F404144

General Info

Members Datasets Scaffolds Average Seq Length
317 226 634 210

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_11042406|Ga0105239_110424062
Length 246
Sequence VGGCNVGAERFSLTSCNIKPACEDSTCCSFDQAETSMGKVRVAGFGVSIDGYGAGAEQSLEHPLRKGGKELHNWFYPTRTFRSMIGKDGGVDDRFARTASEGFGAFILGRNMFGPIRGEWPDESWKGWWGDNPPYHAPTFILTHNARAPIVMEGGTTFHFVTDGIEAALAQARAAAGDLDVKIGGGVSTVRQYLLARAIDELHLALSPVFLGHGESLFAGIDLPGLGYRVTEAVPTELATHLVLTR

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
90 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
115 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
116 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
117 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
118 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
151 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
215 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
219 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
220 2818991435 Caulobacter henricii 536 Isolate Unclassified
221 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
222 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
223 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
224 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
225 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
226 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 1.89
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 1.26
Rhizoplane 8.2
Rhizosphere 80.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_11042406 3300010375 Bacteria 941
2 Ga0070670_100691558 3300005331 Bacteria 917
3 Ga0070680_100014676 3300005336 Bacteria 6126
4 Ga0068868_100127284 3300005338 Bacteria 2082
5 Ga0070661_100232235 3300005344 Bacteria 1418
6 Ga0070671_100948516 3300005355 Bacteria 753
7 Ga0070714_100007408 3300005435 Bacteria 8539
8 Ga0070713_100065490 3300005436 Bacteria 3052
9 Ga0070713_100313642 3300005436 Bacteria 1447
10 Ga0070713_100343662 3300005436 Bacteria 1383
11 Ga0070710_10399694 3300005437 Bacteria 921
12 Ga0070705_100085570 3300005440 Bacteria 1949
13 Ga0070708_100246218 3300005445 Bacteria 1679
14 Ga0070663_100354004 3300005455 Bacteria 1189
15 Ga0070681_10022680 3300005458 Bacteria 6307
16 Ga0070681_10233519 3300005458 Bacteria 1753
17 Ga0070706_100320935 3300005467 Bacteria 1444
18 Ga0070707_100007568 3300005468 Bacteria 10085
19 Ga0070707_100633006 3300005468 Bacteria 1032
20 Ga0070699_100102317 3300005518 Bacteria 2512
21 Ga0070679_100132649 3300005530 Bacteria 2472
22 Ga0070679_100382248 3300005530 Bacteria 1355
23 Ga0070684_100039454 3300005535 Bacteria 4061
24 Ga0070697_100194190 3300005536 Bacteria 1724
25 Ga0068853_100005841 3300005539 Bacteria 9693
26 Ga0070686_100126985 3300005544 Bacteria 1759
27 Ga0070695_100208038 3300005545 Bacteria 1402
28 Ga0068855_100063026 3300005563 Bacteria 4327
29 Ga0068855_100108954 3300005563 Bacteria 3181
30 Ga0068854_100028297 3300005578 Bacteria 3871
31 Ga0068854_100204514 3300005578 Bacteria 1554
32 Ga0068854_100479966 3300005578 Bacteria 1044
33 Ga0068856_100038601 3300005614 Bacteria 4688
34 Ga0068861_100000375 3300005719 Bacteria 25742
