F403635

General Info

Members Datasets Scaffolds Average Seq Length
316 187 633 160

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_11521599|Ga0105240_115215991
Length 185
Sequence MVIGHAANLLIFLPIEEFLTNFGLMDQPKANKISDEKVALGKAENYCAYQERSQQEVRDKLYEWGVYPSIVEGVISKLIENNFLNEERFAIAYATGKFRQKGWGRNKIEQGLKFKKVSDPLIKKALKSIDEDEYLEMLRRIIQKKELSVTEKVSYKRKYKLHQYALSRGFENDLIGDILRDEEMG

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
110 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
111 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
112 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
113 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
160 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
161 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
165 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
166 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
167 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
168 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
171 2738541284 Pedobacter sp. YR016 Isolate Unclassified
172 2738543023 Pedobacter sp. OK628 Isolate Unclassified
173 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
174 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
175 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
176 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
177 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
178 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
179 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
180 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
181 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
182 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
183 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
184 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
185 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
186 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
187 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.3
Metatranscriptomes 0
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.28
Nodule 0
Rhizoplane 0.63
Rhizosphere 86.39
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_11521599 3300009093 Bacteria 701
2 SwRhRL2b_contig_1188869 2162886007 Bacteria 809
3 MBSR1b_contig_9334638 2162886012 Bacteria 1568
4 JGI24741J21665_1022177 3300001915 Bacteria 986
5 JGI24740J21852_10013832 3300001979 Bacteria 2996
6 JGI24739J22299_10067712 3300001989 Bacteria 1115
7 JGI24737J22298_10004484 3300001990 Bacteria 4862
8 JGI24737J22298_10014872 3300001990 Bacteria 2523
9 JGI24735J21928_10000048 3300002067 Bacteria 51228
10 JGI24744J21845_10027442 3300002077 Bacteria 1100
11 JGI25164J39214_1002916 3300002772 Bacteria 2358
12 JGI25165J46597_1000634 3300003214 Bacteria 29066
13 rootH1_10065003 3300003316 Bacteria 7491
14 rootH1_10079750 3300003316 Bacteria 4100
15 rootH1_10079750 3300003323 Bacteria 1538
16 rootH2_10016199 3300003320 Bacteria 99895
17 rootH1_10024899 3300003323 Bacteria 34477
18 rootH1_10090188 3300003323 Bacteria 4386
19 rootH1_10316821 3300003323 Bacteria 1079
20 Ga0065714_10187910 3300005288 Bacteria 933
21 Ga0065714_10212259 3300005288 Bacteria 863
22 Ga0065714_10270957 3300005288 Bacteria 739
23 Ga0065714_10304567 3300005288 Bacteria 683
24 Ga0065715_10001465 3300005293 Bacteria 7524
25 Ga0070658_10000019 3300005327 Bacteria 194742
26 Ga0070658_10133912 3300005327 Bacteria 2067
27 Ga0070658_10591672 3300005327 Bacteria 961
28 Ga0070676_10015810 3300005328 Bacteria 4163
