F403667
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 316 | 170 | 316 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10110937|Ga0105237_101109373 |
| Length | 229 |
| Sequence | MQTFLSMFPIQASTHAAEVDHMTILVHWLMLVKGANPKASYTGAHGKFAKSTEVAVAVIEIGILIFYAIPAWATRVKAFPAESQAVVVRVVAEQFAWNVHYPGPDGKFGRTDIKLVSADNPLGLDRSDPNAKDDITTINQLNLPVDRPVLVHLSSKDVIHSFGLYEMRVKQDAVPGLDIPVWFIPNRIGDYEITCSQLCGLGHYRMRGFVNIRSQADYEKFLASGGQNP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 127 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 128 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 129 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 130 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 131 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 132 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 133 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 135 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 137 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 139 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 142 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 151 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 152 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 153 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 156 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 157 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 158 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 159 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 160 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 5.38 |
| Rhizosphere | 94.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10147026 | 3300005288 | Bacteria | 1117 |
| 2 | Ga0065712_10142937 | 3300005290 | Bacteria | 1430 |
| 3 | Ga0065715_10176386 | 3300005293 | Bacteria | 1508 |
| 4 | Ga0065707_10045599 | 3300005295 | Bacteria | 1138 |
| 5 | Ga0065707_10105703 | 3300005295 | Unclassified | 2632 |
| 6 | Ga0070676_10005359 | 3300005328 | Bacteria | 6831 |
| 7 | Ga0070690_100010063 | 3300005330 | Bacteria | 5490 |
| 8 | Ga0070690_100346528 | 3300005330 | Unclassified | 1077 |
| 9 | Ga0070670_100032321 | 3300005331 | Bacteria | 4507 |
| 10 | Ga0070666_10087272 | 3300005335 | Bacteria | 2138 |
| 11 | Ga0070666_10172321 | 3300005335 | Bacteria | 1516 |
| 12 | Ga0070666_10230231 | 3300005335 | Unclassified | 1308 |
| 13 | Ga0070680_100515138 | 3300005336 | Bacteria | 1024 |
| 14 | Ga0070689_100069682 | 3300005340 | Bacteria | 2744 |
| 15 | Ga0070689_100093909 | 3300005340 | Bacteria | 2368 |
| 16 | Ga0070691_10001728 | 3300005341 | Bacteria | 9485 |
| 17 | Ga0070687_100229439 | 3300005343 | Unclassified | 1142 |
| 18 | Ga0070661_100629915 | 3300005344 | Bacteria | 869 |
| 19 | Ga0070692_10105342 | 3300005345 | Unclassified | 1552 |
| 20 | Ga0070668_100208239 | 3300005347 | Bacteria | 1608 |
| 21 | Ga0070668_100208643 | 3300005347 | Bacteria | 1606 |
| 22 | Ga0070669_100023632 | 3300005353 | Bacteria | 4402 |
| 23 | Ga0070669_100031544 | 3300005353 | Bacteria | 3827 |
| 24 | Ga0070669_100053128 | 3300005353 | Bacteria | 2965 |
| 25 | Ga0070675_100298106 | 3300005354 | Bacteria | 1420 |
| 26 | Ga0070674_100170957 | 3300005356 | Bacteria | 1657 |
| 27 | Ga0070674_100373758 | 3300005356 | Bacteria | 1158 |
| 28 | Ga0070673_100074187 | 3300005364 | Bacteria | 2741 |
| 29 | Ga0070673_100125491 | 3300005364 | Bacteria | 2147 |
| 30 | Ga0070673_100528049 | 3300005364 | Bacteria | 1070 |
| 31 | Ga0070688_100029659 | 3300005365 | Bacteria | 3277 |
| 32 | Ga0070688_100067596 | 3300005365 | Bacteria | 2277 |
| 33 | Ga0070688_100173387 | 3300005365 | Bacteria | 1490 |
| 34 | Ga0070667_100057160 | 3300005367 | Unclassified | 3296 |
| 35 | Ga0070667_100135860 | 3300005367 | Unclassified | 2150 |
| 36 | Ga0070667_100405111 | 3300005367 | Unclassified | 1242 |
| 37 | Ga0070714_100016015 | 3300005435 | Bacteria | 6044 |
| 38 | Ga0070701_10034778 | 3300005438 | Bacteria | 2526 |
| 39 | Ga0070705_100016790 | 3300005440 | Bacteria | 3810 |
| 40 | Ga0070705_100035361 | 3300005440 | Unclassified | 2800 |
| 41 | Ga0070700_100010175 | 3300005441 | Bacteria | 5185 |
| 42 | Ga0070694_100010066 | 3300005444 | Bacteria | 5815 |
| 43 | Ga0070694_100350444 | 3300005444 | Bacteria | 1144 |
| 44 | Ga0070678_100419909 | 3300005456 | Bacteria | 1166 |
| 45 | Ga0070662_100117152 | 3300005457 | Bacteria | 2037 |
| 46 | Ga0068867_100012807 | 3300005459 | Bacteria | 5934 |
| 47 | Ga0068867_100051864 | 3300005459 | Bacteria | 3026 |
| 48 | Ga0070685_10064369 | 3300005466 | Bacteria | 2156 |
| 49 | Ga0070707_100121089 | 3300005468 | Bacteria | 2541 |
| 50 | Ga0070698_100026990 | 3300005471 | Bacteria | 5972 |
| 51 | Ga0070698_100055411 | 3300005471 | Bacteria | 4020 |
| 52 | Ga0070699_100009880 | 3300005518 | Bacteria | 8263 |
| 53 | Ga0070697_100030202 | 3300005536 | Bacteria | 4352 |
| 54 | Ga0070697_100277982 | 3300005536 | Unclassified | 1436 |
| 55 | Ga0070672_100016241 | 3300005543 | Bacteria | 5325 |
| 56 | Ga0070686_100002486 | 3300005544 | Bacteria | 10150 |
| 57 | Ga0070686_100235642 | 3300005544 | Unclassified | 1330 |
| 58 | Ga0070686_100312770 | 3300005544 | Bacteria | 1168 |
| 59 | Ga0070686_100378477 | 3300005544 | Bacteria | 1071 |
| 60 | Ga0070695_100003699 | 3300005545 | Bacteria | 8913 |
| 61 | Ga0070695_100013076 | 3300005545 | Bacteria | 4986 |
| 62 | Ga0070695_100308722 | 3300005545 | Bacteria | 1172 |
| 63 | Ga0070696_100026541 | 3300005546 | Bacteria | 3941 |
| 64 | Ga0070665_100008701 | 3300005548 | Bacteria | 10272 |
| 65 | Ga0070704_100010915 | 3300005549 | Bacteria | 5540 |
| 66 | Ga0070704_100020400 | 3300005549 | Bacteria | 4272 |
| 67 | Ga0070664_100315803 | 3300005564 | Bacteria | 1415 |
| 68 | Ga0068854_100021646 | 3300005578 | Bacteria | 4365 |
