F403980

General Info

Members Datasets Scaffolds Average Seq Length
317 188 312 130

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10060111|rootH1_100601113
Length 157
Sequence LYTSSPLLNPCQNFIFEEIRQEENTMSNNEKSDKLRIDKYLWSIRLFKTRSLAATACDSGKVKQEGNAVKAAKQVHVGDEYDVRTEGRLWRIKVTGLLHNRVQYSEAIKYYTDITPAEELERLQFQRQASSFHTGKRLSKVGRPTKKERRDLDEFMD

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
130 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
131 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
132 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
168 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
173 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
174 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
175 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
176 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
177 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
178 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
179 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
180 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
185 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
186 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
187 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
188 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.2
Nodule 0
Rhizoplane 3.15
Rhizosphere 82.97
Stem 0
Stem Tuber 0
Unclassified 5.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10024844 3300001989 Bacteria 2110
2 JGI25153J46596_10022576 3300003215 Bacteria 2314
3 rootL2_10003615 3300003322 Bacteria 2913
4 rootH1_10015677 3300003323 Bacteria 8000
5 rootH1_10043167 3300003323 Bacteria 3532
6 rootH1_10060111 3300003323 Bacteria 3913
7 Ga0065712_10250696 3300005290 Bacteria 961
8 Ga0065712_10757403 3300005290 Unclassified 503
9 Ga0070658_10000176 3300005327 Bacteria 56043
10 Ga0070658_10682994 3300005327 Unclassified 891
11 Ga0070676_10000034 3300005328 Bacteria 41415
12 Ga0070683_100058160 3300005329 Bacteria 3592
13 Ga0070683_100720225 3300005329 Bacteria 956
14 Ga0070683_101025540 3300005329 Bacteria 792
15 Ga0070690_100777234 3300005330 Bacteria 741
16 Ga0070670_100104648 3300005331 Bacteria 2438
17 Ga0070670_100707710 3300005331 Unclassified 906
18 Ga0070670_101106236 3300005331 Bacteria 723
19 Ga0068869_100101426 3300005334 Bacteria 2177
20 Ga0070666_10000437 3300005335 Bacteria 25520
21 Ga0070666_10279645 3300005335 Bacteria 1186
22 Ga0070666_10437742 3300005335 Unclassified 943
23 Ga0070680_100136022 3300005336 Bacteria 2059
24 Ga0070682_100000005 3300005337 Bacteria 386439
25 Ga0070682_100281097 3300005337 Bacteria 1213
26 Ga0068868_100001305 3300005338 Bacteria 17174
27 Ga0068868_100892605 3300005338 Unclassified 807
28 Ga0068868_100898591 3300005338 Bacteria 805
29 Ga0070660_100129406 3300005339 Bacteria 2019
30 Ga0070689_100458848 3300005340 Unclassified 1085
31 Ga0070661_100351708 3300005344 Bacteria 1156
32 Ga0070661_101783565 3300005344 Unclassified 522
33 Ga0070668_100000087 3300005347 Bacteria 57426
34 Ga0070675_100044653 3300005354 Bacteria 3624
35 Ga0070675_100624685 3300005354 Bacteria 978
36 Ga0070671_100141631 3300005355 Bacteria 2029
37 Ga0070671_100207291 3300005355 Bacteria 1663
38 Ga0070673_100000074 3300005364 Bacteria 42660
39 Ga0070673_100122747 3300005364 Bacteria 2170
40 Ga0070659_100422579 3300005366 Viruses 1127
41 Ga0070667_100000031 3300005367 Bacteria 177447
42 Ga0070663_100941236 3300005455 Unclassified 748
43 Ga0070678_100895391 3300005456 Unclassified 811
44 Ga0070662_100043302 3300005457 Bacteria 3220
45 Ga0068867_100006590 3300005459 Bacteria 8208
46 Ga0068867_100518831 3300005459 Bacteria 1027
47 Ga0068867_101157964 3300005459 Bacteria 708
48 Ga0068867_102027806 3300005459 Bacteria 544
49 Ga0070706_101087797 3300005467 Bacteria 736
50 Ga0070684_100034750 3300005535 Bacteria 4311
51 Ga0070684_100062911 3300005535 Bacteria 3252
52 Ga0068853_100012420 3300005539 Bacteria 6927
53 Ga0068853_101938860 3300005539 Unclassified 571
54 Ga0070672_100000002 3300005543 Bacteria 159809
55 Ga0070672_100452560 3300005543 Unclassified 1106
56 Ga0070686_100366059 3300005544 Bacteria 1087
57 Ga0070693_100297473 3300005547 Bacteria 1087
58 Ga0070665_100000222 3300005548 Bacteria 94961
59 Ga0068855_100056937 3300005563 Bacteria 4584
60 Ga0070664_100003850 3300005564 Bacteria 12110
61 Ga0068857_100659467 3300005577 Bacteria 992
62 Ga0068857_101314324 3300005577 Unclassified 702
63 Ga0068854_101063864 3300005578 Unclassified 719
64 Ga0070702_101679965 3300005615 Unclassified 527
65 Ga0068852_100145128 3300005616 Unclassified 2200
66 Ga0068852_101085323 3300005616 Bacteria 820
