F403667

General Info

Members Datasets Scaffolds Average Seq Length
316 170 316 250

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10110937|Ga0105237_101109373
Length 229
Sequence MQTFLSMFPIQASTHAAEVDHMTILVHWLMLVKGANPKASYTGAHGKFAKSTEVAVAVIEIGILIFYAIPAWATRVKAFPAESQAVVVRVVAEQFAWNVHYPGPDGKFGRTDIKLVSADNPLGLDRSDPNAKDDITTINQLNLPVDRPVLVHLSSKDVIHSFGLYEMRVKQDAVPGLDIPVWFIPNRIGDYEITCSQLCGLGHYRMRGFVNIRSQADYEKFLASGGQNP

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
127 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
128 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
129 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 5.38
Rhizosphere 94.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10147026 3300005288 Bacteria 1117
2 Ga0065712_10142937 3300005290 Bacteria 1430
3 Ga0065715_10176386 3300005293 Bacteria 1508
4 Ga0065707_10045599 3300005295 Bacteria 1138
5 Ga0065707_10105703 3300005295 Unclassified 2632
6 Ga0070676_10005359 3300005328 Bacteria 6831
7 Ga0070690_100010063 3300005330 Bacteria 5490
8 Ga0070690_100346528 3300005330 Unclassified 1077
9 Ga0070670_100032321 3300005331 Bacteria 4507
10 Ga0070666_10087272 3300005335 Bacteria 2138
11 Ga0070666_10172321 3300005335 Bacteria 1516
12 Ga0070666_10230231 3300005335 Unclassified 1308
13 Ga0070680_100515138 3300005336 Bacteria 1024
14 Ga0070689_100069682 3300005340 Bacteria 2744
15 Ga0070689_100093909 3300005340 Bacteria 2368
16 Ga0070691_10001728 3300005341 Bacteria 9485
17 Ga0070687_100229439 3300005343 Unclassified 1142
18 Ga0070661_100629915 3300005344 Bacteria 869
19 Ga0070692_10105342 3300005345 Unclassified 1552
20 Ga0070668_100208239 3300005347 Bacteria 1608
21 Ga0070668_100208643 3300005347 Bacteria 1606
22 Ga0070669_100023632 3300005353 Bacteria 4402
23 Ga0070669_100031544 3300005353 Bacteria 3827
24 Ga0070669_100053128 3300005353 Bacteria 2965
25 Ga0070675_100298106 3300005354 Bacteria 1420
26 Ga0070674_100170957 3300005356 Bacteria 1657
27 Ga0070674_100373758 3300005356 Bacteria 1158
28 Ga0070673_100074187 3300005364 Bacteria 2741
29 Ga0070673_100125491 3300005364 Bacteria 2147
30 Ga0070673_100528049 3300005364 Bacteria 1070
31 Ga0070688_100029659 3300005365 Bacteria 3277
32 Ga0070688_100067596 3300005365 Bacteria 2277
33 Ga0070688_100173387 3300005365 Bacteria 1490
34 Ga0070667_100057160 3300005367 Unclassified 3296
35 Ga0070667_100135860 3300005367 Unclassified 2150
36 Ga0070667_100405111 3300005367 Unclassified 1242
37 Ga0070714_100016015 3300005435 Bacteria 6044
38 Ga0070701_10034778 3300005438 Bacteria 2526
39 Ga0070705_100016790 3300005440 Bacteria 3810
40 Ga0070705_100035361 3300005440 Unclassified 2800
41 Ga0070700_100010175 3300005441 Bacteria 5185
42 Ga0070694_100010066 3300005444 Bacteria 5815
43 Ga0070694_100350444 3300005444 Bacteria 1144
44 Ga0070678_100419909 3300005456 Bacteria 1166
45 Ga0070662_100117152 3300005457 Bacteria 2037
46 Ga0068867_100012807 3300005459 Bacteria 5934
47 Ga0068867_100051864 3300005459 Bacteria 3026
48 Ga0070685_10064369 3300005466 Bacteria 2156
49 Ga0070707_100121089 3300005468 Bacteria 2541
50 Ga0070698_100026990 3300005471 Bacteria 5972
51 Ga0070698_100055411 3300005471 Bacteria 4020
52 Ga0070699_100009880 3300005518 Bacteria 8263
53 Ga0070697_100030202 3300005536 Bacteria 4352
54 Ga0070697_100277982 3300005536 Unclassified 1436
55 Ga0070672_100016241 3300005543 Bacteria 5325
56 Ga0070686_100002486 3300005544 Bacteria 10150
57 Ga0070686_100235642 3300005544 Unclassified 1330
58 Ga0070686_100312770 3300005544 Bacteria 1168
59 Ga0070686_100378477 3300005544 Bacteria 1071
60 Ga0070695_100003699 3300005545 Bacteria 8913
61 Ga0070695_100013076 3300005545 Bacteria 4986
62 Ga0070695_100308722 3300005545 Bacteria 1172
63 Ga0070696_100026541 3300005546 Bacteria 3941
64 Ga0070665_100008701 3300005548 Bacteria 10272
65 Ga0070704_100010915 3300005549 Bacteria 5540
66 Ga0070704_100020400 3300005549 Bacteria 4272
67 Ga0070664_100315803 3300005564 Bacteria 1415
68 Ga0068854_100021646 3300005578 Bacteria 4365
69 Ga0068854_100059875 3300005578 Bacteria 2753
70 Ga0070702_100001638 3300005615 Bacteria 9276
71 Ga0068852_100163187 3300005616 Bacteria 2082
72 Ga0068859_100262972 3300005617 Bacteria 1817
73 Ga0068859_100457113 3300005617 Unclassified 1373
74 Ga0068864_100042832 3300005618 Bacteria 3874
75 Ga0068866_10203753 3300005718 Bacteria 1184
76 Ga0068861_100018796 3300005719 Bacteria 4927
77 Ga0068863_100079860 3300005841 Unclassified 3098
78 Ga0068863_100140616 3300005841 Unclassified 2307
79 Ga0068858_100021298 3300005842 Bacteria 6055
80 Ga0068858_100161492 3300005842 Unclassified 2110
81 Ga0068858_100170416 3300005842 Bacteria 2053