| 69 | Ga0068854_100059875 | 3300005578 | Bacteria | 2753 |
| 70 | Ga0070702_100001638 | 3300005615 | Bacteria | 9276 |
| 71 | Ga0068852_100163187 | 3300005616 | Bacteria | 2082 |
| 72 | Ga0068859_100262972 | 3300005617 | Bacteria | 1817 |
| 73 | Ga0068859_100457113 | 3300005617 | Unclassified | 1373 |
| 74 | Ga0068864_100042832 | 3300005618 | Bacteria | 3874 |
| 75 | Ga0068866_10203753 | 3300005718 | Bacteria | 1184 |
| 76 | Ga0068861_100018796 | 3300005719 | Bacteria | 4927 |
| 77 | Ga0068863_100079860 | 3300005841 | Unclassified | 3098 |
| 78 | Ga0068863_100140616 | 3300005841 | Unclassified | 2307 |
| 79 | Ga0068858_100021298 | 3300005842 | Bacteria | 6055 |
| 80 | Ga0068858_100161492 | 3300005842 | Unclassified | 2110 |
| 81 | Ga0068858_100170416 | 3300005842 | Bacteria | 2053 |
| 82 | Ga0068858_100343546 | 3300005842 | Bacteria | 1429 |
| 83 | Ga0068858_100418173 | 3300005842 | Bacteria | 1289 |
| 84 | Ga0068860_100047666 | 3300005843 | Bacteria | 4083 |
| 85 | Ga0068862_100106106 | 3300005844 | Bacteria | 2462 |
| 86 | Ga0068862_100122167 | 3300005844 | Bacteria | 2296 |
| 87 | Ga0081455_10234714 | 3300005937 | Bacteria | 1351 |
| 88 | Ga0081539_10128447 | 3300005985 | Bacteria | 1248 |
| 89 | Ga0081539_10165193 | 3300005985 | Bacteria | 1051 |
| 90 | Ga0070716_100520446 | 3300006173 | Bacteria | 881 |
| 91 | Ga0097621_100198513 | 3300006237 | Bacteria | 1740 |
| 92 | Ga0097621_100240959 | 3300006237 | Unclassified | 1581 |
| 93 | Ga0097621_100503943 | 3300006237 | Bacteria | 1097 |
| 94 | Ga0068871_100021916 | 3300006358 | Bacteria | 4920 |
| 95 | Ga0068871_100231266 | 3300006358 | Unclassified | 1604 |
| 96 | Ga0068871_100609001 | 3300006358 | Bacteria | 994 |
| 97 | Ga0075428_100116199 | 3300006844 | Bacteria | 2914 |
| 98 | Ga0075433_10249075 | 3300006852 | Bacteria | 1576 |
| 99 | Ga0075433_10264412 | 3300006852 | Unclassified | 1525 |
| 100 | Ga0075434_100004066 | 3300006871 | Bacteria | 13112 |
| 101 | Ga0075434_100108885 | 3300006871 | Bacteria | 2781 |
| 102 | Ga0075434_100321138 | 3300006871 | Bacteria | 1569 |
| 103 | Ga0068865_100342589 | 3300006881 | Bacteria | 1208 |
| 104 | Ga0075436_100010413 | 3300006914 | Bacteria | 6374 |
| 105 | Ga0075436_100064174 | 3300006914 | Unclassified | 2538 |
| 106 | Ga0075436_100093342 | 3300006914 | Bacteria | 2092 |
| 107 | Ga0097620_100262956 | 3300006931 | Bacteria | 1817 |
| 108 | Ga0097620_100457130 | 3300006931 | Unclassified | 1373 |
| 109 | Ga0075435_100001499 | 3300007076 | Bacteria | 14991 |
| 110 | Ga0075435_100020280 | 3300007076 | Bacteria | 5090 |
| 111 | Ga0075435_100116273 | 3300007076 | Unclassified | 2228 |
| 112 | Ga0075435_100162675 | 3300007076 | Bacteria | 1880 |
| 113 | Ga0105240_10042264 | 3300009093 | Bacteria | 5809 |
| 114 | Ga0105240_10423646 | 3300009093 | Unclassified | 1495 |
| 115 | Ga0111539_10026076 | 3300009094 | Bacteria | 7155 |
| 116 | Ga0111539_10172376 | 3300009094 | Bacteria | 2528 |
| 117 | Ga0111539_10390884 | 3300009094 | Bacteria | 1620 |
| 118 | Ga0111539_10411923 | 3300009094 | Bacteria | 1574 |
| 119 | Ga0105245_10044442 | 3300009098 | Bacteria | 3965 |
| 120 | Ga0105247_10012411 | 3300009101 | Bacteria | 5117 |
| 121 | Ga0114129_10001435 | 3300009147 | Bacteria | 32173 |
| 122 | Ga0114129_10022782 | 3300009147 | Bacteria | 8880 |
| 123 | Ga0114129_10045015 | 3300009147 | Bacteria | 6206 |
| 124 | Ga0114129_10114829 | 3300009147 | Bacteria | 3712 |
| 125 | Ga0114129_11120609 | 3300009147 | Bacteria | 984 |
| 126 | Ga0105243_10009374 | 3300009148 | Bacteria | 7459 |
| 127 | Ga0105243_10495634 | 3300009148 | Bacteria | 1156 |
| 128 | Ga0105241_10037687 | 3300009174 | Bacteria | 3642 |
| 129 | Ga0105242_10003751 | 3300009176 | Bacteria | 11808 |
| 130 | Ga0105242_10017552 | 3300009176 | Bacteria | 5580 |
| 131 | Ga0105248_10006216 | 3300009177 | Bacteria | 13093 |
| 132 | Ga0105248_10018733 | 3300009177 | Bacteria | 7655 |
| 133 | Ga0105248_10032706 | 3300009177 | Bacteria | 5809 |
| 134 | Ga0105248_10064373 | 3300009177 | Bacteria | 4117 |
| 135 | Ga0105248_10082101 | 3300009177 | Bacteria | 3623 |
| 136 | Ga0105248_10085283 | 3300009177 | Bacteria | 3554 |
| 137 | Ga0105248_10225859 | 3300009177 | Bacteria | 2107 |
| 138 | Ga0105248_10302393 | 3300009177 | Bacteria | 1801 |
| 139 | Ga0105248_11105938 | 3300009177 | Bacteria | 896 |
| 140 | Ga0105237_10110937 | 3300009545 | Bacteria | 2734 |
| 141 | Ga0105238_10556656 | 3300009551 | Unclassified | 1151 |
| 142 | Ga0157374_10054298 | 3300013296 | Bacteria | 3737 |
| 143 | Ga0157378_10066721 | 3300013297 | Bacteria | 3223 |
| 144 | Ga0157378_10499124 | 3300013297 | Bacteria | 1215 |
| 145 | Ga0163162_10068005 | 3300013306 | Bacteria | 3613 |
| 146 | Ga0163162_10310027 | 3300013306 | Unclassified | 1710 |
| 147 | Ga0157375_10111312 | 3300013308 | Bacteria | 2837 |
| 148 | Ga0157375_10165006 | 3300013308 | Bacteria | 2359 |
| 149 | Ga0163163_10007871 | 3300014325 | Bacteria | 9417 |
| 150 | Ga0157380_10046940 | 3300014326 | Bacteria | 3394 |
| 151 | Ga0157380_10154068 | 3300014326 | Unclassified | 1990 |
| 152 | Ga0157379_10008200 | 3300014968 | Bacteria | 9072 |
| 153 | Ga0157379_10040273 | 3300014968 | Bacteria | 4169 |
| 154 | Ga0157379_10112942 | 3300014968 | Bacteria | 2442 |
| 155 | Ga0157376_10008296 | 3300014969 | Bacteria | 7487 |
| 156 | Ga0157376_10022540 | 3300014969 | Bacteria | 4912 |
| 157 | Ga0157376_10154395 | 3300014969 | Unclassified | 2074 |
| 158 | Ga0207710_10030217 | 3300025900 | Bacteria | 2362 |
| 159 | Ga0207688_10093072 | 3300025901 | Bacteria | 1733 |
| 160 | Ga0207680_10344786 | 3300025903 | Unclassified | 1045 |
| 161 | Ga0207645_10002542 | 3300025907 | Bacteria | 14280 |
| 162 | Ga0207684_10352587 | 3300025910 | Unclassified | 1266 |