35 Ga0068858_100000092 3300005842 Bacteria 93550
36 Ga0068858_100373347 3300005842 Bacteria 1368
37 Ga0070717_10026242 3300006028 Bacteria 4646
38 Ga0070717_10074535 3300006028 Bacteria 2837
39 Ga0070717_10095322 3300006028 Bacteria 2519
40 Ga0070717_10172218 3300006028 Bacteria 1883
41 Ga0070716_100726012 3300006173 Bacteria 762
42 Ga0070712_100094297 3300006175 Bacteria 2199
43 Ga0075431_100001598 3300006847 Bacteria 21116
44 Ga0075433_10841565 3300006852 Bacteria 801
45 Ga0075434_100008352 3300006871 Bacteria 9623
46 Ga0075436_100020333 3300006914 Bacteria 4557
47 Ga0075435_100004144 3300007076 Bacteria 9936
48 Ga0105240_10022811 3300009093 Bacteria 8293
49 Ga0105240_10057758 3300009093 Bacteria 4845
50 Ga0105240_10124766 3300009093 Bacteria 3096
51 Ga0105240_10695827 3300009093 Bacteria 1110
52 Ga0111539_10252587 3300009094 Bacteria 2053
53 Ga0105245_10209351 3300009098 Bacteria 1876
54 Ga0105245_10571218 3300009098 Bacteria 1154
55 Ga0105241_10015359 3300009174 Bacteria 5608
56 Ga0105248_10025939 3300009177 Bacteria 6518
57 Ga0105237_10208662 3300009545 Bacteria 1954
58 Ga0105237_10316768 3300009545 Bacteria 1563
59 Ga0105237_10326261 3300009545 Bacteria 1539
60 Ga0105238_10026170 3300009551 Bacteria 5945
61 Ga0105238_10066442 3300009551 Bacteria 3608
62 Ga0105238_10083356 3300009551 Bacteria 3186
63 Ga0105238_10233817 3300009551 Bacteria 1815
64 Ga0099796_10062968 3300010159 Bacteria 1320
65 Ga0105239_10011216 3300010375 Bacteria 10001
66 Ga0157370_10187652 3300013104 Bacteria 1919
67 Ga0157369_10021543 3300013105 Bacteria 7209
68 Ga0157369_10023673 3300013105 Bacteria 6840
69 Ga0157369_10028297 3300013105 Bacteria 6205
70 Ga0157369_10349747 3300013105 Bacteria 1535
71 Ga0171462_1004 3300013250 Bacteria 678877
72 Ga0157374_10418564 3300013296 Bacteria 1338
73 Ga0157372_10012081 3300013307 Bacteria 9199
74 Ga0157372_10086827 3300013307 Bacteria 3549
75 Ga0157372_10115264 3300013307 Bacteria 3081
76 Ga0163163_10253303 3300014325 Bacteria 1811
77 Ga0157379_10051262 3300014968 Bacteria 3686
78 Ga0163161_10091702 3300017792 Bacteria 2249
79 Ga0163161_10822458 3300017792 Bacteria 782
80 Ga0206356_11221166 3300020070 Bacteria 1220
81 Ga0206352_10166636 3300020078 Bacteria 1021
82 Ga0206354_11078640 3300020081 Bacteria 924
83 Ga0213873_10004958 3300021358 Bacteria 2519
84 Ga0213872_10193397 3300021361 Bacteria 875
85 Ga0213875_10034770 3300021388 Bacteria 2379
86 Ga0213871_10125922 3300021441 Bacteria 766
87 Ga0224712_10007156 3300022467 Bacteria 3230
88 Ga0207699_10357734 3300025906 Bacteria 1032
89 Ga0207699_10399857 3300025906 Bacteria 978
90 Ga0207684_10253501 3300025910 Bacteria 1518
91 Ga0207654_10017149 3300025911 Bacteria 3782
92 Ga0207707_10005763 3300025912 Bacteria 10830
93 Ga0207707_10100098 3300025912 Bacteria 2533
94 Ga0207695_10001998 3300025913 Bacteria 31500
95 Ga0207695_10009334 3300025913 Bacteria 12136
96 Ga0207671_10067018 3300025914 Bacteria 2673
97 Ga0207671_10305089 3300025914 Bacteria 1258
98 Ga0207693_10084925 3300025915 Bacteria 2480
99 Ga0207660_10278290 3300025917 Bacteria 1327
100 Ga0207652_10219512 3300025921 Bacteria 1713