82 Ga0068858_100343546 3300005842 Bacteria 1429
83 Ga0068858_100418173 3300005842 Bacteria 1289
84 Ga0068860_100047666 3300005843 Bacteria 4083
85 Ga0068862_100106106 3300005844 Bacteria 2462
86 Ga0068862_100122167 3300005844 Bacteria 2296
87 Ga0081455_10234714 3300005937 Bacteria 1351
88 Ga0081539_10128447 3300005985 Bacteria 1248
89 Ga0081539_10165193 3300005985 Bacteria 1051
90 Ga0070716_100520446 3300006173 Bacteria 881
91 Ga0097621_100198513 3300006237 Bacteria 1740
92 Ga0097621_100240959 3300006237 Unclassified 1581
93 Ga0097621_100503943 3300006237 Bacteria 1097
94 Ga0068871_100021916 3300006358 Bacteria 4920
95 Ga0068871_100231266 3300006358 Unclassified 1604
96 Ga0068871_100609001 3300006358 Bacteria 994
97 Ga0075428_100116199 3300006844 Bacteria 2914
98 Ga0075433_10249075 3300006852 Bacteria 1576
99 Ga0075433_10264412 3300006852 Unclassified 1525
100 Ga0075434_100004066 3300006871 Bacteria 13112
101 Ga0075434_100108885 3300006871 Bacteria 2781
102 Ga0075434_100321138 3300006871 Bacteria 1569
103 Ga0068865_100342589 3300006881 Bacteria 1208
104 Ga0075436_100010413 3300006914 Bacteria 6374
105 Ga0075436_100064174 3300006914 Unclassified 2538
106 Ga0075436_100093342 3300006914 Bacteria 2092
107 Ga0097620_100262956 3300006931 Bacteria 1817
108 Ga0097620_100457130 3300006931 Unclassified 1373
109 Ga0075435_100001499 3300007076 Bacteria 14991
110 Ga0075435_100020280 3300007076 Bacteria 5090
111 Ga0075435_100116273 3300007076 Unclassified 2228
112 Ga0075435_100162675 3300007076 Bacteria 1880
113 Ga0105240_10042264 3300009093 Bacteria 5809
114 Ga0105240_10423646 3300009093 Unclassified 1495
115 Ga0111539_10026076 3300009094 Bacteria 7155
116 Ga0111539_10172376 3300009094 Bacteria 2528
117 Ga0111539_10390884 3300009094 Bacteria 1620
118 Ga0111539_10411923 3300009094 Bacteria 1574
119 Ga0105245_10044442 3300009098 Bacteria 3965
120 Ga0105247_10012411 3300009101 Bacteria 5117
121 Ga0114129_10001435 3300009147 Bacteria 32173
122 Ga0114129_10022782 3300009147 Bacteria 8880
123 Ga0114129_10045015 3300009147 Bacteria 6206
124 Ga0114129_10114829 3300009147 Bacteria 3712
125 Ga0114129_11120609 3300009147 Bacteria 984
126 Ga0105243_10009374 3300009148 Bacteria 7459
127 Ga0105243_10495634 3300009148 Bacteria 1156
128 Ga0105241_10037687 3300009174 Bacteria 3642
129 Ga0105242_10003751 3300009176 Bacteria 11808
130 Ga0105242_10017552 3300009176 Bacteria 5580
131 Ga0105248_10006216 3300009177 Bacteria 13093
132 Ga0105248_10018733 3300009177 Bacteria 7655
133 Ga0105248_10032706 3300009177 Bacteria 5809
134 Ga0105248_10064373 3300009177 Bacteria 4117
135 Ga0105248_10082101 3300009177 Bacteria 3623
136 Ga0105248_10085283 3300009177 Bacteria 3554
137 Ga0105248_10225859 3300009177 Bacteria 2107
138 Ga0105248_10302393 3300009177 Bacteria 1801
139 Ga0105248_11105938 3300009177 Bacteria 896
140 Ga0105237_10110937 3300009545 Bacteria 2734
141 Ga0105238_10556656 3300009551 Unclassified 1151
142 Ga0157374_10054298 3300013296 Bacteria 3737
143 Ga0157378_10066721 3300013297 Bacteria 3223
144 Ga0157378_10499124 3300013297 Bacteria 1215
145 Ga0163162_10068005 3300013306 Bacteria 3613
146 Ga0163162_10310027 3300013306 Unclassified 1710
147 Ga0157375_10111312 3300013308 Bacteria 2837
148 Ga0157375_10165006 3300013308 Bacteria 2359
149 Ga0163163_10007871 3300014325 Bacteria 9417
150 Ga0157380_10046940 3300014326 Bacteria 3394
151 Ga0157380_10154068 3300014326 Unclassified 1990
152 Ga0157379_10008200 3300014968 Bacteria 9072
153 Ga0157379_10040273 3300014968 Bacteria 4169
154 Ga0157379_10112942 3300014968 Bacteria 2442
155 Ga0157376_10008296 3300014969 Bacteria 7487
156 Ga0157376_10022540 3300014969 Bacteria 4912
157 Ga0157376_10154395 3300014969 Unclassified 2074
158 Ga0207710_10030217 3300025900 Bacteria 2362
159 Ga0207688_10093072 3300025901 Bacteria 1733
160 Ga0207680_10344786 3300025903 Unclassified 1045
161 Ga0207645_10002542 3300025907 Bacteria 14280
162 Ga0207684_10352587 3300025910 Unclassified 1266
163 Ga0207654_10012257 3300025911 Bacteria 4389
164 Ga0207695_10062013 3300025913 Bacteria 3862
165 Ga0207695_10179197 3300025913 Bacteria 2040
166 Ga0207662_10003313 3300025918 Bacteria 8263
167 Ga0207662_10106906 3300025918 Unclassified 1740
168 Ga0207662_10233132 3300025918 Unclassified 1203
169 Ga0207646_10101300 3300025922 Bacteria 2582
170 Ga0207646_10138597 3300025922 Bacteria 2191
171 Ga0207681_10009213 3300025923 Bacteria 6033
172 Ga0207681_10013508 3300025923 Bacteria 5056
173 Ga0207681_10033473 3300025923 Bacteria 3370
174 Ga0207681_10128947 3300025923 Bacteria 1867
175 Ga0207659_10051058 3300025926 Bacteria 2939
176 Ga0207659_10165340 3300025926 Bacteria 1741
177 Ga0207687_10068617 3300025927 Bacteria 2526