| 163 | Ga0207654_10012257 | 3300025911 | Bacteria | 4389 |
| 164 | Ga0207695_10062013 | 3300025913 | Bacteria | 3862 |
| 165 | Ga0207695_10179197 | 3300025913 | Bacteria | 2040 |
| 166 | Ga0207662_10003313 | 3300025918 | Bacteria | 8263 |
| 167 | Ga0207662_10106906 | 3300025918 | Unclassified | 1740 |
| 168 | Ga0207662_10233132 | 3300025918 | Unclassified | 1203 |
| 169 | Ga0207646_10101300 | 3300025922 | Bacteria | 2582 |
| 170 | Ga0207646_10138597 | 3300025922 | Bacteria | 2191 |
| 171 | Ga0207681_10009213 | 3300025923 | Bacteria | 6033 |
| 172 | Ga0207681_10013508 | 3300025923 | Bacteria | 5056 |
| 173 | Ga0207681_10033473 | 3300025923 | Bacteria | 3370 |
| 174 | Ga0207681_10128947 | 3300025923 | Bacteria | 1867 |
| 175 | Ga0207659_10051058 | 3300025926 | Bacteria | 2939 |
| 176 | Ga0207659_10165340 | 3300025926 | Bacteria | 1741 |
| 177 | Ga0207687_10068617 | 3300025927 | Bacteria | 2526 |
| 178 | Ga0207687_10095249 | 3300025927 | Unclassified | 2180 |
| 179 | Ga0207700_10015627 | 3300025928 | Bacteria | 5015 |
| 180 | Ga0207664_10026169 | 3300025929 | Bacteria | 4406 |
| 181 | Ga0207644_10031442 | 3300025931 | Bacteria | 3698 |
| 182 | Ga0207706_10123496 | 3300025933 | Bacteria | 2277 |
| 183 | Ga0207686_10001967 | 3300025934 | Bacteria | 11329 |
| 184 | Ga0207670_10031733 | 3300025936 | Bacteria | 3390 |
| 185 | Ga0207670_10055732 | 3300025936 | Bacteria | 2673 |
| 186 | Ga0207669_10090860 | 3300025937 | Bacteria | 1987 |
| 187 | Ga0207669_10188614 | 3300025937 | Bacteria | 1485 |
| 188 | Ga0207704_10025186 | 3300025938 | Bacteria | 3242 |
| 189 | Ga0207665_10417880 | 3300025939 | Bacteria | 1024 |
| 190 | Ga0207691_10027126 | 3300025940 | Bacteria | 5374 |
| 191 | Ga0207711_10006556 | 3300025941 | Bacteria | 9803 |
| 192 | Ga0207711_10019243 | 3300025941 | Bacteria | 5684 |
| 193 | Ga0207711_10390848 | 3300025941 | Unclassified | 1291 |
| 194 | Ga0207711_10768205 | 3300025941 | Bacteria | 898 |
| 195 | Ga0207689_10333835 | 3300025942 | Unclassified | 1259 |
| 196 | Ga0207661_10462392 | 3300025944 | Bacteria | 1157 |
| 197 | Ga0207651_10045410 | 3300025960 | Bacteria | 2947 |
| 198 | Ga0207651_10793860 | 3300025960 | Bacteria | 839 |
| 199 | Ga0207668_10108571 | 3300025972 | Unclassified | 2077 |
| 200 | Ga0207668_10190408 | 3300025972 | Bacteria | 1625 |
| 201 | Ga0207640_10015460 | 3300025981 | Bacteria | 4418 |
| 202 | Ga0207640_10110221 | 3300025981 | Bacteria | 1949 |
| 203 | Ga0207640_10338540 | 3300025981 | Bacteria | 1204 |
| 204 | Ga0207658_10188435 | 3300025986 | Unclassified | 1713 |
| 205 | Ga0207658_10418285 | 3300025986 | Bacteria | 1181 |
| 206 | Ga0207677_10100524 | 3300026023 | Bacteria | 2127 |
| 207 | Ga0207677_10215835 | 3300026023 | Unclassified | 1535 |
| 208 | Ga0207703_10024929 | 3300026035 | Bacteria | 4706 |
| 209 | Ga0207703_10042300 | 3300026035 | Bacteria | 3654 |
| 210 | Ga0207703_10133512 | 3300026035 | Bacteria | 2146 |
| 211 | Ga0207708_10016993 | 3300026075 | Bacteria | 5477 |
| 212 | Ga0207708_10067854 | 3300026075 | Bacteria | 2729 |
| 213 | Ga0207641_10002008 | 3300026088 | Bacteria | 19393 |
| 214 | Ga0207641_10112287 | 3300026088 | Unclassified | 2418 |
| 215 | Ga0207648_10014508 | 3300026089 | Bacteria | 7276 |
| 216 | Ga0207648_10194312 | 3300026089 | Bacteria | 1799 |
| 217 | Ga0207648_10921823 | 3300026089 | Bacteria | 817 |
| 218 | Ga0207676_10010218 | 3300026095 | Bacteria | 6678 |
| 219 | Ga0207675_100030967 | 3300026118 | Bacteria | 4983 |
| 220 | Ga0207675_100062022 | 3300026118 | Bacteria | 3491 |
| 221 | Ga0207675_100807131 | 3300026118 | Bacteria | 952 |
| 222 | Ga0207683_10408351 | 3300026121 | Bacteria | 1250 |
| 223 | Ga0207698_10149347 | 3300026142 | Bacteria | 2026 |
| 224 | Ga0207428_10080724 | 3300027907 | Bacteria | 2540 |
| 225 | Ga0207428_10082549 | 3300027907 | Bacteria | 2508 |
| 226 | Ga0207428_10198282 | 3300027907 | Bacteria | 1511 |
| 227 | Ga0207428_10271916 | 3300027907 | Bacteria | 1259 |
| 228 | Ga0207428_10281697 | 3300027907 | Unclassified | 1234 |
| 229 | Ga0268266_10006329 | 3300028379 | Bacteria | 10851 |
| 230 | Ga0268265_10017461 | 3300028380 | Bacteria | 4953 |
| 231 | Ga0268265_10141814 | 3300028380 | Bacteria | 2013 |
| 232 | Ga0268265_10562337 | 3300028380 | Bacteria | 1084 |
| 233 | Ga0268265_10723128 | 3300028380 | Bacteria | 964 |
| 234 | Ga0268264_10302214 | 3300028381 | Bacteria | 1507 |
| 235 | Ga0268264_10487031 | 3300028381 | Bacteria | 1200 |
| 236 | Ga0373948_0009697 | 3300034817 | Unclassified | 1666 |
| 237 | Ga0373950_0000159 | 3300034818 | Bacteria | 9864 |
| 238 | Ga0373958_0002198 | 3300034819 | Bacteria | 2708 |
| 239 | Ga0373959_0000541 | 3300034820 | Bacteria | 6737 |
| 240 | Ga0373938_0004149 | 3300034957 | Bacteria | 2402 |
| 241 | Ga0373929_0001210 | 3300035085 | Bacteria | 4991 |
| 242 | Ga0373949_0000697 | 3300035090 | Bacteria | 10925 |
| 243 | Ga0373951_0001237 | 3300035091 | Bacteria | 6766 |
| 244 | Ga0373952_0002397 | 3300035092 | Bacteria | 3376 |
| 245 | Ga0373952_0034005 | 3300035092 | Bacteria | 1147 |
| 246 | Ga0373932_0001647 | 3300035112 | Bacteria | 6119 |
| 247 | Ga0373932_0030003 | 3300035112 | Unclassified | 1505 |
| 248 | Ga0373939_0000518 | 3300035114 | Bacteria | 9713 |
| 249 | Ga0373941_0000527 | 3300035115 | Bacteria | 7669 |
| 250 | Ga0373954_0148795 | 3300035118 | Bacteria | 1144 |
| 251 | Ga0373942_0004245 | 3300035207 | Bacteria | 3337 |
| 252 | Ga0373961_0003053 | 3300035241 | Bacteria | 4213 |
| 253 | Ga0373962_0001536 | 3300035242 | Bacteria | 5460 |
| 254 | Ga0373962_0021443 | 3300035242 | Unclassified | 1705 |
| 255 | Ga0373962_0038828 | 3300035242 | Bacteria | 1334 |
| 256 | Ga0373931_0042912 | 3300035691 | Bacteria | 2379 |