67 Ga0068864_100008795 3300005618 Bacteria 8326
68 Ga0068864_101480625 3300005618 Unclassified 682
69 Ga0068866_11236162 3300005718 Bacteria 540
70 Ga0068861_100037086 3300005719 Bacteria 3623
71 Ga0068851_10000267 3300005834 Bacteria 24476
72 Ga0068851_10142374 3300005834 Unclassified 1305
73 Ga0068851_10602846 3300005834 Bacteria 668
74 Ga0068858_102233240 3300005842 Unclassified 541
75 Ga0068860_100005968 3300005843 Bacteria 12256
76 Ga0068860_100409759 3300005843 Bacteria 1342
77 Ga0097621_100035981 3300006237 Bacteria 3958
78 Ga0097621_100265837 3300006237 Bacteria 1506
79 Ga0097621_100731402 3300006237 Bacteria 913
80 Ga0097621_100827275 3300006237 Unclassified 859
81 Ga0068871_100004279 3300006358 Bacteria 9904
82 Ga0068871_100005842 3300006358 Bacteria 8651
83 Ga0068871_100848359 3300006358 Bacteria 844
84 Ga0068871_102024833 3300006358 Bacteria 548
85 Ga0068871_102308913 3300006358 Bacteria 513
86 Ga0068865_100003834 3300006881 Bacteria 9016
87 Ga0105240_10424873 3300009093 Unclassified 1492
88 Ga0111539_10773800 3300009094 Bacteria 1117
89 Ga0105245_10246823 3300009098 Bacteria 1733
90 Ga0105243_10187583 3300009148 Unclassified 1803
91 Ga0105241_10471850 3300009174 Bacteria 1114
92 Ga0105242_10009613 3300009176 Bacteria 7414
93 Ga0105242_10130545 3300009176 Bacteria 2168
94 Ga0105248_10064839 3300009177 Bacteria 4101
95 Ga0105237_10266917 3300009545 Bacteria 1714
96 Ga0105237_10439546 3300009545 Unclassified 1310
97 Ga0105238_10164857 3300009551 Unclassified 2191
98 Ga0105249_10004261 3300009553 Bacteria 12362
99 Ga0105239_10118502 3300010375 Bacteria 2938
100 Ga0105239_10421218 3300010375 Bacteria 1513
101 Ga0105246_10045180 3300011119 Bacteria 2998
102 Ga0157371_10016990 3300013102 Bacteria 5416
103 Ga0157371_10080119 3300013102 Bacteria 2313
104 Ga0157371_10119400 3300013102 Bacteria 1874
105 Ga0157371_10184508 3300013102 Bacteria 1493
106 Ga0157371_10692529 3300013102 Bacteria 762
107 Ga0157370_10097252 3300013104 Bacteria 2761
108 Ga0157370_11972322 3300013104 Unclassified 523
109 Ga0157369_10055525 3300013105 Bacteria 4275
110 Ga0157369_10162825 3300013105 Bacteria 2354
111 Ga0157374_10001136 3300013296 Bacteria 22799
112 Ga0157374_10013137 3300013296 Bacteria 7223
113 Ga0157374_10165412 3300013296 Bacteria 2155
114 Ga0157374_10237224 3300013296 Bacteria 1793
115 Ga0157374_11260577 3300013296 Bacteria 761
116 Ga0157374_11313566 3300013296 Bacteria 745
117 Ga0157374_11487658 3300013296 Bacteria 700
118 Ga0157378_10053645 3300013297 Bacteria 3590
119 Ga0157378_10070588 3300013297 Bacteria 3137
120 Ga0157378_11185870 3300013297 Bacteria 803
121 Ga0157378_12375910 3300013297 Unclassified 582
122 Ga0163162_10000029 3300013306 Bacteria 168510
123 Ga0163162_10000576 3300013306 Bacteria 33923
124 Ga0163162_10017733 3300013306 Bacteria 6966
125 Ga0163162_10216371 3300013306 Bacteria 2046
126 Ga0163162_10241517 3300013306 Bacteria 1937
127 Ga0163162_11160500 3300013306 Bacteria 876
128 Ga0163162_12184470 3300013306 Unclassified 635
129 Ga0163162_12288327 3300013306 Unclassified 621
130 Ga0157372_10021979 3300013307 Bacteria 6896
131 Ga0157372_10083446 3300013307 Bacteria 3620
132 Ga0157372_10303421 3300013307 Bacteria 1858
133 Ga0157372_10586440 3300013307 Unclassified 1299
134 Ga0157372_11298726 3300013307 Unclassified 840
135 Ga0157375_10000042 3300013308 Bacteria 160008
136 Ga0157375_11366168 3300013308 Bacteria 834
137 Ga0157375_13595896 3300013308 Unclassified 516
138 Ga0163163_10000174 3300014325 Bacteria 67568
139 Ga0163163_10409851 3300014325 Bacteria 1414
140 Ga0163163_10945000 3300014325 Unclassified 925
141 Ga0157380_10911333 3300014326 Bacteria 906
142 Ga0157380_11176193 3300014326 Bacteria 809
143 Ga0157380_11751942 3300014326 Unclassified 680
144 Ga0157377_10017457 3300014745 Bacteria 3712
145 Ga0157379_10000080 3300014968 Bacteria 63139
146 Ga0157379_10206184 3300014968 Bacteria 1778
147 Ga0157379_11139079 3300014968 Bacteria 748
148 Ga0157379_11420173 3300014968 Bacteria 673
149 Ga0157379_12299281 3300014968 Unclassified 537
150 Ga0157376_10000521 3300014969 Bacteria 24829
151 Ga0157376_10019036 3300014969 Bacteria 5281
152 Ga0157376_10032269 3300014969 Bacteria 4203
153 Ga0157376_10327634 3300014969 Unclassified 1458
154 Ga0157376_10633508 3300014969 Bacteria 1068
155 Ga0157376_10979623 3300014969 Bacteria 867
156 Ga0157376_12551005 3300014969 Bacteria 551
157 Ga0157376_12772449 3300014969 Bacteria 530
158 Ga0163161_10077471 3300017792 Bacteria 2442
159 Ga0163161_10723749 3300017792 Unclassified 830
160 Ga0163161_11167625 3300017792 Bacteria 664
161 Ga0163161_11558878 3300017792 Bacteria 581