178 Ga0207687_10095249 3300025927 Unclassified 2180
179 Ga0207700_10015627 3300025928 Bacteria 5015
180 Ga0207664_10026169 3300025929 Bacteria 4406
181 Ga0207644_10031442 3300025931 Bacteria 3698
182 Ga0207706_10123496 3300025933 Bacteria 2277
183 Ga0207686_10001967 3300025934 Bacteria 11329
184 Ga0207670_10031733 3300025936 Bacteria 3390
185 Ga0207670_10055732 3300025936 Bacteria 2673
186 Ga0207669_10090860 3300025937 Bacteria 1987
187 Ga0207669_10188614 3300025937 Bacteria 1485
188 Ga0207704_10025186 3300025938 Bacteria 3242
189 Ga0207665_10417880 3300025939 Bacteria 1024
190 Ga0207691_10027126 3300025940 Bacteria 5374
191 Ga0207711_10006556 3300025941 Bacteria 9803
192 Ga0207711_10019243 3300025941 Bacteria 5684
193 Ga0207711_10390848 3300025941 Unclassified 1291
194 Ga0207711_10768205 3300025941 Bacteria 898
195 Ga0207689_10333835 3300025942 Unclassified 1259
196 Ga0207661_10462392 3300025944 Bacteria 1157
197 Ga0207651_10045410 3300025960 Bacteria 2947
198 Ga0207651_10793860 3300025960 Bacteria 839
199 Ga0207668_10108571 3300025972 Unclassified 2077
200 Ga0207668_10190408 3300025972 Bacteria 1625
201 Ga0207640_10015460 3300025981 Bacteria 4418
202 Ga0207640_10110221 3300025981 Bacteria 1949
203 Ga0207640_10338540 3300025981 Bacteria 1204
204 Ga0207658_10188435 3300025986 Unclassified 1713
205 Ga0207658_10418285 3300025986 Bacteria 1181
206 Ga0207677_10100524 3300026023 Bacteria 2127
207 Ga0207677_10215835 3300026023 Unclassified 1535
208 Ga0207703_10024929 3300026035 Bacteria 4706
209 Ga0207703_10042300 3300026035 Bacteria 3654
210 Ga0207703_10133512 3300026035 Bacteria 2146
211 Ga0207708_10016993 3300026075 Bacteria 5477
212 Ga0207708_10067854 3300026075 Bacteria 2729
213 Ga0207641_10002008 3300026088 Bacteria 19393
214 Ga0207641_10112287 3300026088 Unclassified 2418
215 Ga0207648_10014508 3300026089 Bacteria 7276
216 Ga0207648_10194312 3300026089 Bacteria 1799
217 Ga0207648_10921823 3300026089 Bacteria 817
218 Ga0207676_10010218 3300026095 Bacteria 6678
219 Ga0207675_100030967 3300026118 Bacteria 4983
220 Ga0207675_100062022 3300026118 Bacteria 3491
221 Ga0207675_100807131 3300026118 Bacteria 952
222 Ga0207683_10408351 3300026121 Bacteria 1250
223 Ga0207698_10149347 3300026142 Bacteria 2026
224 Ga0207428_10080724 3300027907 Bacteria 2540
225 Ga0207428_10082549 3300027907 Bacteria 2508
226 Ga0207428_10198282 3300027907 Bacteria 1511
227 Ga0207428_10271916 3300027907 Bacteria 1259
228 Ga0207428_10281697 3300027907 Unclassified 1234
229 Ga0268266_10006329 3300028379 Bacteria 10851
230 Ga0268265_10017461 3300028380 Bacteria 4953
231 Ga0268265_10141814 3300028380 Bacteria 2013
232 Ga0268265_10562337 3300028380 Bacteria 1084
233 Ga0268265_10723128 3300028380 Bacteria 964
234 Ga0268264_10302214 3300028381 Bacteria 1507
235 Ga0268264_10487031 3300028381 Bacteria 1200
236 Ga0373948_0009697 3300034817 Unclassified 1666
237 Ga0373950_0000159 3300034818 Bacteria 9864
238 Ga0373958_0002198 3300034819 Bacteria 2708
239 Ga0373959_0000541 3300034820 Bacteria 6737
240 Ga0373938_0004149 3300034957 Bacteria 2402
241 Ga0373929_0001210 3300035085 Bacteria 4991
242 Ga0373949_0000697 3300035090 Bacteria 10925
243 Ga0373951_0001237 3300035091 Bacteria 6766
244 Ga0373952_0002397 3300035092 Bacteria 3376
245 Ga0373952_0034005 3300035092 Bacteria 1147
246 Ga0373932_0001647 3300035112 Bacteria 6119
247 Ga0373932_0030003 3300035112 Unclassified 1505
248 Ga0373939_0000518 3300035114 Bacteria 9713
249 Ga0373941_0000527 3300035115 Bacteria 7669
250 Ga0373954_0148795 3300035118 Bacteria 1144
251 Ga0373942_0004245 3300035207 Bacteria 3337
252 Ga0373961_0003053 3300035241 Bacteria 4213
253 Ga0373962_0001536 3300035242 Bacteria 5460
254 Ga0373962_0021443 3300035242 Unclassified 1705
255 Ga0373962_0038828 3300035242 Bacteria 1334
256 Ga0373931_0042912 3300035691 Bacteria 2379
257 Ga0373931_0178848 3300035691 Unclassified 1255
258 Ga0373925_0182805 3300037068 Bacteria 1661
259 Ga0395900_0370558 3300037418 Bacteria 1402
260 Ga0451576_0010034 3300045051 Bacteria 10906
261 Ga0451576_0869951 3300045051 Bacteria 946
262 Ga0495647_0011463 3300046681 Bacteria 3039
263 Ga0495669_0004209 3300046684 Bacteria 5923
264 Ga0495669_0030510 3300046684 Bacteria 2367
265 Ga0495649_0172835 3300046694 Bacteria 1130
266 Ga0496102_0372904 3300048905 Unclassified 1343
267 Ga0496104_0131588 3300048907 Bacteria 2403
268 Ga0496104_0410804 3300048907 Bacteria 1266
269 Ga0496106_0066523 3300048909 Bacteria 2745
270 Ga0496107_0405707 3300048910 Unclassified 1013
271 Ga0496108_0042050 3300048911 Bacteria 3814
272 Ga0496109_0591775 3300048912 Unclassified 1045
273 Ga0496110_0738247 3300048913 Bacteria 887