29 Ga0068869_100441684 3300005334 Bacteria 1077
30 Ga0070680_100025882 3300005336 Bacteria 4691
31 Ga0068868_100116656 3300005338 Bacteria 2174
32 Ga0068868_100302633 3300005338 Bacteria 1358
33 Ga0070660_100069803 3300005339 Bacteria 2741
34 Ga0070689_100123590 3300005340 Bacteria 2069
35 Ga0070671_100010818 3300005355 Bacteria 7322
36 Ga0070673_100003609 3300005364 Bacteria 9677
37 Ga0070688_100018422 3300005365 Bacteria 4029
38 Ga0070659_100000318 3300005366 Bacteria 37333
39 Ga0070659_100071792 3300005366 Bacteria 2754
40 Ga0070659_100970635 3300005366 Bacteria 745
41 Ga0070663_100158156 3300005455 Bacteria 1743
42 Ga0070678_100001108 3300005456 Bacteria 14126
43 Ga0070678_100735395 3300005456 Bacteria 891
44 Ga0070662_100003334 3300005457 Bacteria 10015
45 Ga0070681_10128556 3300005458 Bacteria 2466
46 Ga0068867_100000136 3300005459 Bacteria 47486
47 Ga0070685_10038676 3300005466 Unclassified 2706
48 Ga0070679_100376983 3300005530 Bacteria 1365
49 Ga0070693_100724438 3300005547 Unclassified 730
50 Ga0070665_100000003 3300005548 Bacteria 811857
51 Ga0068855_100000073 3300005563 Bacteria 121126
52 Ga0068855_100029344 3300005563 Bacteria 6577
53 Ga0068855_100033475 3300005563 Bacteria 6133
54 Ga0068855_100867235 3300005563 Bacteria 956
55 Ga0068857_101556954 3300005577 Bacteria 645
56 Ga0068856_100002043 3300005614 Bacteria 20938
57 Ga0068856_100177980 3300005614 Bacteria 2139
58 Ga0068856_100900389 3300005614 Bacteria 904
59 Ga0068866_10090430 3300005718 Bacteria 1666
60 Ga0081539_10026827 3300005985 Bacteria 3662
61 Ga0075366_10000412 3300006195 Bacteria 19976
62 Ga0075366_10000734 3300006195 Bacteria 15602
63 Ga0075366_10204482 3300006195 Bacteria 1201
64 Ga0075366_10242164 3300006195 Bacteria 1099
65 Ga0097621_100000417 3300006237 Bacteria 29675
66 Ga0097621_100910410 3300006237 Bacteria 820
67 Ga0068871_100000652 3300006358 Bacteria 23848
68 Ga0068865_100000067 3300006881 Bacteria 54449
69 Ga0105240_10000722 3300009093 Bacteria 60400
70 Ga0105240_10025869 3300009093 Bacteria 7706
71 Ga0105240_10138150 3300009093 Bacteria 2916
72 Ga0105240_10447504 3300009093 Bacteria 1446
73 Ga0105240_11207653 3300009093 Bacteria 801
74 Ga0105240_11210215 3300009093 Bacteria 800
75 Ga0105240_11222486 3300009093 Bacteria 795
76 Ga0111539_11499533 3300009094 Unclassified 782
77 Ga0105245_10895072 3300009098 Bacteria 929
78 Ga0105243_10577240 3300009148 Bacteria 1079
79 Ga0105241_10003437 3300009174 Bacteria 11784
80 Ga0105241_10031778 3300009174 Bacteria 3953
81 Ga0105241_10365964 3300009174 Bacteria 1256
82 Ga0105241_10401112 3300009174 Unclassified 1203
83 Ga0105242_10296591 3300009176 Bacteria 1474
84 Ga0105242_11085934 3300009176 Bacteria 813
85 Ga0105237_10003926 3300009545 Bacteria 17413
86 Ga0105237_10014131 3300009545 Bacteria 8355
87 Ga0105237_10068896 3300009545 Bacteria 3532
88 Ga0105237_10200737 3300009545 Bacteria 1994
89 Ga0105237_10485119 3300009545 Bacteria 1242
90 Ga0105237_10786022 3300009545 Bacteria 958
91 Ga0105238_10587989 3300009551 Bacteria 1120
92 Ga0105249_10164263 3300009553 Bacteria 2148
93 Ga0105239_10002733 3300010375 Bacteria 22146
94 Ga0105239_10003420 3300010375 Bacteria 19460
95 Ga0105239_10008214 3300010375 Bacteria 11907
96 Ga0105239_10018512 3300010375 Bacteria 7694
97 Ga0105239_11340796 3300010375 Bacteria 826
98 Ga0105239_11454498 3300010375 Bacteria 792
99 Ga0105246_10987957 3300011119 Bacteria 761
100 Ga0157373_10008356 3300013100 Bacteria 7692
101 Ga0157373_10136071 3300013100 Bacteria 1727