162 Ga0213876_10083498 3300021384 Bacteria 1690
163 Ga0213876_10376151 3300021384 Bacteria 755
164 Ga0209758_1030531 3300025297 Bacteria 2230
165 Ga0207426_1000293 3300025302 Bacteria 98805
166 Ga0207426_1041502 3300025302 Bacteria 1426
167 Ga0207697_10120126 3300025315 Unclassified 1130
168 Ga0207697_10449857 3300025315 Bacteria 571
169 Ga0207656_10289006 3300025321 Unclassified 810
170 Ga0207656_10402409 3300025321 Unclassified 688
171 Ga0207680_10000657 3300025903 Bacteria 16337
172 Ga0207680_10253626 3300025903 Bacteria 1216
173 Ga0207645_10000337 3300025907 Bacteria 39173
174 Ga0207705_10001116 3300025909 Bacteria 21828
175 Ga0207654_10326361 3300025911 Unclassified 1050
176 Ga0207695_10664053 3300025913 Unclassified 923
177 Ga0207671_10532969 3300025914 Unclassified 936
178 Ga0207657_10160387 3300025919 Bacteria 1827
179 Ga0207649_10092336 3300025920 Bacteria 1985
180 Ga0207649_11280874 3300025920 Unclassified 580
181 Ga0207652_10772445 3300025921 Bacteria 854
182 Ga0207694_10199644 3300025924 Unclassified 1627
183 Ga0207650_10051066 3300025925 Bacteria 3059
184 Ga0207650_10705877 3300025925 Bacteria 852
185 Ga0207659_10863631 3300025926 Bacteria 778
186 Ga0207659_11075990 3300025926 Unclassified 692
187 Ga0207687_10261596 3300025927 Bacteria 1379
188 Ga0207644_10101514 3300025931 Bacteria 2162
189 Ga0207644_10422644 3300025931 Unclassified 1092
190 Ga0207644_11582647 3300025931 Bacteria 550
191 Ga0207706_10004551 3300025933 Bacteria 13017
192 Ga0207686_10015430 3300025934 Bacteria 4271
193 Ga0207709_10126114 3300025935 Unclassified 1736
194 Ga0207691_10000004 3300025940 Bacteria 168729
195 Ga0207691_10260930 3300025940 Bacteria 1494
196 Ga0207691_10392613 3300025940 Bacteria 1184
197 Ga0207691_10567685 3300025940 Bacteria 962
198 Ga0207711_10170645 3300025941 Unclassified 1974
199 Ga0207661_10492712 3300025944 Bacteria 1119
200 Ga0207679_10004909 3300025945 Bacteria 8337
201 Ga0207679_10166218 3300025945 Unclassified 1812
202 Ga0207651_10005923 3300025960 Bacteria 6328
203 Ga0207651_10181831 3300025960 Bacteria 1669
204 Ga0207712_10125704 3300025961 Bacteria 1946
205 Ga0207668_10000551 3300025972 Bacteria 23563
206 Ga0207640_10326359 3300025981 Bacteria 1224
207 Ga0207658_10000059 3300025986 Bacteria 121530
208 Ga0207677_10002598 3300026023 Bacteria 9495
209 Ga0207677_10738117 3300026023 Bacteria 877
210 Ga0207677_10881335 3300026023 Bacteria 806
211 Ga0207703_10039213 3300026035 Bacteria 3784
212 Ga0207703_11267247 3300026035 Bacteria 709
213 Ga0207703_12369799 3300026035 Unclassified 506
214 Ga0207639_10099855 3300026041 Bacteria 2343
215 Ga0207639_11807713 3300026041 Unclassified 572
216 Ga0207678_10300920 3300026067 Bacteria 1378
217 Ga0207648_10016208 3300026089 Bacteria 6819
218 Ga0207648_10196127 3300026089 Bacteria 1790
219 Ga0207648_11468715 3300026089 Bacteria 641
220 Ga0207676_10008891 3300026095 Bacteria 7147
221 Ga0207674_10351663 3300026116 Unclassified 1425
222 Ga0207674_10479494 3300026116 Bacteria 1202
223 Ga0207674_10522812 3300026116 Bacteria 1146
224 Ga0207674_11015252 3300026116 Bacteria 799
225 Ga0207675_100019866 3300026118 Bacteria 6269
226 Ga0207683_10828791 3300026121 Bacteria 859
227 Ga0207698_10948503 3300026142 Bacteria 869
228 Ga0268266_10006251 3300028379 Bacteria 10932
229 Ga0268264_10003852 3300028381 Bacteria 12873
230 Ga0268264_10379247 3300028381 Bacteria 1354
231 Ga0307509_10055018 3300031507 Bacteria 4232
232 Ga0265313_10027008 3300031595 Bacteria 3012
233 Ga0373937_0093811 3300036401 Bacteria 2783
234 Ga0373937_0667608 3300036401 Bacteria 985
235 Ga0436365_0517469 3300039437 Bacteria 501
236 Ga0436365_1668150 3300039437 Bacteria 7466
237 Ga0439436_0010275 3300041404 Bacteria 2858
238 Ga0439436_0204196 3300041404 Unclassified 566
239 Ga0439439_0008940 3300041406 Unclassified 2372
240 Ga0451791_1884426 3300041451 Bacteria 735
241 Ga0451795_0190990 3300041456 Bacteria 703
242 Ga0451802_1266609 3300041460 Bacteria 757
243 Ga0451807_2560468 3300041486 Unclassified 587
244 Ga0451851_1150644 3300041507 Bacteria 814
245 Ga0451853_2454815 3300041512 Bacteria 768
246 Ga0451853_4001071 3300041512 Bacteria 2897
247 Ga0439449_0375087 3300042007 Bacteria 539
248 Ga0439457_001223 3300042014 Bacteria 7733
249 Ga0439457_052525 3300042014 Bacteria 916
250 Ga0439462_0006893 3300042015 Bacteria 2834
251 Ga0451577_0028329 3300042876 Bacteria 5066
252 Ga0451577_0050227 3300042876 Bacteria 3724
253 Ga0451577_0569456 3300042876 Bacteria 1028
254 Ga0453684_0274601 3300044712 Bacteria 1924
255 Ga0453684_0445439 3300044712 Bacteria 1442
256 Ga0495638_0136053 3300046460 Bacteria 1439
257 Ga0495638_0410248 3300046460 Bacteria 701