274 Ga0496111_0318976 3300048914 Bacteria 1151
275 Ga0496112_0009087 3300048915 Bacteria 8929
276 Ga0496112_0091143 3300048915 Bacteria 3017
277 Ga0496112_0196980 3300048915 Unclassified 1975
278 Ga0496112_0218191 3300048915 Unclassified 1864
279 Ga0496112_0837923 3300048915 Bacteria 843
280 Ga0496113_0164192 3300048916 Bacteria 1757
281 Ga0496114_0066540 3300048917 Bacteria 3021
282 Ga0496114_0119659 3300048917 Unclassified 2264
283 Ga0501076_0105008 3300049592 Bacteria 2280
284 nmdc:mga05p37_22585_c1 3300050507 Bacteria 7629
285 nmdc:mga05p37_252990_c1 3300050507 Archaea 2112
286 nmdc:mga05p37_46505_c1 3300050507 Bacteria 5336
287 nmdc:mga05p37_78239_c1 3300050507 Bacteria 4072
288 nmdc:mga05p37_9103_c1 3300050507 Bacteria 11737
289 nmdc:mga09592_75613_c1 3300050508 Bacteria 2863
290 nmdc:mga09592_80868_c1 3300050508 Bacteria 2767
291 nmdc:mga06r32_31557_c1 3300050510 Bacteria 4977
292 nmdc:mga08y16_209424_c1 3300050511 Unclassified 2019
293 nmdc:mga08y16_254144_c1 3300050511 Bacteria 1816
294 nmdc:mga08y16_377337_c1 3300050511 Unclassified 1454
295 nmdc:mga08y16_52037_c1 3300050511 Bacteria 4285
296 nmdc:mga08y16_6656_c1 3300050511 Bacteria 12122
297 nmdc:mga08y16_7157_c1 3300050511 Bacteria 11711
298 nmdc:mga0n895_28384_c1 3300050512 Bacteria 5322
299 nmdc:mga0n895_315166_c1 3300050512 Bacteria 1585
300 nmdc:mga0n895_859_c1 3300050512 Bacteria 21838
301 nmdc:mga0rr50_109_c1 3300050513 Bacteria 46163
302 nmdc:mga0rr50_35265_c1 3300050513 Bacteria 3591
303 nmdc:mga0rr50_44439_c1 3300050513 Bacteria 3258
304 nmdc:mga08x19_224_c1 3300050514 Bacteria 43344
305 nmdc:mga08x19_24050_c1 3300050514 Bacteria 3783
306 nmdc:mga08x19_419420_c1 3300050514 Bacteria 940
307 nmdc:mga08x19_92986_c1 3300050514 Bacteria 1993
308 nmdc:mga08x19_9879_c1 3300050514 Bacteria 5721
309 nmdc:mga0a205_216591_c1 3300050515 Bacteria 1802
310 nmdc:mga0a205_230728_c1 3300050515 Bacteria 1734
311 nmdc:mga0a205_2484_c1 3300050515 Bacteria 16260
312 nmdc:mga0a205_426044_c1 3300050515 Unclassified 1189
313 nmdc:mga0a205_437688_c1 3300050515 Bacteria 1168
314 nmdc:mga0a205_669338_c1 3300050515 Bacteria 889
315 Ga0495619_0212216 3300053085 Unclassified 1341
316 Ga0500658_0159037 3300053134 Bacteria 1022

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046684 Ga0495669_0030510 Ga0495669_0030510_907_1590 219
2 3300050515 nmdc:mga0a205_669338_c1 nmdc:mga0a205_669338_c1_166_873 228
3 3300009545 Ga0105237_10110937 Ga0105237_101109373 229
4 3300005343 Ga0070687_100229439 Ga0070687_1002294392 232
5 3300005340 Ga0070689_100093909 Ga0070689_1000939095 233
6 3300005365 Ga0070688_100029659 Ga0070688_1000296594 233
7 3300009094 Ga0111539_10172376 Ga0111539_101723762 233
8 3300025918 Ga0207662_10106906 Ga0207662_101069062 233
9 3300025936 Ga0207670_10031733 Ga0207670_100317333 233
10 3300027907 Ga0207428_10281697 Ga0207428_102816972 233
11 3300050511 nmdc:mga08y16_377337_c1 nmdc:mga08y16_377337_c1_501_1313 233
12 3300026118 Ga0207675_100807131 Ga0207675_1008071312 234
13 3300050508 nmdc:mga09592_80868_c1 nmdc:mga09592_80868_c1_1633_2457 234
14 3300005617 Ga0068859_100457113 Ga0068859_1004571132 236
15 3300006931 Ga0097620_100457130 Ga0097620_1004571302 236
16 3300027907 Ga0207428_10198282 Ga0207428_101982823 236
17 3300048907 Ga0496104_0410804 Ga0496104_0410804_435_1166 236
18 3300048915 Ga0496112_0091143 Ga0496112_0091143_561_1292 236
19 3300050507 nmdc:mga05p37_252990_c1 nmdc:mga05p37_252990_c1_890_1705 236
20 3300005328 Ga0070676_10005359 Ga0070676_100053596 237
21 3300005341 Ga0070691_10001728 Ga0070691_100017287 237
22 3300005345 Ga0070692_10105342 Ga0070692_101053424 237
23 3300005353 Ga0070669_100023632 Ga0070669_1000236324 237
24 3300005364 Ga0070673_100125491 Ga0070673_1001254911 237
25 3300005438 Ga0070701_10034778 Ga0070701_100347782 237
26 3300005440 Ga0070705_100016790 Ga0070705_1000167906 237
27 3300005441 Ga0070700_100010175 Ga0070700_1000101754 237
28 3300005444 Ga0070694_100010066 Ga0070694_1000100666 237
29 3300005459 Ga0068867_100012807 Ga0068867_1000128076 237
30 3300005544 Ga0070686_100378477 Ga0070686_1003784771 237
31 3300005545 Ga0070695_100013076 Ga0070695_1000130766 237
32 3300005549 Ga0070704_100010915 Ga0070704_1000109154 237
33 3300005578 Ga0068854_100059875 Ga0068854_1000598752 237
34 3300005615 Ga0070702_100001638 Ga0070702_1000016389 237
35 3300005719 Ga0068861_100018796 Ga0068861_1000187965 237
36 3300025907 Ga0207645_10002542 Ga0207645_100025426 237
37 3300025923 Ga0207681_10013508 Ga0207681_100135083 237
38 3300025960 Ga0207651_10045410 Ga0207651_100454106 237
39 3300026075 Ga0207708_10016993 Ga0207708_100169934 237
40 3300026089 Ga0207648_10014508 Ga0207648_100145086 237