102 Ga0157371_10016011 3300013102 Bacteria 5608
103 Ga0157371_10028342 3300013102 Bacteria 4056
104 Ga0157370_10132965 3300013104 Bacteria 2320
105 Ga0157369_10002019 3300013105 Bacteria 24475
106 Ga0157369_10059760 3300013105 Bacteria 4111
107 Ga0157374_10004282 3300013296 Bacteria 12005
108 Ga0157374_10005007 3300013296 Bacteria 11119
109 Ga0157374_11960924 3300013296 Bacteria 612
110 Ga0157378_10046788 3300013297 Bacteria 3845
111 Ga0157378_10161560 3300013297 Bacteria 2095
112 Ga0157378_10856707 3300013297 Bacteria 937
113 Ga0163162_10000024 3300013306 Bacteria 188515
114 Ga0163162_10075688 3300013306 Bacteria 3427
115 Ga0163162_10325429 3300013306 Bacteria 1670
116 Ga0163162_10470899 3300013306 Bacteria 1388
117 Ga0163162_11035042 3300013306 Bacteria 929
118 Ga0157372_10000011 3300013307 Bacteria 277202
119 Ga0157372_10000120 3300013307 Bacteria 83586
120 Ga0157372_10155132 3300013307 Bacteria 2644
121 Ga0157375_10011675 3300013308 Bacteria 7760
122 Ga0157375_10021080 3300013308 Bacteria 5968
123 Ga0157375_11277433 3300013308 Bacteria 862
124 Ga0157375_11590406 3300013308 Bacteria 773
125 Ga0157375_12535185 3300013308 Bacteria 612
126 Ga0163163_10070875 3300014325 Bacteria 3472
127 Ga0157380_10000013 3300014326 Bacteria 131248
128 Ga0157377_10287001 3300014745 Bacteria 1081
129 Ga0157376_10799429 3300014969 Bacteria 956
130 Ga0157376_10912311 3300014969 Unclassified 897
131 Ga0163161_10004625 3300017792 Bacteria 9579
132 Ga0163161_10472964 3300017792 Bacteria 1016
133 Ga0213872_10002791 3300021361 Bacteria 9992
134 Ga0207427_100103 3300025231 Bacteria 119618
135 Ga0209437_100024 3300025233 Bacteria 592878
136 Ga0209437_100101 3300025233 Bacteria 226668
137 Ga0209026_1002297 3300025250 Bacteria 7298
138 Ga0209026_1003770 3300025250 Bacteria 4806
139 Ga0209233_1000124 3300025261 Bacteria 226743
140 Ga0209233_1040806 3300025261 Bacteria 1007
141 Ga0207642_10449539 3300025899 Bacteria 780
142 Ga0207647_10000051 3300025904 Bacteria 87826
143 Ga0207647_10340736 3300025904 Bacteria 850
144 Ga0207645_10000067 3300025907 Bacteria 75648
145 Ga0207705_10000069 3300025909 Bacteria 133094
146 Ga0207705_10428125 3300025909 Unclassified 1025
147 Ga0207654_10001814 3300025911 Bacteria 11090
148 Ga0207654_10099320 3300025911 Bacteria 1790
149 Ga0207654_10561857 3300025911 Bacteria 811
150 Ga0207707_10357400 3300025912 Bacteria 1258
151 Ga0207695_10000013 3300025913 Bacteria 821265
152 Ga0207695_10011550 3300025913 Bacteria 10683
153 Ga0207695_10060404 3300025913 Bacteria 3924
154 Ga0207695_10150646 3300025913 Bacteria 2265
155 Ga0207695_10470538 3300025913 Unclassified 1139
156 Ga0207671_10002970 3300025914 Bacteria 17427
157 Ga0207671_10006604 3300025914 Bacteria 10296
158 Ga0207671_10006942 3300025914 Bacteria 9965
159 Ga0207671_10026152 3300025914 Bacteria 4377
160 Ga0207671_10052166 3300025914 Bacteria 3031
161 Ga0207671_10103843 3300025914 Bacteria 2155
162 Ga0207671_10117347 3300025914 Bacteria 2031
163 Ga0207671_10707095 3300025914 Bacteria 801
164 Ga0207660_10018467 3300025917 Bacteria 4649
165 Ga0207657_10145850 3300025919 Bacteria 1931
166 Ga0207657_10180484 3300025919 Bacteria 1706
167 Ga0207652_10472007 3300025921 Bacteria 1130
168 Ga0207694_10290223 3300025924 Bacteria 1345
169 Ga0207687_10315866 3300025927 Bacteria 1263
170 Ga0207644_10030977 3300025931 Bacteria 3725
171 Ga0207690_10000318 3300025932 Bacteria 32496
172 Ga0207690_10032498 3300025932 Bacteria 3349
173 Ga0207706_10005473 3300025933 Bacteria 11839