258 Ga0495580_0318580 3300046472 Bacteria 1057
259 Ga0495582_0607100 3300046473 Bacteria 633
260 Ga0495630_0969701 3300046517 Bacteria 646
261 Ga0495632_0248940 3300046519 Unclassified 797
262 Ga0495586_0059936 3300046535 Bacteria 2069
263 Ga0495633_0061032 3300046558 Bacteria 1766
264 Ga0495668_0000268 3300046616 Bacteria 73486
265 Ga0495635_0086507 3300046663 Bacteria 2145
266 Ga0495657_0374222 3300046675 Bacteria 841
267 Ga0495670_0080613 3300046691 Bacteria 1658
268 Ga0495674_0194426 3300047319 Bacteria 1685
269 Ga0495672_0134542 3300047320 Unclassified 1297
270 Ga0495680_0820040 3300047322 Unclassified 606
271 Ga0495684_0180038 3300047471 Bacteria 1567
272 Ga0496104_0792541 3300048907 Unclassified 854
273 Ga0496104_1301726 3300048907 Bacteria 630
274 Ga0496108_1234251 3300048911 Bacteria 631
275 Ga0496114_1044841 3300048917 Unclassified 701
276 Ga0496115_0040474 3300048918 Unclassified 3705
277 Ga0496115_0140613 3300048918 Bacteria 1992
278 Ga0496124_0151514 3300048927 Bacteria 1818
279 Ga0501032_0956589 3300049569 Unclassified 538
280 Ga0501034_0659380 3300049571 Unclassified 947
281 Ga0501034_0997549 3300049571 Unclassified 721
282 Ga0501038_0328229 3300049574 Unclassified 1196
283 Ga0501043_0024134 3300049579 Bacteria 4772
284 Ga0501073_0822620 3300049589 Unclassified 640
285 Ga0501080_0353646 3300049742 Bacteria 1326
286 Ga0501080_0454779 3300049742 Bacteria 1148
287 Ga0501241_013675 3300049758 Bacteria 1475
288 Ga0501270_128793 3300049767 Bacteria 558
289 Ga0501044_0323744 3300049823 Bacteria 1465
290 nmdc:mga0k408_836615_c1 3300050493 Bacteria 535
291 Ga0495595_0447067 3300053084 Bacteria 657
292 Ga0500644_0031312 3300053088 Bacteria 1690
293 Ga0500644_0384133 3300053088 Bacteria 611
294 Ga0500646_0017307 3300053090 Bacteria 1889
295 Ga0500646_0051039 3300053090 Bacteria 1194
296 Ga0500583_0000037 3300053092 Bacteria 92466
297 Ga0500583_0007626 3300053092 Bacteria 3823
298 Ga0500650_0044999 3300053098 Bacteria 2044
299 Ga0500556_0012715 3300053104 Bacteria 2524
300 Ga0500562_052946 3300053108 Bacteria 1087
301 Ga0500594_0028819 3300053118 Bacteria 1447
302 Ga0500642_0195244 3300053130 Bacteria 943
303 Ga0500652_002036 3300053131 Bacteria 6087
304 Ga0500652_006031 3300053131 Bacteria 3867
305 Ga0500658_0162447 3300053134 Unclassified 1012
306 Ga0500568_0063386 3300053139 Bacteria 1426
307 Ga0500616_0177502 3300053153 Bacteria 962
308 Ga0500622_0001619 3300053156 Bacteria 17667
309 Ga0500622_0214046 3300053156 Bacteria 868
310 Ga0500636_0336472 3300053177 Bacteria 727
311 Ga0500645_040092 3300053730 Bacteria 1386
312 Ga0500661_026992 3300055283 Unclassified 1015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026035 Ga0207703_11267247 Ga0207703_112672471 124
2 3300005329 Ga0070683_100720225 Ga0070683_1007202252 125
3 3300013102 Ga0157371_10080119 Ga0157371_100801191 125
4 3300013307 Ga0157372_10303421 Ga0157372_103034212 125
5 3300049742 Ga0501080_0454779 Ga0501080_0454779_18_395 125
6 iso_pu_bacteria 2738541278 2738726065 125
7 3300013297 Ga0157378_11185870 Ga0157378_111858702 126
8 3300013307 Ga0157372_11298726 Ga0157372_112987262 126
9 3300025931 Ga0207644_11582647 Ga0207644_115826471 126
10 3300048911 Ga0496108_1234251 Ga0496108_1234251_31_411 126
11 3300005327 Ga0070658_10000176 Ga0070658_1000017636 127
12 3300005328 Ga0070676_10000034 Ga0070676_1000003420 127
13 3300005334 Ga0068869_100101426 Ga0068869_1001014261 127
14 3300005335 Ga0070666_10000437 Ga0070666_1000043720 127
15 3300005337 Ga0070682_100000005 Ga0070682_100000005136 127
16 3300005338 Ga0068868_100001305 Ga0068868_10000130510 127
17 3300005338 Ga0068868_100898591 Ga0068868_1008985912 127
18 3300005347 Ga0070668_100000087 Ga0070668_10000008722 127
19 3300005364 Ga0070673_100000074 Ga0070673_10000007412 127
20 3300005364 Ga0070673_100122747 Ga0070673_1001227473 127
21 3300005367 Ga0070667_100000031 Ga0070667_10000003153 127
22 3300005455 Ga0070663_100941236 Ga0070663_1009412362 127
23 3300005457 Ga0070662_100043302 Ga0070662_1000433023 127
24 3300005459 Ga0068867_100006590 Ga0068867_1000065903 127
25 3300005459 Ga0068867_102027806 Ga0068867_1020278061 127
26 3300005539 Ga0068853_100012420 Ga0068853_1000124206 127
27 3300005539 Ga0068853_101938860 Ga0068853_1019388601 127
28 3300005543 Ga0070672_100000002 Ga0070672_10000000235 127
29 3300005548 Ga0070665_100000222 Ga0070665_10000022281 127
30 3300005563 Ga0068855_100056937 Ga0068855_1000569373 127
31 3300005618 Ga0068864_100008795 Ga0068864_1000087957 127
32 3300005719 Ga0068861_100037086 Ga0068861_1000370863 127
33 3300005834 Ga0068851_10000267 Ga0068851_100002678 127
34 3300005843 Ga0068860_100409759 Ga0068860_1004097592 127