41 3300026118 Ga0207675_100030967 Ga0207675_1000309674 237
42 3300005330 Ga0070690_100346528 Ga0070690_1003465281 238
43 3300005336 Ga0070680_100515138 Ga0070680_1005151381 238
44 3300005367 Ga0070667_100135860 Ga0070667_1001358604 238
45 3300005471 Ga0070698_100055411 Ga0070698_1000554113 238
46 3300005548 Ga0070665_100008701 Ga0070665_1000087019 238
47 3300005841 Ga0068863_100140616 Ga0068863_1001406164 238
48 3300005842 Ga0068858_100021298 Ga0068858_1000212985 238
49 3300006237 Ga0097621_100240959 Ga0097621_1002409592 238
50 3300006852 Ga0075433_10249075 Ga0075433_102490753 238
51 3300009093 Ga0105240_10423646 Ga0105240_104236462 238
52 3300009094 Ga0111539_10411923 Ga0111539_104119233 238
53 3300009176 Ga0105242_10017552 Ga0105242_100175524 238
54 3300009177 Ga0105248_10018733 Ga0105248_100187334 238
55 3300009551 Ga0105238_10556656 Ga0105238_105566562 238
56 3300013296 Ga0157374_10054298 Ga0157374_100542985 238
57 3300013306 Ga0163162_10310027 Ga0163162_103100272 238
58 3300014968 Ga0157379_10040273 Ga0157379_100402734 238
59 3300014969 Ga0157376_10008296 Ga0157376_100082964 238
60 3300025913 Ga0207695_10179197 Ga0207695_101791972 238
61 3300025927 Ga0207687_10095249 Ga0207687_100952492 238
62 3300025934 Ga0207686_10001967 Ga0207686_100019676 238
63 3300026035 Ga0207703_10024929 Ga0207703_100249295 238
64 3300026088 Ga0207641_10112287 Ga0207641_101122874 238
65 3300027907 Ga0207428_10082549 Ga0207428_100825495 238
66 3300028379 Ga0268266_10006329 Ga0268266_100063299 238
67 3300035242 Ga0373962_0038828 Ga0373962_0038828_259_1044 238
68 3300035691 Ga0373931_0178848 Ga0373931_0178848_273_1040 238
69 3300048915 Ga0496112_0218191 Ga0496112_0218191_814_1581 238
70 3300048917 Ga0496114_0119659 Ga0496114_0119659_749_1516 238
71 3300050508 nmdc:mga09592_75613_c1 nmdc:mga09592_75613_c1_192_977 238
72 3300050511 nmdc:mga08y16_254144_c1 nmdc:mga08y16_254144_c1_831_1616 238
73 3300050514 nmdc:mga08x19_92986_c1 nmdc:mga08x19_92986_c1_366_1103 238
74 3300050515 nmdc:mga0a205_230728_c1 nmdc:mga0a205_230728_c1_384_1169 238
75 3300050515 nmdc:mga0a205_437688_c1 nmdc:mga0a205_437688_c1_256_1044 238
76 3300005518 Ga0070699_100009880 Ga0070699_1000098806 239
77 3300005618 Ga0068864_100042832 Ga0068864_1000428322 239
78 3300005842 Ga0068858_100170416 Ga0068858_1001704162 239
79 3300006914 Ga0075436_100064174 Ga0075436_1000641744 239
80 3300006914 Ga0075436_100093342 Ga0075436_1000933422 239
81 3300007076 Ga0075435_100116273 Ga0075435_1001162732 239
82 3300009101 Ga0105247_10012411 Ga0105247_100124116 239
83 3300009147 Ga0114129_10001435 Ga0114129_1000143510 239
84 3300009177 Ga0105248_10006216 Ga0105248_1000621610 239
85 3300009177 Ga0105248_10082101 Ga0105248_100821014 239
86 3300014325 Ga0163163_10007871 Ga0163163_100078712 239
87 3300014968 Ga0157379_10112942 Ga0157379_101129422 239
88 3300025900 Ga0207710_10030217 Ga0207710_100302172 239
89 3300025941 Ga0207711_10006556 Ga0207711_100065566 239
90 3300025941 Ga0207711_10390848 Ga0207711_103908482 239
91 3300026035 Ga0207703_10133512 Ga0207703_101335122 239
92 3300026095 Ga0207676_10010218 Ga0207676_100102186 239
93 3300028381 Ga0268264_10302214 Ga0268264_103022141 239
94 3300037418 Ga0395900_0370558 Ga0395900_0370558_558_1304 239
95 3300048907 Ga0496104_0131588 Ga0496104_0131588_715_1488 239
96 3300048910 Ga0496107_0405707 Ga0496107_0405707_61_831 239
97 3300048911 Ga0496108_0042050 Ga0496108_0042050_2617_3390 239
98 3300048913 Ga0496110_0738247 Ga0496110_0738247_53_826 239
99 3300048915 Ga0496112_0009087 Ga0496112_0009087_4598_5371 239
100 3300049592 Ga0501076_0105008 Ga0501076_0105008_958_1701 239
101 3300050507 nmdc:mga05p37_9103_c1 nmdc:mga05p37_9103_c1_8063_8818 239
102 3300050514 nmdc:mga08x19_419420_c1 nmdc:mga08x19_419420_c1_85_837 239
103 3300050514 nmdc:mga08x19_9879_c1 nmdc:mga08x19_9879_c1_1801_2544 239
104 3300050515 nmdc:mga0a205_216591_c1 nmdc:mga0a205_216591_c1_96_851 239
105 3300005295 Ga0065707_10045599 Ga0065707_100455992 240
106 3300005330 Ga0070690_100010063 Ga0070690_1000100631 240
107 3300005335 Ga0070666_10172321 Ga0070666_101723214 240
108 3300005364 Ga0070673_100528049 Ga0070673_1005280492 240
109 3300005457 Ga0070662_100117152 Ga0070662_1001171525 240
110 3300005471 Ga0070698_100026990 Ga0070698_1000269907 240
111 3300005544 Ga0070686_100002486 Ga0070686_10000248610 240
112 3300005578 Ga0068854_100021646 Ga0068854_1000216466 240
113 3300005616 Ga0068852_100163187 Ga0068852_1001631875 240
114 3300005985 Ga0081539_10128447 Ga0081539_101284472 240
115 3300005985 Ga0081539_10165193 Ga0081539_101651931 240
116 3300006871 Ga0075434_100321138 Ga0075434_1003211382 240
117 3300009174 Ga0105241_10037687 Ga0105241_100376876 240