101 Ga0207652_10238910 3300025921 Bacteria 1637
102 Ga0207646_10004860 3300025922 Bacteria 14396
103 Ga0207694_10000157 3300025924 Bacteria 70076
104 Ga0207694_10068151 3300025924 Bacteria 2778
105 Ga0207694_10068700 3300025924 Bacteria 2767
106 Ga0207700_10301575 3300025928 Bacteria 1384
107 Ga0207664_10000737 3300025929 Bacteria 22232
108 Ga0207664_10086649 3300025929 Bacteria 2559
109 Ga0207690_10164060 3300025932 Bacteria 1659
110 Ga0207706_10064402 3300025933 Bacteria 3227
111 Ga0207670_10227893 3300025936 Bacteria 1430
112 Ga0207665_10490477 3300025939 Bacteria 948
113 Ga0207665_10753503 3300025939 Bacteria 768
114 Ga0207711_10059553 3300025941 Bacteria 3288
115 Ga0207679_10037399 3300025945 Bacteria 3450
116 Ga0207667_10009414 3300025949 Bacteria 11508
117 Ga0207667_10011520 3300025949 Bacteria 10275
118 Ga0207667_10442617 3300025949 Bacteria 1321
119 Ga0207677_10557320 3300026023 Bacteria 1000
120 Ga0207703_10000737 3300026035 Bacteria 32201
121 Ga0207703_10350638 3300026035 Bacteria 1359
122 Ga0207703_11389087 3300026035 Bacteria 675
123 Ga0207639_10014940 3300026041 Bacteria 5470
124 Ga0207678_10311829 3300026067 Bacteria 1353
125 Ga0207702_10000002 3300026078 Bacteria 491507
126 Ga0207702_10057323 3300026078 Bacteria 3311
127 Ga0207702_10573827 3300026078 Bacteria 1105
128 Ga0207675_100000019 3300026118 Bacteria 122642
129 Ga0207698_10063363 3300026142 Bacteria 2893
130 Ga0207698_10109072 3300026142 Bacteria 2315
131 Ga0207698_10110392 3300026142 Bacteria 2304
132 Ga0207698_10520727 3300026142 Bacteria 1160
133 Ga0307517_10039490 3300028786 Bacteria 5181
134 Ga0265338_10161650 3300028800 Bacteria 1729
135 Ga0307511_10031383 3300030521 Bacteria 4748
136 Ga0265765_1018296 3300030879 Bacteria 832
137 Ga0265760_10076245 3300031090 Bacteria 1034
138 Ga0265328_10145845 3300031239 Bacteria 889
139 Ga0265339_10004753 3300031249 Bacteria 9207
140 Ga0265339_10067416 3300031249 Bacteria 1914
141 Ga0265327_10016605 3300031251 Bacteria 4664
142 Ga0307408_101087086 3300031548 Bacteria 741
143 Ga0307508_10011619 3300031616 Bacteria 8047
144 Ga0265314_10008536 3300031711 Bacteria 8758
145 Ga0265314_10128014 3300031711 Bacteria 1588
146 Ga0307409_100307394 3300031995 Bacteria 1478
147 Ga0373934_0064343 3300035086 Bacteria 1464
148 Ga0373923_0064313 3300035111 Bacteria 1564
149 Ga0373954_0081906 3300035118 Bacteria 1542
150 Ga0373955_0106772 3300035172 Bacteria 1614
151 Ga0373924_0235629 3300035410 Bacteria 809
152 Ga0373935_0205977 3300035692 Bacteria 1361
153 Ga0373933_0204374 3300035724 Bacteria 1264
154 Ga0373947_0535819 3300035725 Bacteria 797
155 Ga0373925_0196568 3300037068 Bacteria 1602
156 Ga0395899_0072708 3300037312 Bacteria 2516
157 Ga0436364_1400663 3300037853 Bacteria 3285
158 Ga0395901_0073703 3300038443 Bacteria 3561
159 Ga0395901_0788373 3300038443 Bacteria 940
160 Ga0436365_0670285 3300039437 Bacteria 836
161 Ga0436365_1063831 3300039437 Bacteria 1881
162 Ga0436360_0084123 3300039438 Bacteria 1018
163 Ga0436363_0083618 3300039450 Bacteria 929
164 Ga0451835_1085803 3300041492 Bacteria 3315
165 Ga0451839_0090435 3300041496 Bacteria 968
166 Ga0451849_0079886 3300041505 Bacteria 2637