35 3300006237 Ga0097621_100035981 Ga0097621_1000359811 127
36 3300006237 Ga0097621_100731402 Ga0097621_1007314022 127
37 3300006358 Ga0068871_100004279 Ga0068871_1000042793 127
38 3300006881 Ga0068865_100003834 Ga0068865_1000038348 127
39 3300009093 Ga0105240_10424873 Ga0105240_104248732 127
40 3300009098 Ga0105245_10246823 Ga0105245_102468232 127
41 3300009148 Ga0105243_10187583 Ga0105243_101875832 127
42 3300009174 Ga0105241_10471850 Ga0105241_104718502 127
43 3300009176 Ga0105242_10009613 Ga0105242_100096138 127
44 3300009177 Ga0105248_10064839 Ga0105248_100648392 127
45 3300009545 Ga0105237_10439546 Ga0105237_104395463 127
46 3300009551 Ga0105238_10164857 Ga0105238_101648572 127
47 3300009553 Ga0105249_10004261 Ga0105249_100042612 127
48 3300010375 Ga0105239_10421218 Ga0105239_104212182 127
49 3300011119 Ga0105246_10045180 Ga0105246_100451803 127
50 3300013102 Ga0157371_10119400 Ga0157371_101194002 127
51 3300013296 Ga0157374_10001136 Ga0157374_1000113620 127
52 3300013296 Ga0157374_11487658 Ga0157374_114876581 127
53 3300013297 Ga0157378_10053645 Ga0157378_100536452 127
54 3300013306 Ga0163162_10000029 Ga0163162_1000002945 127
55 3300013306 Ga0163162_10241517 Ga0163162_102415172 127
56 3300013306 Ga0163162_11160500 Ga0163162_111605002 127
57 3300013306 Ga0163162_12288327 Ga0163162_122883271 127
58 3300013307 Ga0157372_10083446 Ga0157372_100834463 127
59 3300013308 Ga0157375_10000042 Ga0157375_10000042116 127
60 3300013308 Ga0157375_11366168 Ga0157375_113661681 127
61 3300014325 Ga0163163_10000174 Ga0163163_1000017453 127
62 3300014325 Ga0163163_10409851 Ga0163163_104098512 127
63 3300014326 Ga0157380_10911333 Ga0157380_109113332 127
64 3300014968 Ga0157379_10000080 Ga0157379_1000008021 127
65 3300014969 Ga0157376_10000521 Ga0157376_1000052117 127
66 3300014969 Ga0157376_12772449 Ga0157376_127724491 127
67 3300017792 Ga0163161_10077471 Ga0163161_100774712 127
68 3300017792 Ga0163161_10723749 Ga0163161_107237492 127
69 3300017792 Ga0163161_11558878 Ga0163161_115588781 127
70 3300025315 Ga0207697_10120126 Ga0207697_101201262 127
71 3300025903 Ga0207680_10000657 Ga0207680_1000065715 127
72 3300025907 Ga0207645_10000337 Ga0207645_1000033731 127
73 3300025909 Ga0207705_10001116 Ga0207705_1000111622 127
74 3300025913 Ga0207695_10664053 Ga0207695_106640532 127
75 3300025914 Ga0207671_10532969 Ga0207671_105329692 127
76 3300025924 Ga0207694_10199644 Ga0207694_101996442 127
77 3300025925 Ga0207650_10705877 Ga0207650_107058771 127
78 3300025927 Ga0207687_10261596 Ga0207687_102615963 127
79 3300025933 Ga0207706_10004551 Ga0207706_1000455111 127
80 3300025934 Ga0207686_10015430 Ga0207686_100154302 127
81 3300025935 Ga0207709_10126114 Ga0207709_101261142 127
82 3300025940 Ga0207691_10000004 Ga0207691_1000000445 127
83 3300025940 Ga0207691_10392613 Ga0207691_103926132 127
84 3300025941 Ga0207711_10170645 Ga0207711_101706453 127
85 3300025960 Ga0207651_10005923 Ga0207651_100059233 127
86 3300025960 Ga0207651_10181831 Ga0207651_101818312 127
87 3300025961 Ga0207712_10125704 Ga0207712_101257042 127
88 3300025972 Ga0207668_10000551 Ga0207668_100005513 127
89 3300025981 Ga0207640_10326359 Ga0207640_103263592 127
90 3300025986 Ga0207658_10000059 Ga0207658_1000005996 127
91 3300026023 Ga0207677_10002598 Ga0207677_1000259810 127
92 3300026023 Ga0207677_10738117 Ga0207677_107381172 127
93 3300026035 Ga0207703_10039213 Ga0207703_100392132 127
94 3300026041 Ga0207639_10099855 Ga0207639_100998553 127
95 3300026041 Ga0207639_11807713 Ga0207639_118077131 127
96 3300026067 Ga0207678_10300920 Ga0207678_103009202 127
97 3300026089 Ga0207648_10016208 Ga0207648_100162086 127
98 3300026089 Ga0207648_10196127 Ga0207648_101961273 127
99 3300026095 Ga0207676_10008891 Ga0207676_100088913 127
100 3300026118 Ga0207675_100019866 Ga0207675_1000198663 127
101 3300026121 Ga0207683_10828791 Ga0207683_108287912 127
102 3300028379 Ga0268266_10006251 Ga0268266_100062519 127
103 3300028381 Ga0268264_10379247 Ga0268264_103792472 127
104 3300031507 Ga0307509_10055018 Ga0307509_100550184 127
105 3300031595 Ga0265313_10027008 Ga0265313_100270084 127
106 3300041456 Ga0451795_0190990 Ga0451795_0190990_115_510 127
107 3300041460 Ga0451802_1266609 Ga0451802_1266609_171_566 127
108 3300041486 Ga0451807_2560468 Ga0451807_2560468_45_440 127
109 3300041507 Ga0451851_1150644 Ga0451851_1150644_17_400 127
110 3300042876 Ga0451577_0028329 Ga0451577_0028329_1767_2150 127
111 3300046460 Ga0495638_0136053 Ga0495638_0136053_154_549 127
112 3300046460 Ga0495638_0410248 Ga0495638_0410248_208_603 127
113 3300046519 Ga0495632_0248940 Ga0495632_0248940_266_661 127
114 3300046616 Ga0495668_0000268 Ga0495668_0000268_23373_23756 127