118 3300009177 Ga0105248_10085283 Ga0105248_100852833 240
119 3300009177 Ga0105248_10225859 Ga0105248_102258592 240
120 3300025910 Ga0207684_10352587 Ga0207684_103525872 240
121 3300025911 Ga0207654_10012257 Ga0207654_100122576 240
122 3300025918 Ga0207662_10003313 Ga0207662_100033136 240
123 3300025922 Ga0207646_10138597 Ga0207646_101385973 240
124 3300025933 Ga0207706_10123496 Ga0207706_101234962 240
125 3300025981 Ga0207640_10015460 Ga0207640_100154606 240
126 3300026089 Ga0207648_10921823 Ga0207648_109218231 240
127 3300026142 Ga0207698_10149347 Ga0207698_101493472 240
128 3300034817 Ga0373948_0009697 Ga0373948_0009697_141_890 240
129 3300034818 Ga0373950_0000159 Ga0373950_0000159_3151_3900 240
130 3300034819 Ga0373958_0002198 Ga0373958_0002198_822_1571 240
131 3300034820 Ga0373959_0000541 Ga0373959_0000541_835_1584 240
132 3300034957 Ga0373938_0004149 Ga0373938_0004149_1361_2110 240
133 3300035085 Ga0373929_0001210 Ga0373929_0001210_3113_3862 240
134 3300035090 Ga0373949_0000697 Ga0373949_0000697_3284_4033 240
135 3300035091 Ga0373951_0001237 Ga0373951_0001237_4610_5359 240
136 3300035092 Ga0373952_0002397 Ga0373952_0002397_2089_2838 240
137 3300035112 Ga0373932_0001647 Ga0373932_0001647_1135_1884 240
138 3300035114 Ga0373939_0000518 Ga0373939_0000518_5978_6727 240
139 3300035115 Ga0373941_0000527 Ga0373941_0000527_1193_1942 240
140 3300035207 Ga0373942_0004245 Ga0373942_0004245_2365_3114 240
141 3300035241 Ga0373961_0003053 Ga0373961_0003053_3088_3837 240
142 3300035242 Ga0373962_0001536 Ga0373962_0001536_4675_5424 240
143 3300035691 Ga0373931_0042912 Ga0373931_0042912_387_1136 240
144 3300045051 Ga0451576_0010034 Ga0451576_0010034_945_1694 240
145 3300045051 Ga0451576_0869951 Ga0451576_0869951_28_777 240
146 3300046684 Ga0495669_0004209 Ga0495669_0004209_3770_4516 240
147 3300048909 Ga0496106_0066523 Ga0496106_0066523_1638_2384 240
148 3300050512 nmdc:mga0n895_315166_c1 nmdc:mga0n895_315166_c1_179_922 240
149 3300050513 nmdc:mga0rr50_35265_c1 nmdc:mga0rr50_35265_c1_2498_3244 240
150 3300005331 Ga0070670_100032321 Ga0070670_1000323217 241
151 3300005335 Ga0070666_10087272 Ga0070666_100872722 241
152 3300005340 Ga0070689_100069682 Ga0070689_1000696821 241
153 3300005344 Ga0070661_100629915 Ga0070661_1006299151 241
154 3300005354 Ga0070675_100298106 Ga0070675_1002981061 241
155 3300005356 Ga0070674_100170957 Ga0070674_1001709571 241
156 3300005364 Ga0070673_100074187 Ga0070673_1000741872 241
157 3300005365 Ga0070688_100067596 Ga0070688_1000675964 241
158 3300005435 Ga0070714_100016015 Ga0070714_1000160154 241
159 3300005459 Ga0068867_100051864 Ga0068867_1000518644 241
160 3300005466 Ga0070685_10064369 Ga0070685_100643692 241
161 3300005468 Ga0070707_100121089 Ga0070707_1001210895 241
162 3300005544 Ga0070686_100235642 Ga0070686_1002356422 241
163 3300005545 Ga0070695_100003699 Ga0070695_10000369910 241
164 3300005549 Ga0070704_100020400 Ga0070704_1000204006 241
165 3300005564 Ga0070664_100315803 Ga0070664_1003158031 241
166 3300005842 Ga0068858_100418173 Ga0068858_1004181734 241
167 3300006852 Ga0075433_10264412 Ga0075433_102644122 241
168 3300009093 Ga0105240_10042264 Ga0105240_100422645 241
169 3300009147 Ga0114129_11120609 Ga0114129_111206092 241
170 3300014326 Ga0157380_10046940 Ga0157380_100469406 241
171 3300025913 Ga0207695_10062013 Ga0207695_100620134 241
172 3300025918 Ga0207662_10233132 Ga0207662_102331323 241
173 3300025922 Ga0207646_10101300 Ga0207646_101013005 241
174 3300025923 Ga0207681_10128947 Ga0207681_101289474 241
175 3300025926 Ga0207659_10165340 Ga0207659_101653402 241
176 3300025928 Ga0207700_10015627 Ga0207700_100156272 241
177 3300025929 Ga0207664_10026169 Ga0207664_100261692 241
178 3300025937 Ga0207669_10090860 Ga0207669_100908605 241
179 3300025960 Ga0207651_10793860 Ga0207651_107938601 241
180 3300026089 Ga0207648_10194312 Ga0207648_101943124 241
181 3300027907 Ga0207428_10080724 Ga0207428_100807245 241
182 3300048905 Ga0496102_0372904 Ga0496102_0372904_522_1271 241
183 3300048916 Ga0496113_0164192 Ga0496113_0164192_484_1233 241
184 3300050507 nmdc:mga05p37_22585_c1 nmdc:mga05p37_22585_c1_5730_6491 241
185 3300050511 nmdc:mga08y16_52037_c1 nmdc:mga08y16_52037_c1_857_1606 241
186 3300050515 nmdc:mga0a205_426044_c1 nmdc:mga0a205_426044_c1_344_1105 241
187 3300005295 Ga0065707_10105703 Ga0065707_101057032 242
188 3300005347 Ga0070668_100208239 Ga0070668_1002082392 242
189 3300005353 Ga0070669_100031544 Ga0070669_1000315444 242
190 3300005356 Ga0070674_100373758 Ga0070674_1003737582 242
191 3300005440 Ga0070705_100035361 Ga0070705_1000353612 242
192 3300005546 Ga0070696_100026541 Ga0070696_1000265413 242