167 Ga0451843_0616296 3300041509 Bacteria 1264
168 Ga0451855_1598589 3300041511 Bacteria 1807
169 Ga0466965_0025688 3300044683 Bacteria 2852
170 Ga0466968_0018501 3300044735 Bacteria 2795
171 Ga0466968_0080652 3300044735 Bacteria 1429
172 Ga0466970_0142324 3300044765 Bacteria 1321
173 Ga0466960_0047813 3300044901 Bacteria 2053
174 Ga0466960_0197319 3300044901 Bacteria 1098
175 Ga0466960_0287575 3300044901 Bacteria 923
176 Ga0466967_0004778 3300045976 Bacteria 9225
177 Ga0466967_0136745 3300045976 Bacteria 2279
178 Ga0495617_000785 3300046452 Bacteria 15390
179 Ga0495638_0001285 3300046460 Bacteria 23401
180 Ga0495650_0079681 3300046471 Bacteria 1266
181 Ga0495580_0253219 3300046472 Bacteria 1205
182 Ga0495664_0224032 3300046477 Bacteria 1138
183 Ga0495585_0000063 3300046492 Bacteria 109530
184 Ga0495594_0398663 3300046499 Bacteria 783
185 Ga0495607_0000029 3300046501 Bacteria 155005
186 Ga0495583_0027370 3300046506 Bacteria 2813
187 Ga0495583_0148551 3300046506 Bacteria 972
188 Ga0495606_0254004 3300046507 Bacteria 974
189 Ga0495608_0257875 3300046511 Bacteria 1086
190 Ga0495616_0050414 3300046513 Bacteria 2081
191 Ga0495616_0179253 3300046513 Bacteria 942
192 Ga0495620_0159165 3300046515 Bacteria 878
193 Ga0495631_0002304 3300046518 Bacteria 10891
194 Ga0495637_0011110 3300046520 Bacteria 4335
195 Ga0495640_0078320 3300046533 Bacteria 2202
196 Ga0495587_0322848 3300046536 Bacteria 862
197 Ga0495609_0055386 3300046538 Bacteria 1759
198 Ga0495611_0000003 3300046648 Bacteria 395679
199 Ga0495625_0000019 3300046660 Bacteria 298330
200 Ga0495661_0000703 3300046665 Bacteria 33156
201 Ga0495670_0004940 3300046691 Bacteria 6549
202 Ga0495671_0000549 3300046692 Bacteria 28132
203 Ga0495671_0027578 3300046692 Bacteria 2932
204 Ga0495589_0000018 3300046794 Bacteria 204851
205 Ga0495589_0209415 3300046794 Bacteria 918
206 Ga0495660_0000122 3300046810 Bacteria 85116
207 Ga0495680_0123022 3300047322 Bacteria 1914
208 Ga0495679_000017 3300047446 Bacteria 263230
209 Ga0495673_0004051 3300047469 Bacteria 9338
210 Ga0495686_0050315 3300047472 Bacteria 2619
211 Ga0495602_0280410 3300048088 Bacteria 1228
212 Ga0495614_0202319 3300048089 Bacteria 899
213 Ga0496100_0000324 3300048903 Bacteria 23608
214 Ga0496100_0029409 3300048903 Bacteria 3398
215 Ga0496100_0201096 3300048903 Bacteria 1452
216 Ga0496101_0001179 3300048904 Bacteria 15667
217 Ga0496101_0096416 3300048904 Bacteria 2207
218 Ga0496101_0296359 3300048904 Bacteria 1266
219 Ga0496102_0012797 3300048905 Bacteria 7264
220 Ga0496102_0015042 3300048905 Bacteria 6735
221 Ga0496102_0202002 3300048905 Bacteria 1874
222 Ga0496104_0004300 3300048907 Bacteria 12380
223 Ga0496104_0118634 3300048907 Bacteria 2540
224 Ga0496105_0063215 3300048908 Bacteria 3054
225 Ga0496105_0064430 3300048908 Bacteria 3024
226 Ga0496106_0040064 3300048909 Bacteria 3507
227 Ga0496106_0314966 3300048909 Bacteria 1256
228 Ga0496107_0059655 3300048910 Bacteria 2761
229 Ga0496109_0180108 3300048912 Bacteria 1984
230 Ga0496110_0073199 3300048913 Bacteria 3041
231 Ga0496110_0400241 3300048913 Bacteria 1252
232 Ga0496111_0044735 3300048914 Bacteria 3183