115 3300048917 Ga0496114_1044841 Ga0496114_1044841_183_566 127
116 3300049758 Ga0501241_013675 Ga0501241_013675_550_945 127
117 3300049767 Ga0501270_128793 Ga0501270_128793_123_518 127
118 3300050493 nmdc:mga0k408_836615_c1 nmdc:mga0k408_836615_c1_60_503 127
119 3300053088 Ga0500644_0384133 Ga0500644_0384133_161_556 127
120 3300053090 Ga0500646_0051039 Ga0500646_0051039_171_629 127
121 3300053092 Ga0500583_0000037 Ga0500583_0000037_23641_24036 127
122 3300053092 Ga0500583_0007626 Ga0500583_0007626_2834_3229 127
123 3300053098 Ga0500650_0044999 Ga0500650_0044999_554_1030 127
124 3300053104 Ga0500556_0012715 Ga0500556_0012715_1843_2226 127
125 3300053130 Ga0500642_0195244 Ga0500642_0195244_210_605 127
126 3300053131 Ga0500652_006031 Ga0500652_006031_968_1363 127
127 3300053134 Ga0500658_0162447 Ga0500658_0162447_407_802 127
128 3300053153 Ga0500616_0177502 Ga0500616_0177502_247_642 127
129 3300053156 Ga0500622_0214046 Ga0500622_0214046_47_442 127
130 3300003322 rootL2_10003615 rootL2_100036153 128
131 3300003323 rootH1_10043167 rootH1_100431675 128
132 3300003323 rootH1_10060111 rootH1_100601113 128
133 3300005331 Ga0070670_101106236 Ga0070670_1011062361 128
134 3300005355 Ga0070671_100141631 Ga0070671_1001416312 128
135 3300005467 Ga0070706_101087797 Ga0070706_1010877971 128
136 3300005577 Ga0068857_100659467 Ga0068857_1006594671 128
137 3300005843 Ga0068860_100005968 Ga0068860_1000059684 128
138 3300006237 Ga0097621_100265837 Ga0097621_1002658372 128
139 3300006358 Ga0068871_100848359 Ga0068871_1008483592 128
140 3300006358 Ga0068871_102024833 Ga0068871_1020248331 128
141 3300009545 Ga0105237_10266917 Ga0105237_102669172 128
142 3300013105 Ga0157369_10055525 Ga0157369_100555253 128
143 3300013296 Ga0157374_10165412 Ga0157374_101654121 128
144 3300013297 Ga0157378_12375910 Ga0157378_123759101 128
145 3300013306 Ga0163162_10000576 Ga0163162_1000057621 128
146 3300014326 Ga0157380_11176193 Ga0157380_111761932 128
147 3300014326 Ga0157380_11751942 Ga0157380_117519421 128
148 3300014968 Ga0157379_12299281 Ga0157379_122992811 128
149 3300014969 Ga0157376_10019036 Ga0157376_100190364 128
150 3300014969 Ga0157376_12551005 Ga0157376_125510052 128
151 3300025931 Ga0207644_10101514 Ga0207644_101015143 128
152 3300026116 Ga0207674_10522812 Ga0207674_105228122 128
153 3300026116 Ga0207674_11015252 Ga0207674_110152522 128
154 3300028381 Ga0268264_10003852 Ga0268264_1000385212 128
155 3300041404 Ga0439436_0010275 Ga0439436_0010275_306_707 128
156 3300041406 Ga0439439_0008940 Ga0439439_0008940_492_893 128
157 3300041451 Ga0451791_1884426 Ga0451791_1884426_16_420 128
158 3300041512 Ga0451853_2454815 Ga0451853_2454815_177_581 128
159 3300041512 Ga0451853_4001071 Ga0451853_4001071_946_1347 128
160 3300042007 Ga0439449_0375087 Ga0439449_0375087_19_417 128
161 3300042014 Ga0439457_001223 Ga0439457_001223_5181_5582 128
162 3300042014 Ga0439457_052525 Ga0439457_052525_259_729 128
163 3300042015 Ga0439462_0006893 Ga0439462_0006893_1384_1785 128
164 3300046675 Ga0495657_0374222 Ga0495657_0374222_421_807 128
165 3300047320 Ga0495672_0134542 Ga0495672_0134542_121_507 128
166 3300053090 Ga0500646_0017307 Ga0500646_0017307_500_901 128
167 3300053108 Ga0500562_052946 Ga0500562_052946_480_866 128
168 3300053177 Ga0500636_0336472 Ga0500636_0336472_216_608 128
169 3300005290 Ga0065712_10250696 Ga0065712_102506962 129
170 3300005327 Ga0070658_10682994 Ga0070658_106829942 129
171 3300005329 Ga0070683_100058160 Ga0070683_1000581604 129
172 3300005330 Ga0070690_100777234 Ga0070690_1007772342 129
173 3300005331 Ga0070670_100104648 Ga0070670_1001046482 129
174 3300005331 Ga0070670_100707710 Ga0070670_1007077102 129
175 3300005338 Ga0068868_100892605 Ga0068868_1008926052 129
176 3300005340 Ga0070689_100458848 Ga0070689_1004588482 129
177 3300005344 Ga0070661_100351708 Ga0070661_1003517082 129
178 3300005354 Ga0070675_100044653 Ga0070675_1000446532 129
179 3300005355 Ga0070671_100207291 Ga0070671_1002072913 129
180 3300005535 Ga0070684_100034750 Ga0070684_1000347505 129
181 3300005543 Ga0070672_100452560 Ga0070672_1004525604 129
182 3300005564 Ga0070664_100003850 Ga0070664_1000038509 129
183 3300005577 Ga0068857_101314324 Ga0068857_1013143241 129
184 3300005615 Ga0070702_101679965 Ga0070702_1016799651 129
185 3300005616 Ga0068852_100145128 Ga0068852_1001451283 129
186 3300005834 Ga0068851_10142374 Ga0068851_101423741 129
187 3300005842 Ga0068858_102233240 Ga0068858_1022332401 129
188 3300009094 Ga0111539_10773800 Ga0111539_107738001 129
189 3300013102 Ga0157371_10692529 Ga0157371_106925292 129
190 3300013104 Ga0157370_10097252 Ga0157370_100972523 129