193 3300005844 Ga0068862_100106106 Ga0068862_1001061061 242
194 3300006358 Ga0068871_100609001 Ga0068871_1006090012 242
195 3300009094 Ga0111539_10026076 Ga0111539_100260766 242
196 3300009148 Ga0105243_10495634 Ga0105243_104956343 242
197 3300009177 Ga0105248_10302393 Ga0105248_103023932 242
198 3300025901 Ga0207688_10093072 Ga0207688_100930721 242
199 3300025923 Ga0207681_10033473 Ga0207681_100334737 242
200 3300025926 Ga0207659_10051058 Ga0207659_100510582 242
201 3300025937 Ga0207669_10188614 Ga0207669_101886141 242
202 3300025942 Ga0207689_10333835 Ga0207689_103338351 242
203 3300025972 Ga0207668_10108571 Ga0207668_101085712 242
204 3300025981 Ga0207640_10338540 Ga0207640_103385403 242
205 3300026075 Ga0207708_10067854 Ga0207708_100678545 242
206 3300026118 Ga0207675_100062022 Ga0207675_1000620222 242
207 3300028380 Ga0268265_10141814 Ga0268265_101418143 242
208 3300028380 Ga0268265_10562337 Ga0268265_105623372 242
209 3300028380 Ga0268265_10723128 Ga0268265_107231282 242
210 3300048915 Ga0496112_0837923 Ga0496112_0837923_17_766 242
211 3300050510 nmdc:mga06r32_31557_c1 nmdc:mga06r32_31557_c1_968_1717 242
212 3300050511 nmdc:mga08y16_6656_c1 nmdc:mga08y16_6656_c1_8268_9017 242
213 3300009148 Ga0105243_10009374 Ga0105243_100093748 243
214 3300025981 Ga0207640_10110221 Ga0207640_101102212 243
215 3300053085 Ga0495619_0212216 Ga0495619_0212216_236_1006 244
216 3300005456 Ga0070678_100419909 Ga0070678_1004199092 245
217 3300027907 Ga0207428_10271916 Ga0207428_102719161 245
218 3300050511 nmdc:mga08y16_209424_c1 nmdc:mga08y16_209424_c1_215_985 245
219 3300007076 Ga0075435_100162675 Ga0075435_1001626752 246
220 3300009147 Ga0114129_10114829 Ga0114129_101148296 246
221 3300046694 Ga0495649_0172835 Ga0495649_0172835_289_1059 246
222 3300006871 Ga0075434_100004066 Ga0075434_1000040666 247
223 3300006914 Ga0075436_100010413 Ga0075436_1000104134 247
224 3300007076 Ga0075435_100001499 Ga0075435_1000014997 247
225 3300007076 Ga0075435_100020280 Ga0075435_1000202806 247
226 3300013297 Ga0157378_10499124 Ga0157378_104991243 247
227 3300050512 nmdc:mga0n895_859_c1 nmdc:mga0n895_859_c1_18532_19296 247
228 3300050513 nmdc:mga0rr50_109_c1 nmdc:mga0rr50_109_c1_4556_5320 247
229 3300050513 nmdc:mga0rr50_44439_c1 nmdc:mga0rr50_44439_c1_1161_1925 247
230 3300050514 nmdc:mga08x19_224_c1 nmdc:mga08x19_224_c1_1274_2038 247
231 3300050514 nmdc:mga08x19_24050_c1 nmdc:mga08x19_24050_c1_2537_3301 247
232 3300053134 Ga0500658_0159037 Ga0500658_0159037_21_800 247
233 3300005293 Ga0065715_10176386 Ga0065715_101763863 248
234 3300005335 Ga0070666_10230231 Ga0070666_102302312 248
235 3300005347 Ga0070668_100208643 Ga0070668_1002086432 248
236 3300005353 Ga0070669_100053128 Ga0070669_1000531281 248
237 3300005365 Ga0070688_100173387 Ga0070688_1001733871 248
238 3300005367 Ga0070667_100057160 Ga0070667_1000571602 248
239 3300005444 Ga0070694_100350444 Ga0070694_1003504441 248
240 3300005536 Ga0070697_100030202 Ga0070697_1000302026 248
241 3300005536 Ga0070697_100277982 Ga0070697_1002779823 248
242 3300005543 Ga0070672_100016241 Ga0070672_1000162413 248
243 3300005544 Ga0070686_100312770 Ga0070686_1003127702 248
244 3300005545 Ga0070695_100308722 Ga0070695_1003087221 248
245 3300005841 Ga0068863_100079860 Ga0068863_1000798603 248
246 3300005842 Ga0068858_100161492 Ga0068858_1001614922 248
247 3300005843 Ga0068860_100047666 Ga0068860_1000476662 248
248 3300005844 Ga0068862_100122167 Ga0068862_1001221673 248
249 3300005937 Ga0081455_10234714 Ga0081455_102347142 248
250 3300006237 Ga0097621_100503943 Ga0097621_1005039432 248
251 3300006358 Ga0068871_100231266 Ga0068871_1002312662 248
252 3300006844 Ga0075428_100116199 Ga0075428_1001161996 248
253 3300006871 Ga0075434_100108885 Ga0075434_1001088852 248
254 3300009094 Ga0111539_10390884 Ga0111539_103908842 248
255 3300009098 Ga0105245_10044442 Ga0105245_100444423 248
256 3300009147 Ga0114129_10022782 Ga0114129_100227826 248
257 3300009147 Ga0114129_10045015 Ga0114129_100450157 248
258 3300009177 Ga0105248_10032706 Ga0105248_100327068 248
259 3300013297 Ga0157378_10066721 Ga0157378_100667212 248
260 3300013306 Ga0163162_10068005 Ga0163162_100680052 248
261 3300013308 Ga0157375_10111312 Ga0157375_101113125 248
262 3300013308 Ga0157375_10165006 Ga0157375_101650062 248
263 3300014326 Ga0157380_10154068 Ga0157380_101540681 248
264 3300014968 Ga0157379_10008200 Ga0157379_100082007 248
265 3300014969 Ga0157376_10154395 Ga0157376_101543952 248
266 3300025903 Ga0207680_10344786 Ga0207680_103447862 248
267 3300025923 Ga0207681_10009213 Ga0207681_100092136 248
268 3300025927 Ga0207687_10068617 Ga0207687_100686172 248
269 3300025931 Ga0207644_10031442 Ga0207644_100314422 248