174 Ga0207686_10033664 3300025934 Bacteria 3061
175 Ga0207709_10000072 3300025935 Bacteria 178084
176 Ga0207704_10000056 3300025938 Bacteria 78848
177 Ga0207689_10494143 3300025942 Bacteria 1025
178 Ga0207689_11113221 3300025942 Unclassified 665
179 Ga0207667_10000009 3300025949 Bacteria 603135
180 Ga0207667_10119301 3300025949 Bacteria 2718
181 Ga0207667_10226997 3300025949 Bacteria 1913
182 Ga0207667_11106596 3300025949 Bacteria 775
183 Ga0207651_10001950 3300025960 Bacteria 9699
184 Ga0207640_10782380 3300025981 Bacteria 825
185 Ga0207677_10290141 3300026023 Bacteria 1347
186 Ga0207639_10054265 3300026041 Bacteria 3063
187 Ga0207678_10084955 3300026067 Bacteria 2706
188 Ga0207702_10007304 3300026078 Bacteria 9444
189 Ga0207702_10034522 3300026078 Bacteria 4229
190 Ga0207702_10868195 3300026078 Bacteria 893
191 Ga0207648_10001841 3300026089 Bacteria 23201
192 Ga0207674_10774592 3300026116 Bacteria 926
193 Ga0207683_10080942 3300026121 Bacteria 2882
194 Ga0207698_10010379 3300026142 Bacteria 5979
195 Ga0207698_10064543 3300026142 Unclassified 2871
196 Ga0268266_10000137 3300028379 Bacteria 140685
197 Ga0307517_10002507 3300028786 Bacteria 29365
198 Ga0307515_10002439 3300028794 Bacteria 40495
199 Ga0307515_10003653 3300028794 Bacteria 32336
200 Ga0316177_1055273 3300030731 Bacteria 1491
201 Ga0316176_1019983 3300030732 Bacteria 5317
202 Ga0316183_1205599 3300030742 Bacteria 27167
203 Ga0316181_1039405 3300030744 Bacteria 12554
204 Ga0316182_1024000 3300030745 Bacteria 1428
205 Ga0307408_100029239 3300031548 Bacteria 3815
206 Ga0307408_100080471 3300031548 Bacteria 2433
207 Ga0307405_10002409 3300031731 Bacteria 8233
208 Ga0307412_10035273 3300031911 Bacteria 3194
209 Ga0307412_10436139 3300031911 Bacteria 1075
210 Ga0307414_10043731 3300032004 Bacteria 3053
211 Ga0307414_10054520 3300032004 Bacteria 2794
212 Ga0307414_10069401 3300032004 Bacteria 2534
213 Ga0307414_10391278 3300032004 Bacteria 1205
214 Ga0307414_10788202 3300032004 Bacteria 866
215 Ga0307411_10394012 3300032005 Bacteria 1143
216 Ga0373941_0006217 3300035115 Bacteria 2865
217 Ga0395899_0000001 3300037312 Bacteria 1750322
218 Ga0395899_0000547 3300037312 Bacteria 40664
219 Ga0395899_0000796 3300037312 Bacteria 30874
220 Ga0395899_0115654 3300037312 Bacteria 1925
221 Ga0395900_0000014 3300037418 Bacteria 386513
222 Ga0395900_0001002 3300037418 Bacteria 36638
223 Ga0395900_0124670 3300037418 Bacteria 2642
224 Ga0395898_0012314 3300037466 Bacteria 8844
225 Ga0395905_0000520 3300037471 Bacteria 52744
226 Ga0395905_0001097 3300037471 Bacteria 34059
227 Ga0395901_0000523 3300038443 Bacteria 44364
228 Ga0395901_0009717 3300038443 Bacteria 9754
229 Ga0395901_0846890 3300038443 Bacteria 900
230 Ga0436361_0504524 3300039447 Bacteria 10480
231 Ga0451807_2269413 3300041486 Bacteria 709
232 Ga0439455_0041786 3300042012 Bacteria 1176
233 Ga0466961_0257991 3300044693 Bacteria 1069
234 Ga0466959_0082308 3300045049 Bacteria 2319
235 Ga0495629_0399103 3300046459 Bacteria 935
236 Ga0495638_0209765 3300046460 Bacteria 1095
237 Ga0495650_0000036 3300046471 Bacteria 400633
238 Ga0495650_0132076 3300046471 Bacteria 910
239 Ga0495605_0325680 3300046474 Bacteria 647
240 Ga0495585_0000246 3300046492 Bacteria 56090
241 Ga0495585_0022158 3300046492 Bacteria 3647
242 Ga0495607_0347694 3300046501 Bacteria 685
243 Ga0495583_0023996 3300046506 Bacteria 3074
244 Ga0495606_0012256 3300046507 Bacteria 6896
245 Ga0495606_0085517 3300046507 Bacteria 1951
246 Ga0495606_0087171 3300046507 Bacteria 1928