191 3300013296 Ga0157374_10237224 Ga0157374_102372243 129
192 3300013296 Ga0157374_11313566 Ga0157374_113135661 129
193 3300013306 Ga0163162_10017733 Ga0163162_100177336 129
194 3300014325 Ga0163163_10945000 Ga0163163_109450002 129
195 3300014745 Ga0157377_10017457 Ga0157377_100174574 129
196 3300025315 Ga0207697_10449857 Ga0207697_104498571 129
197 3300025321 Ga0207656_10402409 Ga0207656_104024092 129
198 3300025903 Ga0207680_10253626 Ga0207680_102536263 129
199 3300025911 Ga0207654_10326361 Ga0207654_103263612 129
200 3300025920 Ga0207649_10092336 Ga0207649_100923363 129
201 3300025925 Ga0207650_10051066 Ga0207650_100510662 129
202 3300025931 Ga0207644_10422644 Ga0207644_104226442 129
203 3300025940 Ga0207691_10567685 Ga0207691_105676851 129
204 3300025944 Ga0207661_10492712 Ga0207661_104927122 129
205 3300025945 Ga0207679_10004909 Ga0207679_100049099 129
206 3300026023 Ga0207677_10881335 Ga0207677_108813352 129
207 3300026035 Ga0207703_12369799 Ga0207703_123697991 129
208 3300026116 Ga0207674_10351663 Ga0207674_103516631 129
209 3300026116 Ga0207674_10479494 Ga0207674_104794941 129
210 3300042876 Ga0451577_0050227 Ga0451577_0050227_2867_3256 129
211 3300042876 Ga0451577_0569456 Ga0451577_0569456_339_728 129
212 3300044712 Ga0453684_0274601 Ga0453684_0274601_268_657 129
213 3300044712 Ga0453684_0445439 Ga0453684_0445439_576_965 129
214 3300046472 Ga0495580_0318580 Ga0495580_0318580_238_627 129
215 3300046473 Ga0495582_0607100 Ga0495582_0607100_104_493 129
216 3300046558 Ga0495633_0061032 Ga0495633_0061032_60_449 129
217 3300046691 Ga0495670_0080613 Ga0495670_0080613_1241_1630 129
218 3300047322 Ga0495680_0820040 Ga0495680_0820040_123_512 129
219 3300048907 Ga0496104_1301726 Ga0496104_1301726_31_420 129
220 3300049569 Ga0501032_0956589 Ga0501032_0956589_25_417 129
221 3300049571 Ga0501034_0659380 Ga0501034_0659380_542_934 129
222 3300049571 Ga0501034_0997549 Ga0501034_0997549_33_425 129
223 3300049574 Ga0501038_0328229 Ga0501038_0328229_365_757 129
224 3300049579 Ga0501043_0024134 Ga0501043_0024134_3871_4263 129
225 3300053084 Ga0495595_0447067 Ga0495595_0447067_166_555 129
226 iso_pu_bacteria 2929154850 2929160078 129
227 3300005290 Ga0065712_10757403 Ga0065712_107574031 130
228 3300005329 Ga0070683_101025540 Ga0070683_1010255402 130
229 3300005335 Ga0070666_10279645 Ga0070666_102796451 130
230 3300005335 Ga0070666_10437742 Ga0070666_104377422 130
231 3300005336 Ga0070680_100136022 Ga0070680_1001360222 130
232 3300005337 Ga0070682_100281097 Ga0070682_1002810971 130
233 3300005339 Ga0070660_100129406 Ga0070660_1001294063 130
234 3300005344 Ga0070661_101783565 Ga0070661_1017835651 130
235 3300005354 Ga0070675_100624685 Ga0070675_1006246852 130
236 3300005366 Ga0070659_100422579 Ga0070659_1004225791 130
237 3300005456 Ga0070678_100895391 Ga0070678_1008953911 130
238 3300005459 Ga0068867_100518831 Ga0068867_1005188312 130
239 3300005459 Ga0068867_101157964 Ga0068867_1011579642 130
240 3300005535 Ga0070684_100062911 Ga0070684_1000629112 130
241 3300005544 Ga0070686_100366059 Ga0070686_1003660592 130
242 3300005547 Ga0070693_100297473 Ga0070693_1002974732 130
243 3300005578 Ga0068854_101063864 Ga0068854_1010638642 130
244 3300005616 Ga0068852_101085323 Ga0068852_1010853232 130
245 3300005618 Ga0068864_101480625 Ga0068864_1014806251 130
246 3300005718 Ga0068866_11236162 Ga0068866_112361621 130
247 3300005834 Ga0068851_10602846 Ga0068851_106028462 130
248 3300006358 Ga0068871_100005842 Ga0068871_10000584210 130
249 3300009176 Ga0105242_10130545 Ga0105242_101305452 130
250 3300013102 Ga0157371_10016990 Ga0157371_100169904 130
251 3300013102 Ga0157371_10184508 Ga0157371_101845082 130
252 3300013104 Ga0157370_11972322 Ga0157370_119723221 130
253 3300013296 Ga0157374_11260577 Ga0157374_112605771 130
254 3300013297 Ga0157378_10070588 Ga0157378_100705882 130
255 3300013306 Ga0163162_10216371 Ga0163162_102163713 130
256 3300013306 Ga0163162_12184470 Ga0163162_121844701 130
257 3300013307 Ga0157372_10021979 Ga0157372_100219798 130
258 3300013307 Ga0157372_10586440 Ga0157372_105864402 130
259 3300013308 Ga0157375_13595896 Ga0157375_135958961 130
260 3300014968 Ga0157379_10206184 Ga0157379_102061842 130
261 3300014968 Ga0157379_11139079 Ga0157379_111390792 130
262 3300014969 Ga0157376_10032269 Ga0157376_100322694 130
263 3300014969 Ga0157376_10327634 Ga0157376_103276341 130
264 3300014969 Ga0157376_10633508 Ga0157376_106335081 130
265 3300014969 Ga0157376_10979623 Ga0157376_109796231 130
266 3300017792 Ga0163161_11167625 Ga0163161_111676251 130
267 3300021384 Ga0213876_10083498 Ga0213876_100834982 130
268 3300021384 Ga0213876_10376151 Ga0213876_103761512 130