233 Ga0496112_0810685 3300048915 Bacteria 861
234 Ga0496114_0096708 3300048917 Bacteria 2514
235 Ga0496114_0202905 3300048917 Bacteria 1737
236 Ga0496115_0047569 3300048918 Bacteria 3431
237 Ga0496115_0158449 3300048918 Bacteria 1870
238 Ga0496115_0421182 3300048918 Bacteria 1082
239 Ga0496116_0008351 3300048919 Bacteria 8997
240 Ga0496117_0000035 3300048920 Bacteria 326449
241 Ga0496117_0037920 3300048920 Bacteria 3583
242 Ga0496118_0000054 3300048921 Bacteria 233617
243 Ga0496118_0000423 3300048921 Bacteria 70256
244 Ga0496118_0155312 3300048921 Bacteria 1425
245 Ga0496119_0005770 3300048922 Bacteria 11726
246 Ga0496120_0007388 3300048923 Bacteria 8187
247 Ga0496124_0120737 3300048927 Bacteria 2095
248 Ga0496125_0046520 3300048928 Bacteria 3639
249 Ga0496126_0034701 3300048929 Bacteria 4735
250 Ga0496126_0063283 3300048929 Bacteria 3316
251 Ga0495678_000210 3300049459 Bacteria 68186
252 Ga0495682_0004086 3300049460 Bacteria 6342
253 Ga0495682_0057728 3300049460 Bacteria 1404
254 Ga0501031_0007813 3300049568 Bacteria 6962
255 Ga0501032_0000767 3300049569 Bacteria 26035
256 Ga0501033_0035725 3300049570 Bacteria 3725
257 Ga0501033_0211001 3300049570 Bacteria 1385
258 Ga0501034_0054740 3300049571 Bacteria 4016
259 Ga0501036_0007805 3300049572 Bacteria 8750
260 Ga0501037_0003426 3300049573 Bacteria 11526
261 Ga0501037_0077229 3300049573 Bacteria 2417
262 Ga0501038_0037231 3300049574 Bacteria 4266
263 Ga0501038_0258281 3300049574 Bacteria 1378
264 Ga0501038_0480890 3300049574 Bacteria 952
265 Ga0501039_0052551 3300049575 Bacteria 3152
266 Ga0501043_0002085 3300049579 Bacteria 17072
267 Ga0501046_0003083 3300049580 Bacteria 15390
268 Ga0501047_0026148 3300049581 Bacteria 5614
269 Ga0501047_0141046 3300049581 Bacteria 2288
270 Ga0501048_0217959 3300049582 Bacteria 1353
271 Ga0501067_0000653 3300049583 Bacteria 18676
272 Ga0501067_0008290 3300049583 Bacteria 5770
273 Ga0501068_0007420 3300049584 Bacteria 6071
274 Ga0501069_0006325 3300049585 Bacteria 6191
275 Ga0501069_0372167 3300049585 Bacteria 843
276 Ga0501070_0004405 3300049586 Bacteria 12086
277 Ga0501070_0034537 3300049586 Bacteria 4227
278 Ga0501070_0235296 3300049586 Bacteria 1500
279 Ga0501072_0001615 3300049588 Bacteria 16849
280 Ga0501073_0001950 3300049589 Bacteria 15373
281 Ga0501074_0060812 3300049590 Bacteria 2721
282 Ga0501076_0140471 3300049592 Bacteria 1962
283 Ga0501077_0003301 3300049593 Bacteria 9710
284 Ga0501079_0011766 3300049741 Bacteria 6683
285 Ga0501080_0000291 3300049742 Bacteria 38072
286 Ga0501083_0034357 3300049744 Bacteria 3467
287 Ga0501035_0064008 3300049822 Bacteria 3269
288 Ga0501035_0107786 3300049822 Bacteria 2442
289 Ga0501044_0032490 3300049823 Bacteria 5486
290 Ga0501044_0100032 3300049823 Bacteria 2918
291 Ga0501044_0168563 3300049823 Bacteria 2162
292 Ga0501044_0551124 3300049823 Bacteria 1050
293 Ga0501045_0449881 3300049824 Bacteria 957
294 nmdc:mga05p37_686342_c1 3300050507 Bacteria 1140
295 nmdc:mga06r32_599_c1 3300050510 Bacteria 31400
296 nmdc:mga0n895_45041_c1 3300050512 Bacteria 4304
297 nmdc:mga0rr50_13931_c1 3300050513 Bacteria 5254
298 nmdc:mga08x19_589134_c1 3300050514 Bacteria 788