270 3300025936 Ga0207670_10055732 Ga0207670_100557322 248
271 3300025940 Ga0207691_10027126 Ga0207691_100271263 248
272 3300025941 Ga0207711_10019243 Ga0207711_100192434 248
273 3300025972 Ga0207668_10190408 Ga0207668_101904084 248
274 3300025986 Ga0207658_10418285 Ga0207658_104182852 248
275 3300026023 Ga0207677_10100524 Ga0207677_101005242 248
276 3300026035 Ga0207703_10042300 Ga0207703_100423006 248
277 3300026088 Ga0207641_10002008 Ga0207641_100020087 248
278 3300026121 Ga0207683_10408351 Ga0207683_104083512 248
279 3300028380 Ga0268265_10017461 Ga0268265_100174615 248
280 3300028381 Ga0268264_10487031 Ga0268264_104870312 248
281 3300035092 Ga0373952_0034005 Ga0373952_0034005_327_1106 248
282 3300035112 Ga0373932_0030003 Ga0373932_0030003_188_958 248
283 3300035118 Ga0373954_0148795 Ga0373954_0148795_14_781 248
284 3300035242 Ga0373962_0021443 Ga0373962_0021443_390_1160 248
285 3300048912 Ga0496109_0591775 Ga0496109_0591775_220_999 248
286 3300048914 Ga0496111_0318976 Ga0496111_0318976_211_990 248
287 3300048915 Ga0496112_0196980 Ga0496112_0196980_305_1078 248
288 3300050507 nmdc:mga05p37_46505_c1 nmdc:mga05p37_46505_c1_2363_3133 248
289 3300050507 nmdc:mga05p37_78239_c1 nmdc:mga05p37_78239_c1_1403_2173 248
290 3300050511 nmdc:mga08y16_7157_c1 nmdc:mga08y16_7157_c1_4342_5121 248
291 3300050512 nmdc:mga0n895_28384_c1 nmdc:mga0n895_28384_c1_1896_2675 248
292 3300050515 nmdc:mga0a205_2484_c1 nmdc:mga0a205_2484_c1_15142_15921 248
293 3300005617 Ga0068859_100262972 Ga0068859_1002629722 249
294 3300006173 Ga0070716_100520446 Ga0070716_1005204461 249
295 3300006931 Ga0097620_100262956 Ga0097620_1002629562 249
296 3300009177 Ga0105248_11105938 Ga0105248_111059381 249
297 3300025939 Ga0207665_10417880 Ga0207665_104178801 249
298 3300025941 Ga0207711_10768205 Ga0207711_107682051 249
299 3300005288 Ga0065714_10147026 Ga0065714_101470262 250
300 3300005290 Ga0065712_10142937 Ga0065712_101429372 250
301 3300005367 Ga0070667_100405111 Ga0070667_1004051112 250
302 3300005718 Ga0068866_10203753 Ga0068866_102037531 250
303 3300005842 Ga0068858_100343546 Ga0068858_1003435462 250
304 3300006237 Ga0097621_100198513 Ga0097621_1001985134 250
305 3300006358 Ga0068871_100021916 Ga0068871_1000219166 250
306 3300006881 Ga0068865_100342589 Ga0068865_1003425892 250
307 3300009176 Ga0105242_10003751 Ga0105242_100037512 250
308 3300009177 Ga0105248_10064373 Ga0105248_100643735 250
309 3300014969 Ga0157376_10022540 Ga0157376_100225405 250
310 3300025938 Ga0207704_10025186 Ga0207704_100251863 250
311 3300025944 Ga0207661_10462392 Ga0207661_104623921 250
312 3300025986 Ga0207658_10188435 Ga0207658_101884354 250
313 3300026023 Ga0207677_10215835 Ga0207677_102158354 250
314 3300037068 Ga0373925_0182805 Ga0373925_0182805_71_850 250
315 3300046681 Ga0495647_0011463 Ga0495647_0011463_608_1387 250
316 3300048917 Ga0496114_0066540 Ga0496114_0066540_1955_2734 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

86

212

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cua-assembly2.cif.gz_B the cua domain of cytochrome ba3 from thermus thermophilus 0.9216 149 224
2cua-assembly1.cif.gz_A the cua domain of cytochrome ba3 from thermus thermophilus 0.9173 149 224
6pty-assembly2.cif.gz_B soluble model of human cua (tt3lh) 0.9154 149 224
8gym-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.9066 150 233
6ptt-assembly2.cif.gz_B soluble model of arabidopsis thaliana cua (tt3lat) 0.9064 149 224
ID Description Score Start End Superfamily
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9317 95 234 2.60.40.420
af_Q8I6V2_60_165_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9172 150 230 2.60.40.420
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9157 150 231 2.60.40.420
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9056 149 224 2.60.40.420
af_Q2FZJ9_108_266_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8999 87 234 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A7C2EVG6-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9446 90 227 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A7C7WHT2-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9433 65 239 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A523LR61-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9414 99 239 GO:0004129
GO:0005507
GO:0016020
AF-A0A2G4EVY8-F1-model_v4 Cytochrome c oxidase subunit 2 (EC 7.1.1.9) 0.9395 96 238 GO:0004129
GO:0005507
GO:0005886
GO:0042773
AF-A0A7W1TTH5-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9295 76 235 GO:0004129
GO:0005507
GO:0016020
GO:0042773

Feature Viewer

pLDDT pTM Quality
80.54 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map