247 Ga0495606_0127472 3300046507 Bacteria 1516
248 Ga0495610_0000757 3300046512 Bacteria 30503
249 Ga0495616_0009964 3300046513 Bacteria 5524
250 Ga0495616_0013313 3300046513 Bacteria 4644
251 Ga0495631_0022740 3300046518 Bacteria 2914
252 Ga0495648_0000390 3300046524 Bacteria 48133
253 Ga0495648_0017135 3300046524 Bacteria 5191
254 Ga0495652_0329165 3300046529 Bacteria 1101
255 Ga0495609_0001678 3300046538 Bacteria 14363
256 Ga0495622_0221340 3300046557 Bacteria 838
257 Ga0495633_0000233 3300046558 Bacteria 67958
258 Ga0495633_0021672 3300046558 Bacteria 3210
259 Ga0495668_0000044 3300046616 Bacteria 227585
260 Ga0495611_0066164 3300046648 Bacteria 1648
261 Ga0495625_0000379 3300046660 Bacteria 67828
262 Ga0495625_0000772 3300046660 Bacteria 44536
263 Ga0495625_0201999 3300046660 Bacteria 1311
264 Ga0495625_0248403 3300046660 Bacteria 1155
265 Ga0495625_0378725 3300046660 Bacteria 888
266 Ga0495625_0423070 3300046660 Bacteria 828
267 Ga0495661_0000702 3300046665 Bacteria 33210
268 Ga0495661_0004466 3300046665 Bacteria 10092
269 Ga0495661_0198161 3300046665 Bacteria 1053
270 Ga0495588_0179797 3300046674 Bacteria 1118
271 Ga0495669_0326199 3300046684 Bacteria 741
272 Ga0495671_0080669 3300046692 Bacteria 1594
273 Ga0495649_0000010 3300046694 Bacteria 430552
274 Ga0495660_0133610 3300046810 Bacteria 1242
275 Ga0495660_0198619 3300046810 Bacteria 959
276 Ga0495687_015735 3300047443 Bacteria 3834
277 Ga0495687_020751 3300047443 Bacteria 3197
278 Ga0495687_111079 3300047443 Bacteria 1007
279 Ga0495673_0030372 3300047469 Bacteria 2538
280 Ga0495686_0000196 3300047472 Bacteria 112875
281 Ga0495686_0004135 3300047472 Bacteria 12083
282 Ga0495686_0150715 3300047472 Bacteria 1365
283 Ga0495686_0217365 3300047472 Unclassified 1089
284 Ga0495614_0016639 3300048089 Bacteria 3199
285 Ga0495678_026790 3300049459 Bacteria 2454
286 Ga0501223_000747 3300049663 Bacteria 7734
287 Ga0501280_055304 3300049776 Bacteria 677
288 nmdc:mga0k408_222757_c1 3300050493 Bacteria 1126
289 nmdc:mga0k408_223170_c1 3300050493 Bacteria 1125
290 nmdc:mga0k408_234_c1 3300050493 Bacteria 29698
291 nmdc:mga0k408_605_c2 3300050493 Bacteria 15618
292 Ga0500635_0001826 3300053080 Bacteria 5200
293 Ga0500608_000318 3300053122 Bacteria 18520
294 Ga0500608_001848 3300053122 Bacteria 7546
295 Ga0500614_068677 3300053123 Bacteria 968
296 Ga0500642_0164318 3300053130 Bacteria 1040
297 Ga0500619_155094 3300053154 Bacteria 778
298 Ga0500624_001454 3300053157 Bacteria 3804
299 Ga0500636_0257819 3300053177 Bacteria 885
300 2599481003 2599185184 Bacteria 6430550
301 2738760557 2738541284 Bacteria 5199923
302 2739300643 2738543023 Bacteria 6767879
303 2842908397 2842903701 Bacteria 6986368
304 2852623877 2852623160 Bacteria 4376875
305 2884937219 2884933994 Bacteria 4535041
306 2896318097 2896317667 Bacteria 4606601
307 2902051727 2902048731 Bacteria 4976191
308 2904783902 2904780799 Bacteria 5840761
309 2911139021 2911138879 Bacteria 5811561
310 2919181840 2919177583 Bacteria 5641607
311 2919438395 2919437846 Bacteria 6199444
312 2928080915 2928078545 Bacteria 6534839
313 2928150178 2928147474 Bacteria 6512076
314 2932088256 2932082852 Bacteria 6563563
315 2977232743 2977232053 Bacteria 5485925
316 3003234074 3003233435 Bacteria 4458031
317 8055589206 8055588893 Bacteria 3619545
318 Ga0105240_11521599
319 SwRhRL2b_contig_1188869
320 MBSR1b_contig_9334638
321 JGI24741J21665_1022177
322 JGI24740J21852_10013832
323 JGI24739J22299_10067712
324 JGI24737J22298_10004484