| 257 | Ga0373931_0178848 | 3300035691 | Unclassified | 1255 |
| 258 | Ga0373925_0182805 | 3300037068 | Bacteria | 1661 |
| 259 | Ga0395900_0370558 | 3300037418 | Bacteria | 1402 |
| 260 | Ga0451576_0010034 | 3300045051 | Bacteria | 10906 |
| 261 | Ga0451576_0869951 | 3300045051 | Bacteria | 946 |
| 262 | Ga0495647_0011463 | 3300046681 | Bacteria | 3039 |
| 263 | Ga0495669_0004209 | 3300046684 | Bacteria | 5923 |
| 264 | Ga0495669_0030510 | 3300046684 | Bacteria | 2367 |
| 265 | Ga0495649_0172835 | 3300046694 | Bacteria | 1130 |
| 266 | Ga0496102_0372904 | 3300048905 | Unclassified | 1343 |
| 267 | Ga0496104_0131588 | 3300048907 | Bacteria | 2403 |
| 268 | Ga0496104_0410804 | 3300048907 | Bacteria | 1266 |
| 269 | Ga0496106_0066523 | 3300048909 | Bacteria | 2745 |
| 270 | Ga0496107_0405707 | 3300048910 | Unclassified | 1013 |
| 271 | Ga0496108_0042050 | 3300048911 | Bacteria | 3814 |
| 272 | Ga0496109_0591775 | 3300048912 | Unclassified | 1045 |
| 273 | Ga0496110_0738247 | 3300048913 | Bacteria | 887 |
| 274 | Ga0496111_0318976 | 3300048914 | Bacteria | 1151 |
| 275 | Ga0496112_0009087 | 3300048915 | Bacteria | 8929 |
| 276 | Ga0496112_0091143 | 3300048915 | Bacteria | 3017 |
| 277 | Ga0496112_0196980 | 3300048915 | Unclassified | 1975 |
| 278 | Ga0496112_0218191 | 3300048915 | Unclassified | 1864 |
| 279 | Ga0496112_0837923 | 3300048915 | Bacteria | 843 |
| 280 | Ga0496113_0164192 | 3300048916 | Bacteria | 1757 |
| 281 | Ga0496114_0066540 | 3300048917 | Bacteria | 3021 |
| 282 | Ga0496114_0119659 | 3300048917 | Unclassified | 2264 |
| 283 | Ga0501076_0105008 | 3300049592 | Bacteria | 2280 |
| 284 | nmdc:mga05p37_22585_c1 | 3300050507 | Bacteria | 7629 |
| 285 | nmdc:mga05p37_252990_c1 | 3300050507 | Archaea | 2112 |
| 286 | nmdc:mga05p37_46505_c1 | 3300050507 | Bacteria | 5336 |
| 287 | nmdc:mga05p37_78239_c1 | 3300050507 | Bacteria | 4072 |
| 288 | nmdc:mga05p37_9103_c1 | 3300050507 | Bacteria | 11737 |
| 289 | nmdc:mga09592_75613_c1 | 3300050508 | Bacteria | 2863 |
| 290 | nmdc:mga09592_80868_c1 | 3300050508 | Bacteria | 2767 |
| 291 | nmdc:mga06r32_31557_c1 | 3300050510 | Bacteria | 4977 |
| 292 | nmdc:mga08y16_209424_c1 | 3300050511 | Unclassified | 2019 |
| 293 | nmdc:mga08y16_254144_c1 | 3300050511 | Bacteria | 1816 |
| 294 | nmdc:mga08y16_377337_c1 | 3300050511 | Unclassified | 1454 |
| 295 | nmdc:mga08y16_52037_c1 | 3300050511 | Bacteria | 4285 |
| 296 | nmdc:mga08y16_6656_c1 | 3300050511 | Bacteria | 12122 |
| 297 | nmdc:mga08y16_7157_c1 | 3300050511 | Bacteria | 11711 |
| 298 | nmdc:mga0n895_28384_c1 | 3300050512 | Bacteria | 5322 |
| 299 | nmdc:mga0n895_315166_c1 | 3300050512 | Bacteria | 1585 |
| 300 | nmdc:mga0n895_859_c1 | 3300050512 | Bacteria | 21838 |
| 301 | nmdc:mga0rr50_109_c1 | 3300050513 | Bacteria | 46163 |
| 302 | nmdc:mga0rr50_35265_c1 | 3300050513 | Bacteria | 3591 |
| 303 | nmdc:mga0rr50_44439_c1 | 3300050513 | Bacteria | 3258 |
| 304 | nmdc:mga08x19_224_c1 | 3300050514 | Bacteria | 43344 |
| 305 | nmdc:mga08x19_24050_c1 | 3300050514 | Bacteria | 3783 |
| 306 | nmdc:mga08x19_419420_c1 | 3300050514 | Bacteria | 940 |
| 307 | nmdc:mga08x19_92986_c1 | 3300050514 | Bacteria | 1993 |
| 308 | nmdc:mga08x19_9879_c1 | 3300050514 | Bacteria | 5721 |
| 309 | nmdc:mga0a205_216591_c1 | 3300050515 | Bacteria | 1802 |
| 310 | nmdc:mga0a205_230728_c1 | 3300050515 | Bacteria | 1734 |
| 311 | nmdc:mga0a205_2484_c1 | 3300050515 | Bacteria | 16260 |
| 312 | nmdc:mga0a205_426044_c1 | 3300050515 | Unclassified | 1189 |
| 313 | nmdc:mga0a205_437688_c1 | 3300050515 | Bacteria | 1168 |
| 314 | nmdc:mga0a205_669338_c1 | 3300050515 | Bacteria | 889 |
| 315 | Ga0495619_0212216 | 3300053085 | Unclassified | 1341 |
| 316 | Ga0500658_0159037 | 3300053134 | Bacteria | 1022 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046684 | Ga0495669_0030510 | Ga0495669_0030510_907_1590 | 219 |
| 2 | 3300050515 | nmdc:mga0a205_669338_c1 | nmdc:mga0a205_669338_c1_166_873 | 228 |
| 3 | 3300009545 | Ga0105237_10110937 | Ga0105237_101109373 | 229 |
| 4 | 3300005343 | Ga0070687_100229439 | Ga0070687_1002294392 | 232 |
| 5 | 3300005340 | Ga0070689_100093909 | Ga0070689_1000939095 | 233 |
| 6 | 3300005365 | Ga0070688_100029659 | Ga0070688_1000296594 | 233 |
| 7 | 3300009094 | Ga0111539_10172376 | Ga0111539_101723762 | 233 |
| 8 | 3300025918 | Ga0207662_10106906 | Ga0207662_101069062 | 233 |
| 9 | 3300025936 | Ga0207670_10031733 | Ga0207670_100317333 | 233 |
| 10 | 3300027907 | Ga0207428_10281697 | Ga0207428_102816972 | 233 |
| 11 | 3300050511 | nmdc:mga08y16_377337_c1 | nmdc:mga08y16_377337_c1_501_1313 | 233 |
| 12 | 3300026118 | Ga0207675_100807131 | Ga0207675_1008071312 | 234 |
| 13 | 3300050508 | nmdc:mga09592_80868_c1 | nmdc:mga09592_80868_c1_1633_2457 | 234 |
| 14 | 3300005617 | Ga0068859_100457113 | Ga0068859_1004571132 | 236 |
| 15 | 3300006931 | Ga0097620_100457130 | Ga0097620_1004571302 | 236 |
| 16 | 3300027907 | Ga0207428_10198282 | Ga0207428_101982823 | 236 |
| 17 | 3300048907 | Ga0496104_0410804 | Ga0496104_0410804_435_1166 | 236 |
| 18 | 3300048915 | Ga0496112_0091143 | Ga0496112_0091143_561_1292 | 236 |
| 19 | 3300050507 | nmdc:mga05p37_252990_c1 | nmdc:mga05p37_252990_c1_890_1705 | 236 |
| 20 | 3300005328 | Ga0070676_10005359 | Ga0070676_100053596 | 237 |
| 21 | 3300005341 | Ga0070691_10001728 | Ga0070691_100017287 | 237 |
| 22 | 3300005345 | Ga0070692_10105342 | Ga0070692_101053424 | 237 |
| 23 | 3300005353 | Ga0070669_100023632 | Ga0070669_1000236324 | 237 |
| 24 | 3300005364 | Ga0070673_100125491 | Ga0070673_1001254911 | 237 |
| 25 | 3300005438 | Ga0070701_10034778 | Ga0070701_100347782 | 237 |
| 26 | 3300005440 | Ga0070705_100016790 | Ga0070705_1000167906 | 237 |
| 27 | 3300005441 | Ga0070700_100010175 | Ga0070700_1000101754 | 237 |