269 3300025321 Ga0207656_10289006 Ga0207656_102890062 130
270 3300025919 Ga0207657_10160387 Ga0207657_101603873 130
271 3300025920 Ga0207649_11280874 Ga0207649_112808741 130
272 3300025921 Ga0207652_10772445 Ga0207652_107724453 130
273 3300025926 Ga0207659_10863631 Ga0207659_108636311 130
274 3300025926 Ga0207659_11075990 Ga0207659_110759901 130
275 3300025940 Ga0207691_10260930 Ga0207691_102609302 130
276 3300025945 Ga0207679_10166218 Ga0207679_101662181 130
277 3300026089 Ga0207648_11468715 Ga0207648_114687151 130
278 3300026142 Ga0207698_10948503 Ga0207698_109485032 130
279 3300039437 Ga0436365_0517469 Ga0436365_0517469_60_452 130
280 3300039437 Ga0436365_1668150 Ga0436365_1668150_6840_7232 130
281 3300041404 Ga0439436_0204196 Ga0439436_0204196_106_498 130
282 3300049589 Ga0501073_0822620 Ga0501073_0822620_147_539 130
283 3300049823 Ga0501044_0323744 Ga0501044_0323744_480_872 130
284 iso_pu_bacteria 2818991444 2819589838 131
285 iso_pu_bacteria 2929921140 2929922566 131
286 iso_pu_bacteria 8003151029 8003156006 131
287 3300006237 Ga0097621_100827275 Ga0097621_1008272752 132
288 3300006358 Ga0068871_102308913 Ga0068871_1023089131 132
289 3300049742 Ga0501080_0353646 Ga0501080_0353646_369_767 132
290 3300013105 Ga0157369_10162825 Ga0157369_101628251 133
291 3300013296 Ga0157374_10013137 Ga0157374_100131377 133
292 3300014968 Ga0157379_11420173 Ga0157379_114201731 133
293 3300036401 Ga0373937_0093811 Ga0373937_0093811_1632_2072 133
294 3300036401 Ga0373937_0667608 Ga0373937_0667608_45_485 133
295 3300046517 Ga0495630_0969701 Ga0495630_0969701_60_500 133
296 3300046535 Ga0495586_0059936 Ga0495586_0059936_1004_1444 133
297 3300046663 Ga0495635_0086507 Ga0495635_0086507_1004_1444 133
298 3300047319 Ga0495674_0194426 Ga0495674_0194426_199_600 133
299 3300047471 Ga0495684_0180038 Ga0495684_0180038_683_1123 133
300 3300048907 Ga0496104_0792541 Ga0496104_0792541_237_638 133
301 3300048918 Ga0496115_0140613 Ga0496115_0140613_73_474 133
302 3300048918 Ga0496115_0040474 Ga0496115_0040474_621_1025 134
303 3300048927 Ga0496124_0151514 Ga0496124_0151514_347_757 134
304 3300001989 JGI24739J22299_10024844 JGI24739J22299_100248442 135
305 3300003215 JGI25153J46596_10022576 JGI25153J46596_100225762 135
306 3300003323 rootH1_10015677 rootH1_100156772 135
307 3300010375 Ga0105239_10118502 Ga0105239_101185022 135
308 3300025297 Ga0209758_1030531 Ga0209758_10305312 135
309 3300025302 Ga0207426_1000293 Ga0207426_100029314 135
310 3300025302 Ga0207426_1041502 Ga0207426_10415022 135
311 3300053088 Ga0500644_0031312 Ga0500644_0031312_276_689 135
312 3300053118 Ga0500594_0028819 Ga0500594_0028819_258_680 135
313 3300053131 Ga0500652_002036 Ga0500652_002036_4554_4961 135
314 3300053139 Ga0500568_0063386 Ga0500568_0063386_766_1173 135
315 3300053156 Ga0500622_0001619 Ga0500622_0001619_15632_16051 135
316 3300053730 Ga0500645_040092 Ga0500645_040092_186_599 135
317 3300055283 Ga0500661_026992 Ga0500661_026992_213_635 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

35

80

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ope-assembly1.cif.gz_1 rqch dr variant bound to 50s-peptidyl-trna-rqcp rqc complex (rigid body refinement) 0.9049 8 86
7asa-assembly1.cif.gz_1 bacillus subtilis ribosome-associated quality control complex state b, multibody refinement focussed on rqch. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9047 8 86
7aqc-assembly1.cif.gz_Y structure of the bacterial rqc complex (decoding state) 0.8978 8 86
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.8937 9 48
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.8876 9 57
ID Description Score Start End Superfamily
af_Q2G0R5_1_87_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9175 8 87 3.10.290.10
af_Q25804_3_135_1.10.1050.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain 0.9153 8 52 1.10.1050.10
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9123 8 49 3.10.290.10
af_O60063_95_238_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9055 9 57 3.10.290.10
af_P9WHQ3_3_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.8988 7 58 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A2E9MKS1-F1-model_v4 RNA-binding S4 domain-containing protein 0.9683 8 88 GO:0003723
AF-A0A243S3J5-F1-model_v4 RNA-binding S4 domain-containing protein 0.9645 7 89 GO:0003723
AF-D6A9U2-F1-model_v4 RNA-binding S4 domain-containing protein 0.9638 6 86 GO:0003723
AF-A0A1X4HW27-F1-model_v4 Heat-shock protein 0.9578 3 88 GO:0003723
AF-A0A6N7FPV5-F1-model_v4 RNA-binding S4 domain-containing protein 0.9567 6 86 GO:0003723

Feature Viewer

pLDDT pTM Quality
79.12 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map