325 JGI24737J22298_10014872
326 JGI24735J21928_10000048
327 JGI24744J21845_10027442
328 JGI25164J39214_1002916
329 JGI25165J46597_1000634
330 rootH1_10065003
331 rootH1_10079750
332 rootH2_10016199
333 rootH1_10024899
334 rootH1_10090188
335 rootH1_10316821
336 Ga0065714_10187910
337 Ga0065714_10212259
338 Ga0065714_10270957
339 Ga0065714_10304567
340 Ga0065715_10001465
341 Ga0070658_10000019
342 Ga0070658_10133912
343 Ga0070658_10591672
344 Ga0070676_10015810
345 Ga0068869_100441684
346 Ga0070680_100025882
347 Ga0068868_100116656
348 Ga0068868_100302633
349 Ga0070660_100069803
350 Ga0070689_100123590
351 Ga0070671_100010818
352 Ga0070673_100003609
353 Ga0070688_100018422
354 Ga0070659_100000318
355 Ga0070659_100071792
356 Ga0070659_100970635
357 Ga0070663_100158156
358 Ga0070678_100001108
359 Ga0070678_100735395
360 Ga0070662_100003334
361 Ga0070681_10128556
362 Ga0068867_100000136
363 Ga0070685_10038676
364 Ga0070679_100376983
365 Ga0070693_100724438
366 Ga0070665_100000003
367 Ga0068855_100000073
368 Ga0068855_100029344
369 Ga0068855_100033475
370 Ga0068855_100867235
371 Ga0068857_101556954
372 Ga0068856_100002043
373 Ga0068856_100177980
374 Ga0068856_100900389
375 Ga0068866_10090430
376 Ga0081539_10026827
377 Ga0075366_10000412
378 Ga0075366_10000734
379 Ga0075366_10204482
380 Ga0075366_10242164
381 Ga0097621_100000417
382 Ga0097621_100910410
383 Ga0068871_100000652
384 Ga0068865_100000067
385 Ga0105240_10000722
386 Ga0105240_10025869
387 Ga0105240_10138150
388 Ga0105240_10447504
389 Ga0105240_11207653
390 Ga0105240_11210215
391 Ga0105240_11222486
392 Ga0111539_11499533
393 Ga0105245_10895072
394 Ga0105243_10577240
395 Ga0105241_10003437
396 Ga0105241_10031778
397 Ga0105241_10365964
398 Ga0105241_10401112
399 Ga0105242_10296591
400 Ga0105242_11085934
401 Ga0105237_10003926
402 Ga0105237_10014131
403 Ga0105237_10068896
404 Ga0105237_10200737
405 Ga0105237_10485119
406 Ga0105237_10786022
407 Ga0105238_10587989
408 Ga0105249_10164263
409 Ga0105239_10002733
410 Ga0105239_10003420
411 Ga0105239_10008214
412 Ga0105239_10018512
413 Ga0105239_11340796
414 Ga0105239_11454498
415 Ga0105246_10987957
416 Ga0157373_10008356
417 Ga0157373_10136071
418 Ga0157371_10016011
419 Ga0157371_10028342
420 Ga0157370_10132965
421 Ga0157369_10002019
422 Ga0157369_10059760
423 Ga0157374_10004282
424 Ga0157374_10005007
425 Ga0157374_11960924
426 Ga0157378_10046788
427 Ga0157378_10161560
428 Ga0157378_10856707
429 Ga0163162_10000024
430 Ga0163162_10075688
431 Ga0163162_10325429
432 Ga0163162_10470899
433 Ga0163162_11035042
434 Ga0157372_10000011
435 Ga0157372_10000120
436 Ga0157372_10155132
437 Ga0157375_10011675
438 Ga0157375_10021080
439 Ga0157375_11277433
440 Ga0157375_11590406
441 Ga0157375_12535185
442 Ga0163163_10070875
443 Ga0157380_10000013
444 Ga0157377_10287001
445 Ga0157376_10799429
446 Ga0157376_10912311
447 Ga0163161_10004625
448 Ga0163161_10472964
449 Ga0213872_10002791
450 Ga0207427_100103
451 Ga0209437_100024
452 Ga0209437_100101
453 Ga0209026_1002297
454 Ga0209026_1003770
455 Ga0209233_1000124
456 Ga0209233_1040806
457 Ga0207642_10449539
458 Ga0207647_10000051
459 Ga0207647_10340736
460 Ga0207645_10000067
461 Ga0207705_10000069
462 Ga0207705_10428125
463 Ga0207654_10001814
464 Ga0207654_10099320
465 Ga0207654_10561857
466 Ga0207707_10357400
467 Ga0207695_10000013
468 Ga0207695_10011550
469 Ga0207695_10060404
470 Ga0207695_10150646
471 Ga0207695_10470538
472 Ga0207671_10002970
473 Ga0207671_10006604
474 Ga0207671_10006942