| 28 | 3300005444 | Ga0070694_100010066 | Ga0070694_1000100666 | 237 |
| 29 | 3300005459 | Ga0068867_100012807 | Ga0068867_1000128076 | 237 |
| 30 | 3300005544 | Ga0070686_100378477 | Ga0070686_1003784771 | 237 |
| 31 | 3300005545 | Ga0070695_100013076 | Ga0070695_1000130766 | 237 |
| 32 | 3300005549 | Ga0070704_100010915 | Ga0070704_1000109154 | 237 |
| 33 | 3300005578 | Ga0068854_100059875 | Ga0068854_1000598752 | 237 |
| 34 | 3300005615 | Ga0070702_100001638 | Ga0070702_1000016389 | 237 |
| 35 | 3300005719 | Ga0068861_100018796 | Ga0068861_1000187965 | 237 |
| 36 | 3300025907 | Ga0207645_10002542 | Ga0207645_100025426 | 237 |
| 37 | 3300025923 | Ga0207681_10013508 | Ga0207681_100135083 | 237 |
| 38 | 3300025960 | Ga0207651_10045410 | Ga0207651_100454106 | 237 |
| 39 | 3300026075 | Ga0207708_10016993 | Ga0207708_100169934 | 237 |
| 40 | 3300026089 | Ga0207648_10014508 | Ga0207648_100145086 | 237 |
| 41 | 3300026118 | Ga0207675_100030967 | Ga0207675_1000309674 | 237 |
| 42 | 3300005330 | Ga0070690_100346528 | Ga0070690_1003465281 | 238 |
| 43 | 3300005336 | Ga0070680_100515138 | Ga0070680_1005151381 | 238 |
| 44 | 3300005367 | Ga0070667_100135860 | Ga0070667_1001358604 | 238 |
| 45 | 3300005471 | Ga0070698_100055411 | Ga0070698_1000554113 | 238 |
| 46 | 3300005548 | Ga0070665_100008701 | Ga0070665_1000087019 | 238 |
| 47 | 3300005841 | Ga0068863_100140616 | Ga0068863_1001406164 | 238 |
| 48 | 3300005842 | Ga0068858_100021298 | Ga0068858_1000212985 | 238 |
| 49 | 3300006237 | Ga0097621_100240959 | Ga0097621_1002409592 | 238 |
| 50 | 3300006852 | Ga0075433_10249075 | Ga0075433_102490753 | 238 |
| 51 | 3300009093 | Ga0105240_10423646 | Ga0105240_104236462 | 238 |
| 52 | 3300009094 | Ga0111539_10411923 | Ga0111539_104119233 | 238 |
| 53 | 3300009176 | Ga0105242_10017552 | Ga0105242_100175524 | 238 |
| 54 | 3300009177 | Ga0105248_10018733 | Ga0105248_100187334 | 238 |
| 55 | 3300009551 | Ga0105238_10556656 | Ga0105238_105566562 | 238 |
| 56 | 3300013296 | Ga0157374_10054298 | Ga0157374_100542985 | 238 |
| 57 | 3300013306 | Ga0163162_10310027 | Ga0163162_103100272 | 238 |
| 58 | 3300014968 | Ga0157379_10040273 | Ga0157379_100402734 | 238 |
| 59 | 3300014969 | Ga0157376_10008296 | Ga0157376_100082964 | 238 |
| 60 | 3300025913 | Ga0207695_10179197 | Ga0207695_101791972 | 238 |
| 61 | 3300025927 | Ga0207687_10095249 | Ga0207687_100952492 | 238 |
| 62 | 3300025934 | Ga0207686_10001967 | Ga0207686_100019676 | 238 |
| 63 | 3300026035 | Ga0207703_10024929 | Ga0207703_100249295 | 238 |
| 64 | 3300026088 | Ga0207641_10112287 | Ga0207641_101122874 | 238 |
| 65 | 3300027907 | Ga0207428_10082549 | Ga0207428_100825495 | 238 |
| 66 | 3300028379 | Ga0268266_10006329 | Ga0268266_100063299 | 238 |
| 67 | 3300035242 | Ga0373962_0038828 | Ga0373962_0038828_259_1044 | 238 |
| 68 | 3300035691 | Ga0373931_0178848 | Ga0373931_0178848_273_1040 | 238 |
| 69 | 3300048915 | Ga0496112_0218191 | Ga0496112_0218191_814_1581 | 238 |
| 70 | 3300048917 | Ga0496114_0119659 | Ga0496114_0119659_749_1516 | 238 |
| 71 | 3300050508 | nmdc:mga09592_75613_c1 | nmdc:mga09592_75613_c1_192_977 | 238 |
| 72 | 3300050511 | nmdc:mga08y16_254144_c1 | nmdc:mga08y16_254144_c1_831_1616 | 238 |
| 73 | 3300050514 | nmdc:mga08x19_92986_c1 | nmdc:mga08x19_92986_c1_366_1103 | 238 |
| 74 | 3300050515 | nmdc:mga0a205_230728_c1 | nmdc:mga0a205_230728_c1_384_1169 | 238 |
| 75 | 3300050515 | nmdc:mga0a205_437688_c1 | nmdc:mga0a205_437688_c1_256_1044 | 238 |
| 76 | 3300005518 | Ga0070699_100009880 | Ga0070699_1000098806 | 239 |
| 77 | 3300005618 | Ga0068864_100042832 | Ga0068864_1000428322 | 239 |
| 78 | 3300005842 | Ga0068858_100170416 | Ga0068858_1001704162 | 239 |
| 79 | 3300006914 | Ga0075436_100064174 | Ga0075436_1000641744 | 239 |
| 80 | 3300006914 | Ga0075436_100093342 | Ga0075436_1000933422 | 239 |
| 81 | 3300007076 | Ga0075435_100116273 | Ga0075435_1001162732 | 239 |
| 82 | 3300009101 | Ga0105247_10012411 | Ga0105247_100124116 | 239 |
| 83 | 3300009147 | Ga0114129_10001435 | Ga0114129_1000143510 | 239 |
| 84 | 3300009177 | Ga0105248_10006216 | Ga0105248_1000621610 | 239 |
| 85 | 3300009177 | Ga0105248_10082101 | Ga0105248_100821014 | 239 |
| 86 | 3300014325 | Ga0163163_10007871 | Ga0163163_100078712 | 239 |
| 87 | 3300014968 | Ga0157379_10112942 | Ga0157379_101129422 | 239 |
| 88 | 3300025900 | Ga0207710_10030217 | Ga0207710_100302172 | 239 |
| 89 | 3300025941 | Ga0207711_10006556 | Ga0207711_100065566 | 239 |
| 90 | 3300025941 | Ga0207711_10390848 | Ga0207711_103908482 | 239 |
| 91 | 3300026035 | Ga0207703_10133512 | Ga0207703_101335122 | 239 |
| 92 | 3300026095 | Ga0207676_10010218 | Ga0207676_100102186 | 239 |
| 93 | 3300028381 | Ga0268264_10302214 | Ga0268264_103022141 | 239 |
| 94 | 3300037418 | Ga0395900_0370558 | Ga0395900_0370558_558_1304 | 239 |
| 95 | 3300048907 | Ga0496104_0131588 | Ga0496104_0131588_715_1488 | 239 |
| 96 | 3300048910 | Ga0496107_0405707 | Ga0496107_0405707_61_831 | 239 |
| 97 | 3300048911 | Ga0496108_0042050 | Ga0496108_0042050_2617_3390 | 239 |
| 98 | 3300048913 | Ga0496110_0738247 | Ga0496110_0738247_53_826 | 239 |
| 99 | 3300048915 | Ga0496112_0009087 | Ga0496112_0009087_4598_5371 | 239 |
| 100 | 3300049592 | Ga0501076_0105008 | Ga0501076_0105008_958_1701 | 239 |
| 101 | 3300050507 | nmdc:mga05p37_9103_c1 | nmdc:mga05p37_9103_c1_8063_8818 | 239 |
| 102 | 3300050514 | nmdc:mga08x19_419420_c1 | nmdc:mga08x19_419420_c1_85_837 | 239 |
| 103 | 3300050514 | nmdc:mga08x19_9879_c1 | nmdc:mga08x19_9879_c1_1801_2544 | 239 |
| 104 | 3300050515 | nmdc:mga0a205_216591_c1 | nmdc:mga0a205_216591_c1_96_851 | 239 |
| 105 | 3300005295 | Ga0065707_10045599 | Ga0065707_100455992 | 240 |
| 106 | 3300005330 | Ga0070690_100010063 | Ga0070690_1000100631 | 240 |