299 nmdc:mga08x19_9922_c1 3300050514 Bacteria 5706
300 nmdc:mga0a205_380674_c1 3300050515 Bacteria 1276
301 Ga0495601_0301078 3300053077 Bacteria 1044
302 Ga0495595_0093142 3300053084 Bacteria 1447
303 Ga0500643_000029 3300053087 Bacteria 211149
304 Ga0500643_002857 3300053087 Bacteria 8606
305 Ga0500555_000067 3300053103 Bacteria 52543
306 Ga0500564_212070 3300053138 Bacteria 789
307 Ga0501084_0002646 3300054114 Bacteria 14436
308 Ga0501082_0068063 3300060353 Bacteria 3066
309 2517407072 2517287029 Bacteria 6905599
310 2812324196 2811994872 Bacteria 4121241
311 2819540462 2818991435 Bacteria 5433759
312 2819649422 2818991454 Bacteria 5563326
313 2884338895 2884338543 Bacteria 4610696
314 2885310844 2885305155 Bacteria 7348390
315 2885331077 2885326080 Bacteria 7134805
316 2965069948 2965062239 Bacteria 7412989
317 2968132983 2968128360 Bacteria 6270294
318 Ga0105239_11042406
319 Ga0070670_100691558
320 Ga0070680_100014676
321 Ga0068868_100127284
322 Ga0070661_100232235
323 Ga0070671_100948516
324 Ga0070714_100007408
325 Ga0070713_100065490
326 Ga0070713_100313642
327 Ga0070713_100343662
328 Ga0070710_10399694
329 Ga0070705_100085570
330 Ga0070708_100246218
331 Ga0070663_100354004
332 Ga0070681_10022680
333 Ga0070681_10233519
334 Ga0070706_100320935
335 Ga0070707_100007568
336 Ga0070707_100633006
337 Ga0070699_100102317
338 Ga0070679_100132649
339 Ga0070679_100382248
340 Ga0070684_100039454
341 Ga0070697_100194190
342 Ga0068853_100005841
343 Ga0070686_100126985
344 Ga0070695_100208038
345 Ga0068855_100063026
346 Ga0068855_100108954
347 Ga0068854_100028297
348 Ga0068854_100204514
349 Ga0068854_100479966
350 Ga0068856_100038601
351 Ga0068861_100000375
352 Ga0068858_100000092
353 Ga0068858_100373347
354 Ga0070717_10026242
355 Ga0070717_10074535
356 Ga0070717_10095322
357 Ga0070717_10172218
358 Ga0070716_100726012
359 Ga0070712_100094297
360 Ga0075431_100001598
361 Ga0075433_10841565
362 Ga0075434_100008352
363 Ga0075436_100020333
364 Ga0075435_100004144
365 Ga0105240_10022811
366 Ga0105240_10057758
367 Ga0105240_10124766
368 Ga0105240_10695827
369 Ga0111539_10252587
370 Ga0105245_10209351
371 Ga0105245_10571218
372 Ga0105241_10015359
373 Ga0105248_10025939
374 Ga0105237_10208662
375 Ga0105237_10316768
376 Ga0105237_10326261
377 Ga0105238_10026170
378 Ga0105238_10066442
379 Ga0105238_10083356
380 Ga0105238_10233817
381 Ga0099796_10062968
382 Ga0105239_10011216
383 Ga0157370_10187652
384 Ga0157369_10021543
385 Ga0157369_10023673
386 Ga0157369_10028297
387 Ga0157369_10349747
388 Ga0171462_1004
389 Ga0157374_10418564
390 Ga0157372_10012081
391 Ga0157372_10086827
392 Ga0157372_10115264
393 Ga0163163_10253303
394 Ga0157379_10051262
395 Ga0163161_10091702
396 Ga0163161_10822458
397 Ga0206356_11221166
398 Ga0206352_10166636
399 Ga0206354_11078640
400 Ga0213873_10004958
401 Ga0213872_10193397
402 Ga0213875_10034770
403 Ga0213871_10125922
404 Ga0224712_10007156
405 Ga0207699_10357734
406 Ga0207699_10399857
407 Ga0207684_10253501
408 Ga0207654_10017149
409 Ga0207707_10005763
410 Ga0207707_10100098
411 Ga0207695_10001998
412 Ga0207695_10009334
413 Ga0207671_10067018