475 Ga0207671_10026152
476 Ga0207671_10052166
477 Ga0207671_10103843
478 Ga0207671_10117347
479 Ga0207671_10707095
480 Ga0207660_10018467
481 Ga0207657_10145850
482 Ga0207657_10180484
483 Ga0207652_10472007
484 Ga0207694_10290223
485 Ga0207687_10315866
486 Ga0207644_10030977
487 Ga0207690_10000318
488 Ga0207690_10032498
489 Ga0207706_10005473
490 Ga0207686_10033664
491 Ga0207709_10000072
492 Ga0207704_10000056
493 Ga0207689_10494143
494 Ga0207689_11113221
495 Ga0207667_10000009
496 Ga0207667_10119301
497 Ga0207667_10226997
498 Ga0207667_11106596
499 Ga0207651_10001950
500 Ga0207640_10782380
501 Ga0207677_10290141
502 Ga0207639_10054265
503 Ga0207678_10084955
504 Ga0207702_10007304
505 Ga0207702_10034522
506 Ga0207702_10868195
507 Ga0207648_10001841
508 Ga0207674_10774592
509 Ga0207683_10080942
510 Ga0207698_10010379
511 Ga0207698_10064543
512 Ga0268266_10000137
513 Ga0307517_10002507
514 Ga0307515_10002439
515 Ga0307515_10003653
516 Ga0316177_1055273
517 Ga0316176_1019983
518 Ga0316183_1205599
519 Ga0316181_1039405
520 Ga0316182_1024000
521 Ga0307408_100029239
522 Ga0307408_100080471
523 Ga0307405_10002409
524 Ga0307412_10035273
525 Ga0307412_10436139
526 Ga0307414_10043731
527 Ga0307414_10054520
528 Ga0307414_10069401
529 Ga0307414_10391278
530 Ga0307414_10788202
531 Ga0307411_10394012
532 Ga0373941_0006217
533 Ga0395899_0000001
534 Ga0395899_0000547
535 Ga0395899_0000796
536 Ga0395899_0115654
537 Ga0395900_0000014
538 Ga0395900_0001002
539 Ga0395900_0124670
540 Ga0395898_0012314
541 Ga0395905_0000520
542 Ga0395905_0001097
543 Ga0395901_0000523
544 Ga0395901_0009717
545 Ga0395901_0846890
546 Ga0436361_0504524
547 Ga0451807_2269413
548 Ga0439455_0041786
549 Ga0466961_0257991
550 Ga0466959_0082308
551 Ga0495629_0399103
552 Ga0495638_0209765
553 Ga0495650_0000036
554 Ga0495650_0132076
555 Ga0495605_0325680
556 Ga0495585_0000246
557 Ga0495585_0022158
558 Ga0495607_0347694
559 Ga0495583_0023996
560 Ga0495606_0012256
561 Ga0495606_0085517
562 Ga0495606_0087171
563 Ga0495606_0127472
564 Ga0495610_0000757
565 Ga0495616_0009964
566 Ga0495616_0013313
567 Ga0495631_0022740
568 Ga0495648_0000390
569 Ga0495648_0017135
570 Ga0495652_0329165
571 Ga0495609_0001678
572 Ga0495622_0221340
573 Ga0495633_0000233
574 Ga0495633_0021672
575 Ga0495668_0000044
576 Ga0495611_0066164
577 Ga0495625_0000379
578 Ga0495625_0000772
579 Ga0495625_0201999
580 Ga0495625_0248403
581 Ga0495625_0378725
582 Ga0495625_0423070
583 Ga0495661_0000702
584 Ga0495661_0004466
585 Ga0495661_0198161
586 Ga0495588_0179797
587 Ga0495669_0326199
588 Ga0495671_0080669
589 Ga0495649_0000010
590 Ga0495660_0133610
591 Ga0495660_0198619
592 Ga0495687_015735
593 Ga0495687_020751
594 Ga0495687_111079
595 Ga0495673_0030372
596 Ga0495686_0000196
597 Ga0495686_0004135
598 Ga0495686_0150715
599 Ga0495686_0217365
600 Ga0495614_0016639
601 Ga0495678_026790
602 Ga0501223_000747
603 Ga0501280_055304
604 nmdc:mga0k408_222757_c1
605 nmdc:mga0k408_223170_c1
606 nmdc:mga0k408_234_c1
607 nmdc:mga0k408_605_c2
608 Ga0500635_0001826
609 Ga0500608_000318
610 Ga0500608_001848
611 Ga0500614_068677
612 Ga0500642_0164318
613 Ga0500619_155094
614 Ga0500624_001454
615 Ga0500636_0257819
616 2599481003
617 2738760557
618 2739300643
619 2842908397
620 2852623877
621 2884937219
622 2896318097
623 2902051727
624 2904783902
625 2911139021
626 2919181840
627 2919438395
628 2928080915
629 2928150178
630 2932088256
631 2977232743
632 3003234074
633 8055589206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02631