| 107 | 3300005335 | Ga0070666_10172321 | Ga0070666_101723214 | 240 |
| 108 | 3300005364 | Ga0070673_100528049 | Ga0070673_1005280492 | 240 |
| 109 | 3300005457 | Ga0070662_100117152 | Ga0070662_1001171525 | 240 |
| 110 | 3300005471 | Ga0070698_100026990 | Ga0070698_1000269907 | 240 |
| 111 | 3300005544 | Ga0070686_100002486 | Ga0070686_10000248610 | 240 |
| 112 | 3300005578 | Ga0068854_100021646 | Ga0068854_1000216466 | 240 |
| 113 | 3300005616 | Ga0068852_100163187 | Ga0068852_1001631875 | 240 |
| 114 | 3300005985 | Ga0081539_10128447 | Ga0081539_101284472 | 240 |
| 115 | 3300005985 | Ga0081539_10165193 | Ga0081539_101651931 | 240 |
| 116 | 3300006871 | Ga0075434_100321138 | Ga0075434_1003211382 | 240 |
| 117 | 3300009174 | Ga0105241_10037687 | Ga0105241_100376876 | 240 |
| 118 | 3300009177 | Ga0105248_10085283 | Ga0105248_100852833 | 240 |
| 119 | 3300009177 | Ga0105248_10225859 | Ga0105248_102258592 | 240 |
| 120 | 3300025910 | Ga0207684_10352587 | Ga0207684_103525872 | 240 |
| 121 | 3300025911 | Ga0207654_10012257 | Ga0207654_100122576 | 240 |
| 122 | 3300025918 | Ga0207662_10003313 | Ga0207662_100033136 | 240 |
| 123 | 3300025922 | Ga0207646_10138597 | Ga0207646_101385973 | 240 |
| 124 | 3300025933 | Ga0207706_10123496 | Ga0207706_101234962 | 240 |
| 125 | 3300025981 | Ga0207640_10015460 | Ga0207640_100154606 | 240 |
| 126 | 3300026089 | Ga0207648_10921823 | Ga0207648_109218231 | 240 |
| 127 | 3300026142 | Ga0207698_10149347 | Ga0207698_101493472 | 240 |
| 128 | 3300034817 | Ga0373948_0009697 | Ga0373948_0009697_141_890 | 240 |
| 129 | 3300034818 | Ga0373950_0000159 | Ga0373950_0000159_3151_3900 | 240 |
| 130 | 3300034819 | Ga0373958_0002198 | Ga0373958_0002198_822_1571 | 240 |
| 131 | 3300034820 | Ga0373959_0000541 | Ga0373959_0000541_835_1584 | 240 |
| 132 | 3300034957 | Ga0373938_0004149 | Ga0373938_0004149_1361_2110 | 240 |
| 133 | 3300035085 | Ga0373929_0001210 | Ga0373929_0001210_3113_3862 | 240 |
| 134 | 3300035090 | Ga0373949_0000697 | Ga0373949_0000697_3284_4033 | 240 |
| 135 | 3300035091 | Ga0373951_0001237 | Ga0373951_0001237_4610_5359 | 240 |
| 136 | 3300035092 | Ga0373952_0002397 | Ga0373952_0002397_2089_2838 | 240 |
| 137 | 3300035112 | Ga0373932_0001647 | Ga0373932_0001647_1135_1884 | 240 |
| 138 | 3300035114 | Ga0373939_0000518 | Ga0373939_0000518_5978_6727 | 240 |
| 139 | 3300035115 | Ga0373941_0000527 | Ga0373941_0000527_1193_1942 | 240 |
| 140 | 3300035207 | Ga0373942_0004245 | Ga0373942_0004245_2365_3114 | 240 |
| 141 | 3300035241 | Ga0373961_0003053 | Ga0373961_0003053_3088_3837 | 240 |
| 142 | 3300035242 | Ga0373962_0001536 | Ga0373962_0001536_4675_5424 | 240 |
| 143 | 3300035691 | Ga0373931_0042912 | Ga0373931_0042912_387_1136 | 240 |
| 144 | 3300045051 | Ga0451576_0010034 | Ga0451576_0010034_945_1694 | 240 |
| 145 | 3300045051 | Ga0451576_0869951 | Ga0451576_0869951_28_777 | 240 |
| 146 | 3300046684 | Ga0495669_0004209 | Ga0495669_0004209_3770_4516 | 240 |
| 147 | 3300048909 | Ga0496106_0066523 | Ga0496106_0066523_1638_2384 | 240 |
| 148 | 3300050512 | nmdc:mga0n895_315166_c1 | nmdc:mga0n895_315166_c1_179_922 | 240 |
| 149 | 3300050513 | nmdc:mga0rr50_35265_c1 | nmdc:mga0rr50_35265_c1_2498_3244 | 240 |
| 150 | 3300005331 | Ga0070670_100032321 | Ga0070670_1000323217 | 241 |
| 151 | 3300005335 | Ga0070666_10087272 | Ga0070666_100872722 | 241 |
| 152 | 3300005340 | Ga0070689_100069682 | Ga0070689_1000696821 | 241 |
| 153 | 3300005344 | Ga0070661_100629915 | Ga0070661_1006299151 | 241 |
| 154 | 3300005354 | Ga0070675_100298106 | Ga0070675_1002981061 | 241 |
| 155 | 3300005356 | Ga0070674_100170957 | Ga0070674_1001709571 | 241 |
| 156 | 3300005364 | Ga0070673_100074187 | Ga0070673_1000741872 | 241 |
| 157 | 3300005365 | Ga0070688_100067596 | Ga0070688_1000675964 | 241 |
| 158 | 3300005435 | Ga0070714_100016015 | Ga0070714_1000160154 | 241 |
| 159 | 3300005459 | Ga0068867_100051864 | Ga0068867_1000518644 | 241 |
| 160 | 3300005466 | Ga0070685_10064369 | Ga0070685_100643692 | 241 |
| 161 | 3300005468 | Ga0070707_100121089 | Ga0070707_1001210895 | 241 |
| 162 | 3300005544 | Ga0070686_100235642 | Ga0070686_1002356422 | 241 |
| 163 | 3300005545 | Ga0070695_100003699 | Ga0070695_10000369910 | 241 |
| 164 | 3300005549 | Ga0070704_100020400 | Ga0070704_1000204006 | 241 |
| 165 | 3300005564 | Ga0070664_100315803 | Ga0070664_1003158031 | 241 |
| 166 | 3300005842 | Ga0068858_100418173 | Ga0068858_1004181734 | 241 |
| 167 | 3300006852 | Ga0075433_10264412 | Ga0075433_102644122 | 241 |
| 168 | 3300009093 | Ga0105240_10042264 | Ga0105240_100422645 | 241 |
| 169 | 3300009147 | Ga0114129_11120609 | Ga0114129_111206092 | 241 |
| 170 | 3300014326 | Ga0157380_10046940 | Ga0157380_100469406 | 241 |
| 171 | 3300025913 | Ga0207695_10062013 | Ga0207695_100620134 | 241 |
| 172 | 3300025918 | Ga0207662_10233132 | Ga0207662_102331323 | 241 |
| 173 | 3300025922 | Ga0207646_10101300 | Ga0207646_101013005 | 241 |
| 174 | 3300025923 | Ga0207681_10128947 | Ga0207681_101289474 | 241 |
| 175 | 3300025926 | Ga0207659_10165340 | Ga0207659_101653402 | 241 |
| 176 | 3300025928 | Ga0207700_10015627 | Ga0207700_100156272 | 241 |
| 177 | 3300025929 | Ga0207664_10026169 | Ga0207664_100261692 | 241 |
| 178 | 3300025937 | Ga0207669_10090860 | Ga0207669_100908605 | 241 |
| 179 | 3300025960 | Ga0207651_10793860 | Ga0207651_107938601 | 241 |
| 180 | 3300026089 | Ga0207648_10194312 | Ga0207648_101943124 | 241 |
| 181 | 3300027907 | Ga0207428_10080724 | Ga0207428_100807245 | 241 |
| 182 | 3300048905 | Ga0496102_0372904 | Ga0496102_0372904_522_1271 | 241 |
| 183 | 3300048916 | Ga0496113_0164192 | Ga0496113_0164192_484_1233 | 241 |
| 184 | 3300050507 | nmdc:mga05p37_22585_c1 | nmdc:mga05p37_22585_c1_5730_6491 | 241 |