414 Ga0207671_10305089
415 Ga0207693_10084925
416 Ga0207660_10278290
417 Ga0207652_10219512
418 Ga0207652_10238910
419 Ga0207646_10004860
420 Ga0207694_10000157
421 Ga0207694_10068151
422 Ga0207694_10068700
423 Ga0207700_10301575
424 Ga0207664_10000737
425 Ga0207664_10086649
426 Ga0207690_10164060
427 Ga0207706_10064402
428 Ga0207670_10227893
429 Ga0207665_10490477
430 Ga0207665_10753503
431 Ga0207711_10059553
432 Ga0207679_10037399
433 Ga0207667_10009414
434 Ga0207667_10011520
435 Ga0207667_10442617
436 Ga0207677_10557320
437 Ga0207703_10000737
438 Ga0207703_10350638
439 Ga0207703_11389087
440 Ga0207639_10014940
441 Ga0207678_10311829
442 Ga0207702_10000002
443 Ga0207702_10057323
444 Ga0207702_10573827
445 Ga0207675_100000019
446 Ga0207698_10063363
447 Ga0207698_10109072
448 Ga0207698_10110392
449 Ga0207698_10520727
450 Ga0307517_10039490
451 Ga0265338_10161650
452 Ga0307511_10031383
453 Ga0265765_1018296
454 Ga0265760_10076245
455 Ga0265328_10145845
456 Ga0265339_10004753
457 Ga0265339_10067416
458 Ga0265327_10016605
459 Ga0307408_101087086
460 Ga0307508_10011619
461 Ga0265314_10008536
462 Ga0265314_10128014
463 Ga0307409_100307394
464 Ga0373934_0064343
465 Ga0373923_0064313
466 Ga0373954_0081906
467 Ga0373955_0106772
468 Ga0373924_0235629
469 Ga0373935_0205977
470 Ga0373933_0204374
471 Ga0373947_0535819
472 Ga0373925_0196568
473 Ga0395899_0072708
474 Ga0436364_1400663
475 Ga0395901_0073703
476 Ga0395901_0788373
477 Ga0436365_0670285
478 Ga0436365_1063831
479 Ga0436360_0084123
480 Ga0436363_0083618
481 Ga0451835_1085803
482 Ga0451839_0090435
483 Ga0451849_0079886
484 Ga0451843_0616296
485 Ga0451855_1598589
486 Ga0466965_0025688
487 Ga0466968_0018501
488 Ga0466968_0080652
489 Ga0466970_0142324
490 Ga0466960_0047813
491 Ga0466960_0197319
492 Ga0466960_0287575
493 Ga0466967_0004778
494 Ga0466967_0136745
495 Ga0495617_000785
496 Ga0495638_0001285
497 Ga0495650_0079681
498 Ga0495580_0253219
499 Ga0495664_0224032
500 Ga0495585_0000063
501 Ga0495594_0398663
502 Ga0495607_0000029
503 Ga0495583_0027370
504 Ga0495583_0148551
505 Ga0495606_0254004
506 Ga0495608_0257875
507 Ga0495616_0050414
508 Ga0495616_0179253
509 Ga0495620_0159165
510 Ga0495631_0002304
511 Ga0495637_0011110
512 Ga0495640_0078320
513 Ga0495587_0322848
514 Ga0495609_0055386
515 Ga0495611_0000003
516 Ga0495625_0000019
517 Ga0495661_0000703
518 Ga0495670_0004940
519 Ga0495671_0000549
520 Ga0495671_0027578
521 Ga0495589_0000018
522 Ga0495589_0209415
523 Ga0495660_0000122
524 Ga0495680_0123022
525 Ga0495679_000017
526 Ga0495673_0004051
527 Ga0495686_0050315
528 Ga0495602_0280410
529 Ga0495614_0202319
530 Ga0496100_0000324
531 Ga0496100_0029409
532 Ga0496100_0201096
533 Ga0496101_0001179
534 Ga0496101_0096416
535 Ga0496101_0296359
536 Ga0496102_0012797
537 Ga0496102_0015042
538 Ga0496102_0202002
539 Ga0496104_0004300
540 Ga0496104_0118634
541 Ga0496105_0063215
542 Ga0496105_0064430
543 Ga0496106_0040064
544 Ga0496106_0314966
545 Ga0496107_0059655
546 Ga0496109_0180108
547 Ga0496110_0073199
548 Ga0496110_0400241
549 Ga0496111_0044735
550 Ga0496112_0810685
551 Ga0496114_0096708
552 Ga0496114_0202905