RecX_HTH2

RecX, second three-helix domain

85

126

0.99

PF21982

RecX_HTH1

RecX, first three-helix domain

39

78

0.97

PF21981

RecX_HTH3

RecX, third three-helix domain

131

179

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e3v-assembly1.cif.gz_A crystal structure of recx from lactobacillus salivarius 0.8901 14 159
3d5l-assembly2.cif.gz_B crystal structure of regulatory protein recx 0.8696 17 158
3c1d-assembly3.cif.gz_B x-ray crystal structure of recx 0.8566 14 156
3d5l-assembly1.cif.gz_A crystal structure of regulatory protein recx 0.8519 14 158
3c1d-assembly3.cif.gz_A x-ray crystal structure of recx 0.8495 14 156
ID Description Score Start End Superfamily
3e3vA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9542 63 103 1.10.10.10
3e3vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9276 14 61 1.10.10.10
af_Q2G2G9_1_107_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9184 14 61 1.10.10.10
3e3vA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9035 113 159 1.10.10.10
3d5lA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8968 113 158 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y1V3D8-F1-model_v4 Regulatory protein RecX 0.9867 6 159 GO:0005737
GO:0006282
AF-A0A1I3J7S8-F1-model_v4 Regulatory protein RecX 0.9845 16 162 GO:0005737
GO:0006282
AF-A0A389LT78-F1-model_v4 Regulatory protein RecX 0.9841 10 159 GO:0005737
GO:0006282
AF-A0A496L7S1-F1-model_v4 Regulatory protein RecX 0.9812 12 159 GO:0005737
GO:0006282
AF-A0A496C8T8-F1-model_v4 Regulatory protein RecX 0.9809 11 158 GO:0005737
GO:0006282

Map