| 185 | 3300050511 | nmdc:mga08y16_52037_c1 | nmdc:mga08y16_52037_c1_857_1606 | 241 |
| 186 | 3300050515 | nmdc:mga0a205_426044_c1 | nmdc:mga0a205_426044_c1_344_1105 | 241 |
| 187 | 3300005295 | Ga0065707_10105703 | Ga0065707_101057032 | 242 |
| 188 | 3300005347 | Ga0070668_100208239 | Ga0070668_1002082392 | 242 |
| 189 | 3300005353 | Ga0070669_100031544 | Ga0070669_1000315444 | 242 |
| 190 | 3300005356 | Ga0070674_100373758 | Ga0070674_1003737582 | 242 |
| 191 | 3300005440 | Ga0070705_100035361 | Ga0070705_1000353612 | 242 |
| 192 | 3300005546 | Ga0070696_100026541 | Ga0070696_1000265413 | 242 |
| 193 | 3300005844 | Ga0068862_100106106 | Ga0068862_1001061061 | 242 |
| 194 | 3300006358 | Ga0068871_100609001 | Ga0068871_1006090012 | 242 |
| 195 | 3300009094 | Ga0111539_10026076 | Ga0111539_100260766 | 242 |
| 196 | 3300009148 | Ga0105243_10495634 | Ga0105243_104956343 | 242 |
| 197 | 3300009177 | Ga0105248_10302393 | Ga0105248_103023932 | 242 |
| 198 | 3300025901 | Ga0207688_10093072 | Ga0207688_100930721 | 242 |
| 199 | 3300025923 | Ga0207681_10033473 | Ga0207681_100334737 | 242 |
| 200 | 3300025926 | Ga0207659_10051058 | Ga0207659_100510582 | 242 |
| 201 | 3300025937 | Ga0207669_10188614 | Ga0207669_101886141 | 242 |
| 202 | 3300025942 | Ga0207689_10333835 | Ga0207689_103338351 | 242 |
| 203 | 3300025972 | Ga0207668_10108571 | Ga0207668_101085712 | 242 |
| 204 | 3300025981 | Ga0207640_10338540 | Ga0207640_103385403 | 242 |
| 205 | 3300026075 | Ga0207708_10067854 | Ga0207708_100678545 | 242 |
| 206 | 3300026118 | Ga0207675_100062022 | Ga0207675_1000620222 | 242 |
| 207 | 3300028380 | Ga0268265_10141814 | Ga0268265_101418143 | 242 |
| 208 | 3300028380 | Ga0268265_10562337 | Ga0268265_105623372 | 242 |
| 209 | 3300028380 | Ga0268265_10723128 | Ga0268265_107231282 | 242 |
| 210 | 3300048915 | Ga0496112_0837923 | Ga0496112_0837923_17_766 | 242 |
| 211 | 3300050510 | nmdc:mga06r32_31557_c1 | nmdc:mga06r32_31557_c1_968_1717 | 242 |
| 212 | 3300050511 | nmdc:mga08y16_6656_c1 | nmdc:mga08y16_6656_c1_8268_9017 | 242 |
| 213 | 3300009148 | Ga0105243_10009374 | Ga0105243_100093748 | 243 |
| 214 | 3300025981 | Ga0207640_10110221 | Ga0207640_101102212 | 243 |
| 215 | 3300053085 | Ga0495619_0212216 | Ga0495619_0212216_236_1006 | 244 |
| 216 | 3300005456 | Ga0070678_100419909 | Ga0070678_1004199092 | 245 |
| 217 | 3300027907 | Ga0207428_10271916 | Ga0207428_102719161 | 245 |
| 218 | 3300050511 | nmdc:mga08y16_209424_c1 | nmdc:mga08y16_209424_c1_215_985 | 245 |
| 219 | 3300007076 | Ga0075435_100162675 | Ga0075435_1001626752 | 246 |
| 220 | 3300009147 | Ga0114129_10114829 | Ga0114129_101148296 | 246 |
| 221 | 3300046694 | Ga0495649_0172835 | Ga0495649_0172835_289_1059 | 246 |
| 222 | 3300006871 | Ga0075434_100004066 | Ga0075434_1000040666 | 247 |
| 223 | 3300006914 | Ga0075436_100010413 | Ga0075436_1000104134 | 247 |
| 224 | 3300007076 | Ga0075435_100001499 | Ga0075435_1000014997 | 247 |
| 225 | 3300007076 | Ga0075435_100020280 | Ga0075435_1000202806 | 247 |
| 226 | 3300013297 | Ga0157378_10499124 | Ga0157378_104991243 | 247 |
| 227 | 3300050512 | nmdc:mga0n895_859_c1 | nmdc:mga0n895_859_c1_18532_19296 | 247 |
| 228 | 3300050513 | nmdc:mga0rr50_109_c1 | nmdc:mga0rr50_109_c1_4556_5320 | 247 |
| 229 | 3300050513 | nmdc:mga0rr50_44439_c1 | nmdc:mga0rr50_44439_c1_1161_1925 | 247 |
| 230 | 3300050514 | nmdc:mga08x19_224_c1 | nmdc:mga08x19_224_c1_1274_2038 | 247 |
| 231 | 3300050514 | nmdc:mga08x19_24050_c1 | nmdc:mga08x19_24050_c1_2537_3301 | 247 |
| 232 | 3300053134 | Ga0500658_0159037 | Ga0500658_0159037_21_800 | 247 |
| 233 | 3300005293 | Ga0065715_10176386 | Ga0065715_101763863 | 248 |
| 234 | 3300005335 | Ga0070666_10230231 | Ga0070666_102302312 | 248 |
| 235 | 3300005347 | Ga0070668_100208643 | Ga0070668_1002086432 | 248 |
| 236 | 3300005353 | Ga0070669_100053128 | Ga0070669_1000531281 | 248 |
| 237 | 3300005365 | Ga0070688_100173387 | Ga0070688_1001733871 | 248 |
| 238 | 3300005367 | Ga0070667_100057160 | Ga0070667_1000571602 | 248 |
| 239 | 3300005444 | Ga0070694_100350444 | Ga0070694_1003504441 | 248 |
| 240 | 3300005536 | Ga0070697_100030202 | Ga0070697_1000302026 | 248 |
| 241 | 3300005536 | Ga0070697_100277982 | Ga0070697_1002779823 | 248 |
| 242 | 3300005543 | Ga0070672_100016241 | Ga0070672_1000162413 | 248 |
| 243 | 3300005544 | Ga0070686_100312770 | Ga0070686_1003127702 | 248 |
| 244 | 3300005545 | Ga0070695_100308722 | Ga0070695_1003087221 | 248 |
| 245 | 3300005841 | Ga0068863_100079860 | Ga0068863_1000798603 | 248 |
| 246 | 3300005842 | Ga0068858_100161492 | Ga0068858_1001614922 | 248 |
| 247 | 3300005843 | Ga0068860_100047666 | Ga0068860_1000476662 | 248 |
| 248 | 3300005844 | Ga0068862_100122167 | Ga0068862_1001221673 | 248 |
| 249 | 3300005937 | Ga0081455_10234714 | Ga0081455_102347142 | 248 |
| 250 | 3300006237 | Ga0097621_100503943 | Ga0097621_1005039432 | 248 |
| 251 | 3300006358 | Ga0068871_100231266 | Ga0068871_1002312662 | 248 |
| 252 | 3300006844 | Ga0075428_100116199 | Ga0075428_1001161996 | 248 |
| 253 | 3300006871 | Ga0075434_100108885 | Ga0075434_1001088852 | 248 |
| 254 | 3300009094 | Ga0111539_10390884 | Ga0111539_103908842 | 248 |
| 255 | 3300009098 | Ga0105245_10044442 | Ga0105245_100444423 | 248 |
| 256 | 3300009147 | Ga0114129_10022782 | Ga0114129_100227826 | 248 |
| 257 | 3300009147 | Ga0114129_10045015 | Ga0114129_100450157 | 248 |
| 258 | 3300009177 | Ga0105248_10032706 | Ga0105248_100327068 | 248 |
| 259 | 3300013297 | Ga0157378_10066721 | Ga0157378_100667212 | 248 |
| 260 | 3300013306 | Ga0163162_10068005 | Ga0163162_100680052 | 248 |
| 261 | 3300013308 | Ga0157375_10111312 | Ga0157375_101113125 | 248 |
| 262 | 3300013308 | Ga0157375_10165006 | Ga0157375_101650062 | 248 |