553 Ga0496115_0047569
554 Ga0496115_0158449
555 Ga0496115_0421182
556 Ga0496116_0008351
557 Ga0496117_0000035
558 Ga0496117_0037920
559 Ga0496118_0000054
560 Ga0496118_0000423
561 Ga0496118_0155312
562 Ga0496119_0005770
563 Ga0496120_0007388
564 Ga0496124_0120737
565 Ga0496125_0046520
566 Ga0496126_0034701
567 Ga0496126_0063283
568 Ga0495678_000210
569 Ga0495682_0004086
570 Ga0495682_0057728
571 Ga0501031_0007813
572 Ga0501032_0000767
573 Ga0501033_0035725
574 Ga0501033_0211001
575 Ga0501034_0054740
576 Ga0501036_0007805
577 Ga0501037_0003426
578 Ga0501037_0077229
579 Ga0501038_0037231
580 Ga0501038_0258281
581 Ga0501038_0480890
582 Ga0501039_0052551
583 Ga0501043_0002085
584 Ga0501046_0003083
585 Ga0501047_0026148
586 Ga0501047_0141046
587 Ga0501048_0217959
588 Ga0501067_0000653
589 Ga0501067_0008290
590 Ga0501068_0007420
591 Ga0501069_0006325
592 Ga0501069_0372167
593 Ga0501070_0004405
594 Ga0501070_0034537
595 Ga0501070_0235296
596 Ga0501072_0001615
597 Ga0501073_0001950
598 Ga0501074_0060812
599 Ga0501076_0140471
600 Ga0501077_0003301
601 Ga0501079_0011766
602 Ga0501080_0000291
603 Ga0501083_0034357
604 Ga0501035_0064008
605 Ga0501035_0107786
606 Ga0501044_0032490
607 Ga0501044_0100032
608 Ga0501044_0168563
609 Ga0501044_0551124
610 Ga0501045_0449881
611 nmdc:mga05p37_686342_c1
612 nmdc:mga06r32_599_c1
613 nmdc:mga0n895_45041_c1
614 nmdc:mga0rr50_13931_c1
615 nmdc:mga08x19_589134_c1
616 nmdc:mga08x19_9922_c1
617 nmdc:mga0a205_380674_c1
618 Ga0495601_0301078
619 Ga0495595_0093142
620 Ga0500643_000029
621 Ga0500643_002857
622 Ga0500555_000067
623 Ga0500564_212070
624 Ga0501084_0002646
625 Ga0501082_0068063
626 2517407072
627 2812324196
628 2819540462
629 2819649422
630 2884338895
631 2885310844
632 2885331077
633 2965069948
634 2968132983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

40

243

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8499 1 198
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8418 1 198
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7817 2 197
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7775 2 197
2jyb-assembly1.cif.gz_A binary hvdhfr1:folate complex 0.7665 3 195
ID Description Score Start End Superfamily
af_P0AFV2_139_215_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8729 176 199 3.30.70.260
af_Q19962_62_333_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8615 178 195 1.10.510.10
af_P90895_1_189_3.90.1520.10 Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain 0.7797 176 197 3.90.1520.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7721 2 197 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7519 2 197 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A535DTC7-F1-model_v4 Dihydrofolate reductase 0.9892 63 197 GO:0008703
GO:0009231
AF-A0A535MPM6-F1-model_v4 Dihydrofolate reductase 0.9882 76 196 GO:0008703
GO:0009231
AF-A0A2W2E8C6-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9827 90 196 GO:0008703
GO:0009231
AF-A0A1H7GZJ2-F1-model_v4 Dihydrofolate reductase 0.9824 89 196 GO:0008703
GO:0009231
AF-A0A853AW15-F1-model_v4 Dihydrofolate reductase 0.9799 1 197 GO:0008703
GO:0009231

Map