| 263 | 3300014326 | Ga0157380_10154068 | Ga0157380_101540681 | 248 |
| 264 | 3300014968 | Ga0157379_10008200 | Ga0157379_100082007 | 248 |
| 265 | 3300014969 | Ga0157376_10154395 | Ga0157376_101543952 | 248 |
| 266 | 3300025903 | Ga0207680_10344786 | Ga0207680_103447862 | 248 |
| 267 | 3300025923 | Ga0207681_10009213 | Ga0207681_100092136 | 248 |
| 268 | 3300025927 | Ga0207687_10068617 | Ga0207687_100686172 | 248 |
| 269 | 3300025931 | Ga0207644_10031442 | Ga0207644_100314422 | 248 |
| 270 | 3300025936 | Ga0207670_10055732 | Ga0207670_100557322 | 248 |
| 271 | 3300025940 | Ga0207691_10027126 | Ga0207691_100271263 | 248 |
| 272 | 3300025941 | Ga0207711_10019243 | Ga0207711_100192434 | 248 |
| 273 | 3300025972 | Ga0207668_10190408 | Ga0207668_101904084 | 248 |
| 274 | 3300025986 | Ga0207658_10418285 | Ga0207658_104182852 | 248 |
| 275 | 3300026023 | Ga0207677_10100524 | Ga0207677_101005242 | 248 |
| 276 | 3300026035 | Ga0207703_10042300 | Ga0207703_100423006 | 248 |
| 277 | 3300026088 | Ga0207641_10002008 | Ga0207641_100020087 | 248 |
| 278 | 3300026121 | Ga0207683_10408351 | Ga0207683_104083512 | 248 |
| 279 | 3300028380 | Ga0268265_10017461 | Ga0268265_100174615 | 248 |
| 280 | 3300028381 | Ga0268264_10487031 | Ga0268264_104870312 | 248 |
| 281 | 3300035092 | Ga0373952_0034005 | Ga0373952_0034005_327_1106 | 248 |
| 282 | 3300035112 | Ga0373932_0030003 | Ga0373932_0030003_188_958 | 248 |
| 283 | 3300035118 | Ga0373954_0148795 | Ga0373954_0148795_14_781 | 248 |
| 284 | 3300035242 | Ga0373962_0021443 | Ga0373962_0021443_390_1160 | 248 |
| 285 | 3300048912 | Ga0496109_0591775 | Ga0496109_0591775_220_999 | 248 |
| 286 | 3300048914 | Ga0496111_0318976 | Ga0496111_0318976_211_990 | 248 |
| 287 | 3300048915 | Ga0496112_0196980 | Ga0496112_0196980_305_1078 | 248 |
| 288 | 3300050507 | nmdc:mga05p37_46505_c1 | nmdc:mga05p37_46505_c1_2363_3133 | 248 |
| 289 | 3300050507 | nmdc:mga05p37_78239_c1 | nmdc:mga05p37_78239_c1_1403_2173 | 248 |
| 290 | 3300050511 | nmdc:mga08y16_7157_c1 | nmdc:mga08y16_7157_c1_4342_5121 | 248 |
| 291 | 3300050512 | nmdc:mga0n895_28384_c1 | nmdc:mga0n895_28384_c1_1896_2675 | 248 |
| 292 | 3300050515 | nmdc:mga0a205_2484_c1 | nmdc:mga0a205_2484_c1_15142_15921 | 248 |
| 293 | 3300005617 | Ga0068859_100262972 | Ga0068859_1002629722 | 249 |
| 294 | 3300006173 | Ga0070716_100520446 | Ga0070716_1005204461 | 249 |
| 295 | 3300006931 | Ga0097620_100262956 | Ga0097620_1002629562 | 249 |
| 296 | 3300009177 | Ga0105248_11105938 | Ga0105248_111059381 | 249 |
| 297 | 3300025939 | Ga0207665_10417880 | Ga0207665_104178801 | 249 |
| 298 | 3300025941 | Ga0207711_10768205 | Ga0207711_107682051 | 249 |
| 299 | 3300005288 | Ga0065714_10147026 | Ga0065714_101470262 | 250 |
| 300 | 3300005290 | Ga0065712_10142937 | Ga0065712_101429372 | 250 |
| 301 | 3300005367 | Ga0070667_100405111 | Ga0070667_1004051112 | 250 |
| 302 | 3300005718 | Ga0068866_10203753 | Ga0068866_102037531 | 250 |
| 303 | 3300005842 | Ga0068858_100343546 | Ga0068858_1003435462 | 250 |
| 304 | 3300006237 | Ga0097621_100198513 | Ga0097621_1001985134 | 250 |
| 305 | 3300006358 | Ga0068871_100021916 | Ga0068871_1000219166 | 250 |
| 306 | 3300006881 | Ga0068865_100342589 | Ga0068865_1003425892 | 250 |
| 307 | 3300009176 | Ga0105242_10003751 | Ga0105242_100037512 | 250 |
| 308 | 3300009177 | Ga0105248_10064373 | Ga0105248_100643735 | 250 |
| 309 | 3300014969 | Ga0157376_10022540 | Ga0157376_100225405 | 250 |
| 310 | 3300025938 | Ga0207704_10025186 | Ga0207704_100251863 | 250 |
| 311 | 3300025944 | Ga0207661_10462392 | Ga0207661_104623921 | 250 |
| 312 | 3300025986 | Ga0207658_10188435 | Ga0207658_101884354 | 250 |
| 313 | 3300026023 | Ga0207677_10215835 | Ga0207677_102158354 | 250 |
| 314 | 3300037068 | Ga0373925_0182805 | Ga0373925_0182805_71_850 | 250 |
| 315 | 3300046681 | Ga0495647_0011463 | Ga0495647_0011463_608_1387 | 250 |
| 316 | 3300048917 | Ga0496114_0066540 | Ga0496114_0066540_1955_2734 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cua-assembly2.cif.gz_B | the cua domain of cytochrome ba3 from thermus thermophilus | 0.9216 | 149 | 224 |
| 2cua-assembly1.cif.gz_A | the cua domain of cytochrome ba3 from thermus thermophilus | 0.9173 | 149 | 224 |
| 6pty-assembly2.cif.gz_B | soluble model of human cua (tt3lh) | 0.9154 | 149 | 224 |
| 8gym-assembly1.cif.gz_c2 | cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 | 0.9066 | 150 | 233 |
| 6ptt-assembly2.cif.gz_B | soluble model of arabidopsis thaliana cua (tt3lat) | 0.9064 | 149 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2yevE02 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9317 | 95 | 234 | 2.60.40.420 |
| af_Q8I6V2_60_165_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9172 | 150 | 230 | 2.60.40.420 |
| af_A0A1D6ED90_406_498_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9157 | 150 | 231 | 2.60.40.420 |
| 5u7nF00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9056 | 149 | 224 | 2.60.40.420 |
| af_Q2FZJ9_108_266_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8999 | 87 | 234 | 2.60.40.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2EVG6-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9446 | 90 | 227 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A7C7WHT2-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9433 | 65 | 239 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A523LR61-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9414 | 99 | 239 |
GO:0004129
GO:0005507 GO:0016020 |
| AF-A0A2G4EVY8-F1-model_v4 | Cytochrome c oxidase subunit 2 (EC 7.1.1.9) | 0.9395 | 96 | 238 |
GO:0004129
GO:0005507 GO:0005886 GO:0042773 |
| AF-A0A7W1TTH5-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9295 | 76 | 235 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar