F404149

General Info

Members Datasets Scaffolds Average Seq Length
317 214 634 192

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10000016|Ga0157369_100000166
Length 218
Sequence MKLLTMSQKTINHNKNLNSKKISKKQMTEEINQHFPKAYQQINVATKASGFDMASDVLTCSLLRTLASTKPSGKFLELGTGTGLSTSWILDGLDQESTLTSIDNDVKFLAIAKTFLGDDDRLTLVDTDGAEWIEKNKDKKFDYIFADTWHGKYLLLDEALSMLNSGGLYIIDDMLPQTNWPDGHQDKAVKLIKDLESRDDLYLTKQVWATGIVIGVKK

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
116 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
117 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
118 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
134 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
135 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
136 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
137 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
138 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
157 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
158 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
161 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
162 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
163 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
164 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
165 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
166 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
167 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
168 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
169 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
170 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
171 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
172 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
173 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
174 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
175 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
176 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
177 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
178 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
183 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
184 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
187 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
188 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
191 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
192 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
193 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
197 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
198 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
199 2738541278 Niastella sp. CF465 Isolate Unclassified
200 2738541284 Pedobacter sp. YR016 Isolate Unclassified
201 2738541302 Pedobacter sp. CF074 Isolate Unclassified
202 2739367651 Pedobacter sp. OK291 Isolate Unclassified
203 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
204 2818991437 Pedobacter terrae 518 Isolate Unclassified
205 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
206 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
207 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
208 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
209 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
210 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
211 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
212 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
213 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
214 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.32
Metatranscriptomes 0
Isolates 5.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.36
Nodule 0
Rhizoplane 0.32
Rhizosphere 75.08
Stem 0
Stem Tuber 0
Unclassified 13.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10000016 3300013105 Bacteria 257827
2 SwRhRL2b_contig_3406522 2162886007 Bacteria 12647
3 JGI24737J22298_10011799 3300001990 Bacteria 2857
4 JGI25162J39368_1000089 3300002737 Bacteria 104054
5 JGI25154J39366_1000005 3300002738 Bacteria 345115
6 JGI25157J39369_1003368 3300002741 Bacteria 3298
7 rootH1_10063077 3300003316 Bacteria 4060
8 rootH2_10009255 3300003320 Bacteria 10792
9 rootH2_10023494 3300003320 Bacteria 33755
10 rootH2_10128114 3300003320 Bacteria 2768
11 rootH2_10223420 3300003320 Bacteria 1498
12 rootL2_10004033 3300003322 Bacteria 45524
13 rootL2_10007493 3300003322 Bacteria 8283
14 rootL2_10009529 3300003322 Bacteria 24087
15 rootL2_10025540 3300003322 Bacteria 2359
16 rootL2_10195964 3300003322 Bacteria 1371
17 rootL2_10282214 3300003322 Bacteria 4816
18 rootL2_10329458 3300003322 Bacteria 1307
19 rootH1_10000182 3300003323 Bacteria 80743
20 rootH1_10018034 3300003323 Bacteria 1631
21 rootH1_10063503 3300003323 Bacteria 5385
22 rootH1_10104772 3300003323 Bacteria 1921
23 rootH1_10267300 3300003323 Unclassified 1114
24 rootH1_10286945 3300003323 Bacteria 1385
25 JGI25160J50197_1023861 3300003354 Unclassified 1750
26 Ga0055531_10000020 3300003794 Bacteria 170186
27 Ga0065165_1000130 3300005262 Bacteria 128998
28 Ga0065165_1001175 3300005262 Bacteria 30429
29 Ga0065165_1017188 3300005262 Bacteria 2677
30 Ga0065714_10002421 3300005288 Bacteria 18345
31 Ga0065714_10006014 3300005288 Bacteria 9989
32 Ga0065714_10064446 3300005288 Bacteria 88320
33 Ga0065714_10163126 3300005288 Bacteria 1031
34 Ga0065714_10249437 3300005288 Bacteria 751
35 Ga0065704_10000217 3300005289 Bacteria 101781
36 Ga0065704_10072208 3300005289 Bacteria 8935
37 Ga0065712_10084031 3300005290 Bacteria 2794
38 Ga0065707_10345578 3300005295 Bacteria 926
39 Ga0070658_10098604 3300005327 Bacteria 2414
40 Ga0070670_100180424 3300005331 Bacteria 1833
41 Ga0070670_100283414 3300005331 Bacteria 1447
42 Ga0070670_100943442 3300005331 Unclassified 783
43 Ga0070666_10105294 3300005335 Unclassified 1948
44 Ga0068868_100002476 3300005338 Bacteria 12811
45 Ga0070689_100266854 3300005340 Bacteria 1416
46 Ga0070675_100018088 3300005354 Bacteria 5609
47 Ga0070675_100207133 3300005354 Bacteria 1704
48 Ga0070671_100151363 3300005355 Bacteria 1959
49 Ga0070671_100905623 3300005355 Bacteria 771
50 Ga0070673_100073853 3300005364 Unclassified 2746
51 Ga0070673_100536007 3300005364 Bacteria 1062
52 Ga0070688_100125542 3300005365 Bacteria 1724
53 Ga0070667_100413879 3300005367 Unclassified 1228
54 Ga0070663_100195752 3300005455 Bacteria 1575
55 Ga0070662_100000013 3300005457 Bacteria 125019
56 Ga0068867_100305129 3300005459 Bacteria 1314
57 Ga0068867_100333569 3300005459 Bacteria 1260
58 Ga0070699_100080952 3300005518 Bacteria 2830
59 Ga0070679_100001886 3300005530 Bacteria 18840
60 Ga0068853_100920597 3300005539 Bacteria 840
61 Ga0070672_100063550 3300005543 Bacteria 2915
62 Ga0070672_100157142 3300005543 Bacteria 1884
63 Ga0068855_100019871 3300005563 Bacteria 8069
64 Ga0070664_100039741 3300005564 Bacteria 3965
65 Ga0068852_101066483 3300005616 Bacteria 828
66 Ga0068859_100014120 3300005617 Bacteria 8012
67 Ga0068859_100132929 3300005617 Unclassified 2560
68 Ga0068864_100080594 3300005618 Unclassified 2852
69 Ga0068864_100273758 3300005618 Bacteria 1574
70 Ga0068861_100548887 3300005719 Bacteria 1053
71 Ga0068863_100028823 3300005841 Bacteria 5302
72 Ga0068860_100002825 3300005843 Bacteria 18061
73 Ga0068860_100004366 3300005843 Bacteria 14440
74 Ga0068862_100006968 3300005844 Bacteria 9379
75 Ga0075366_10610949 3300006195 Bacteria 676
76 Ga0097621_100193090 3300006237 Bacteria 1764
77 Ga0075433_11047033 3300006852 Unclassified 710
78 Ga0075429_100101715 3300006880 Bacteria 2509
79 Ga0097620_100014120 3300006931 Bacteria 8012
80 Ga0097620_100132932 3300006931 Unclassified 2560
81 Ga0105244_10188529 3300009036 Bacteria 976
82 Ga0105240_10001477 3300009093 Bacteria 40056
83 Ga0105240_10054312 3300009093 Bacteria 5021
84 Ga0111539_10258084 3300009094 Bacteria 2029
85 Ga0105247_10194028 3300009101 Bacteria 1361
86 Ga0105241_10004581 3300009174 Bacteria 10229
87 Ga0105237_10107321 3300009545 Bacteria 2784
88 Ga0105237_10154652 3300009545 Bacteria 2290
89 Ga0105237_10383824 3300009545 Bacteria 1410
90 Ga0105249_10149614 3300009553 Unclassified 2246
91 Ga0105249_10385056 3300009553 Bacteria 1429
92 Ga0105239_10006397 3300010375 Bacteria 13676
93 Ga0105239_10007437 3300010375 Bacteria 12565
94 Ga0105246_10073947 3300011119 Bacteria 2407
95 Ga0105246_10194674 3300011119 Bacteria 1572
96 Ga0157373_10000041 3300013100 Bacteria 113871
97 Ga0157373_10013382 3300013100 Bacteria 6018
98 Ga0157373_10096995 3300013100 Bacteria 2075
99 Ga0157373_10153531 3300013100 Bacteria 1620
100 Ga0157373_10600540 3300013100 Unclassified 801
101 Ga0157371_10000074 3300013102 Bacteria 162988
102 Ga0157371_10000293 3300013102 Bacteria 67201
103 Ga0157371_10001078 3300013102 Bacteria 29528
104 Ga0157371_10015855 3300013102 Bacteria 5637
105 Ga0157371_10069072 3300013102 Bacteria 2501
106 Ga0157371_10160180 3300013102 Bacteria 1607
107 Ga0157371_10381612 3300013102 Bacteria 1029
108 Ga0157370_10009018 3300013104 Bacteria 10706
109 Ga0157370_10172149 3300013104 Unclassified 2012
110 Ga0157370_10198948 3300013104 Bacteria 1859
111 Ga0157370_10393142 3300013104 Bacteria 1277
112 Ga0157374_10007387 3300013296 Bacteria 9373
113 Ga0157378_10010099 3300013297 Bacteria 8231
114 Ga0157378_10902271 3300013297 Bacteria 914
115 Ga0163162_10006519 3300013306 Bacteria 11308
116 Ga0163162_10319745 3300013306 Unclassified 1684
117 Ga0163162_11081754 3300013306 Unclassified 908
118 Ga0157372_10541529 3300013307 Bacteria 1357
119 Ga0157372_10808959 3300013307 Bacteria 1089
120 Ga0157372_11308663 3300013307 Bacteria 836
121 Ga0157375_10113804 3300013308 Bacteria 2807
122 Ga0157375_10191994 3300013308 Bacteria 2197
123 Ga0163163_10101811 3300014325 Unclassified 2895
124 Ga0163163_10461870 3300014325 Bacteria 1330
125 Ga0157380_10007362 3300014326 Bacteria 7813
126 Ga0182008_10000001 3300014497 Bacteria 540790
127 Ga0182008_10001858 3300014497 Bacteria 13732
128 Ga0157377_10004693 3300014745 Bacteria 6324
129 Ga0157376_10312599 3300014969 Bacteria 1491
130 Ga0182006_1000149 3300015261 Bacteria 74752
131 Ga0182006_1001293 3300015261 Bacteria 15436
132 Ga0182006_1001776 3300015261 Bacteria 12476
133 Ga0182006_1007214 3300015261 Bacteria 5105
134 Ga0182007_10000002 3300015262 Bacteria 564661
135 Ga0163161_10000545 3300017792 Bacteria 30599
136 Ga0163161_10004401 3300017792 Bacteria 9830
137 Ga0163161_10006029 3300017792 Bacteria 8400
138 Ga0163161_10407762 3300017792 Bacteria 1091
139 Ga0209437_100221 3300025233 Bacteria 104135
140 Ga0209646_1000017 3300025246 Bacteria 488265
141 Ga0209026_1000538 3300025250 Bacteria 26088
142 Ga0209129_1006804 3300025258 Bacteria 3581
143 Ga0209676_1000513 3300025292 Bacteria 60961
144 Ga0209758_1003107 3300025297 Bacteria 15706
145 Ga0207426_1000845 3300025302 Bacteria 32310
146 Ga0209257_1000001 3300025304 Bacteria 2274655
147 Ga0207697_10252724 3300025315 Bacteria 780
148 Ga0207656_10107999 3300025321 Bacteria 1283
149 Ga0207682_10073436 3300025893 Unclassified 1453
150 Ga0207682_10083087 3300025893 Unclassified 1376
151 Ga0207680_10213848 3300025903 Unclassified 1319
152 Ga0207647_10000044 3300025904 Bacteria 90491
153 Ga0207705_10815633 3300025909 Unclassified 724
154 Ga0207654_10000191 3300025911 Bacteria 37892
155 Ga0207695_10003319 3300025913 Bacteria 22807
156 Ga0207671_10063951 3300025914 Bacteria 2735
157 Ga0207671_10096244 3300025914 Bacteria 2237
158 Ga0207652_10000027 3300025921 Bacteria 151000
159 Ga0207681_10428693 3300025923 Unclassified 1073
160 Ga0207650_10071689 3300025925 Bacteria 2607
161 Ga0207650_10684474 3300025925 Bacteria 866
162 Ga0207644_10114456 3300025931 Bacteria 2044
163 Ga0207644_10294468 3300025931 Bacteria 1306
164 Ga0207706_10007721 3300025933 Bacteria 9932
165 Ga0207706_10482177 3300025933 Bacteria 1071
166 Ga0207670_10530229 3300025936 Bacteria 960
167 Ga0207691_10017188 3300025940 Bacteria 6862
168 Ga0207691_10091894 3300025940 Bacteria 2718
169 Ga0207689_10013013 3300025942 Bacteria 7105
170 Ga0207651_10042145 3300025960 Unclassified 3036
171 Ga0207712_10441900 3300025961 Bacteria 1101
172 Ga0207640_10259242 3300025981 Bacteria 1354
173 Ga0207658_10039312 3300025986 Bacteria 3413
174 Ga0207658_10285225 3300025986 Unclassified 1417
175 Ga0207677_10015545 3300026023 Unclassified 4480
176 Ga0207678_10016157 3300026067 Bacteria 6554
177 Ga0207641_10016058 3300026088 Bacteria 6132
178 Ga0207648_10245611 3300026089 Bacteria 1595
179 Ga0207676_10170410 3300026095 Unclassified 1896
180 Ga0207698_10610951 3300026142 Bacteria 1076
181 Ga0207428_10465637 3300027907 Unclassified 921
182 Ga0268265_10113717 3300028380 Unclassified 2215
183 Ga0268265_10135354 3300028380 Bacteria 2055
184 Ga0268264_10001199 3300028381 Bacteria 25035
185 Ga0268264_10102264 3300028381 Unclassified 2493
186 Ga0307517_10320316 3300028786 Unclassified 858
187 Ga0307515_10132928 3300028794 Bacteria 2726
188 Ga0307511_10008784 3300030521 Bacteria 10093
189 Ga0316177_1160081 3300030731 Bacteria 7348
190 Ga0316176_1020647 3300030732 Bacteria 21813
191 Ga0316183_1166136 3300030742 Bacteria 44041
192 Ga0316181_1203439 3300030744 Bacteria 31400
193 Ga0307509_10053864 3300031507 Bacteria 4286
194 Ga0307509_10116848 3300031507 Unclassified 2656
195 Ga0307408_100044529 3300031548 Bacteria 3163
196 Ga0307405_10000006 3300031731 Bacteria 361477
197 Ga0307407_10000031 3300031903 Bacteria 87995
198 Ga0307412_10000033 3300031911 Bacteria 206649
199 Ga0307412_10696226 3300031911 Bacteria 872
200 Ga0307416_100000002 3300032002 Bacteria 509907
201 Ga0307414_10013647 3300032004 Bacteria 4844
202 Ga0307414_10020310 3300032004 Bacteria 4138
203 Ga0307414_10043605 3300032004 Bacteria 3057
204 Ga0307414_10193623 3300032004 Bacteria 1647
205 Ga0307414_10228755 3300032004 Unclassified 1532
206 Ga0307414_10322361 3300032004 Unclassified 1316
207 Ga0307510_10003837 3300033180 Bacteria 17608
208 Ga0395900_0010020 3300037418 Bacteria 9697
209 Ga0395900_0052129 3300037418 Bacteria 4212
210 Ga0395898_0021382 3300037466 Bacteria 6560
211 Ga0395901_0007815 3300038443 Bacteria 10791
212 Ga0436361_0378332 3300039447 Bacteria 2297
213 Ga0439436_0106346 3300041404 Unclassified 783
214 Ga0451791_1063627 3300041451 Bacteria 775
215 Ga0439431_0020073 3300041997 Unclassified 1594
216 Ga0439449_0001224 3300042007 Bacteria 10075
217 Ga0439449_0171001 3300042007 Bacteria 812
218 Ga0439457_009874 3300042014 Bacteria 2210
219 Ga0450897_000880 3300042128 Bacteria 1862
220 Ga0450894_016357 3300042131 Bacteria 985
221 Ga0450898_017333 3300042134 Bacteria 1238
222 Ga0466972_0005294 3300044658 Bacteria 6462
223 Ga0466982_0048192 3300044672 Unclassified 2600
224 Ga0466965_0048292 3300044683 Bacteria 2108
225 Ga0466964_0144533 3300044706 Bacteria 1097
226 Ga0466964_0287973 3300044706 Unclassified 823
227 Ga0466968_0012956 3300044735 Bacteria 3271
228 Ga0466959_0000002 3300045049 Bacteria 362671
229 Ga0495638_0000001 3300046460 Bacteria 1114121
230 Ga0495606_0021707 3300046507 Bacteria 4697
231 Ga0495610_0000099 3300046512 Bacteria 101553
232 Ga0495610_0000967 3300046512 Bacteria 26569
233 Ga0495616_0048379 3300046513 Bacteria 2137
234 Ga0495632_0035578 3300046519 Bacteria 2540
235 Ga0495637_0004191 3300046520 Bacteria 7486
236 Ga0495611_0000167 3300046648 Bacteria 47182
237 Ga0495611_0321363 3300046648 Unclassified 712
238 Ga0495625_0011431 3300046660 Bacteria 7239
239 Ga0495625_0013187 3300046660 Bacteria 6656
240 Ga0495687_093121 3300047443 Bacteria 1149
241 Ga0495686_0001016 3300047472 Bacteria 33934
242 Ga0495686_0003981 3300047472 Bacteria 12369
243 Ga0495686_0026060 3300047472 Bacteria 3827
244 Ga0495686_0053516 3300047472 Bacteria 2530
245 Ga0496126_0517883 3300048929 Unclassified 951
246 Ga0495678_030606 3300049459 Bacteria 2250
247 Ga0501296_016429 3300049519 Bacteria 920
248 Ga0501300_001597 3300049523 Bacteria 3401
249 Ga0501034_0140375 3300049571 Unclassified 2396
250 Ga0501198_001574 3300049649 Bacteria 3005
251 Ga0501202_004219 3300049652 Unclassified 2510
252 Ga0501202_010394 3300049652 Bacteria 1726
253 Ga0501217_001112 3300049661 Bacteria 4915
254 Ga0501217_004316 3300049661 Bacteria 2917
255 Ga0501223_000421 3300049663 Bacteria 10268
256 Ga0501224_002098 3300049664 Bacteria 2701
257 Ga0501236_001397 3300049670 Bacteria 2747
258 Ga0501243_037962 3300049675 Bacteria 839
259 Ga0501246_032307 3300049676 Bacteria 594
260 Ga0501247_010461 3300049677 Bacteria 1105
261 Ga0501251_002133 3300049681 Bacteria 1892
262 Ga0501257_000196 3300049686 Bacteria 12217
263 Ga0501257_001858 3300049686 Bacteria 4399
264 Ga0501257_018312 3300049686 Bacteria 1632
265 Ga0501261_002653 3300049690 Bacteria 2196
266 Ga0501221_002663 3300049704 Bacteria 2942
267 Ga0501225_0000181 3300049705 Bacteria 19505
268 Ga0501225_0003833 3300049705 Bacteria 4516
269 Ga0501245_001743 3300049708 Bacteria 2849
270 Ga0501241_001520 3300049758 Bacteria 4684
271 Ga0501241_014106 3300049758 Bacteria 1452
272 Ga0501268_012397 3300049765 Bacteria 1363
273 Ga0501270_006415 3300049767 Bacteria 1412
274 Ga0501212_006126 3300049851 Bacteria 1613
275 nmdc:mga0k408_261094_c1 3300050493 Bacteria 1034
276 nmdc:mga0k408_281177_c1 3300050493 Bacteria 993
277 nmdc:mga09592_73692_c1 3300050508 Bacteria 2901
278 nmdc:mga08y16_34513_c1 3300050511 Bacteria 5313
279 Ga0500578_0000003 3300053086 Bacteria 266033
280 Ga0500644_0083424 3300053088 Bacteria 1180
281 Ga0500583_0074945 3300053092 Bacteria 1625
282 Ga0500651_0001588 3300053093 Bacteria 11535
283 Ga0500650_0018615 3300053098 Bacteria 3016
284 Ga0500556_0155537 3300053104 Bacteria 902
285 Ga0500562_034315 3300053108 Unclassified 1342
286 Ga0500594_0164043 3300053118 Bacteria 719
287 Ga0500652_011179 3300053131 Bacteria 3103
288 Ga0500577_0201919 3300053142 Bacteria 858
289 Ga0500589_002134 3300053147 Bacteria 6453
290 Ga0500604_0018864 3300053151 Bacteria 1926
291 Ga0500616_0000009 3300053153 Bacteria 779095
292 Ga0500616_0020398 3300053153 Bacteria 3724
293 Ga0500616_0079353 3300053153 Bacteria 1653
294 Ga0500616_0352094 3300053153 Unclassified 599
295 Ga0500622_0000015 3300053156 Bacteria 346227
296 Ga0500622_0000022 3300053156 Bacteria 267246
297 Ga0500622_0000077 3300053156 Bacteria 108558
298 Ga0500622_0001497 3300053156 Bacteria 18579
299 Ga0500634_0076114 3300053161 Bacteria 1743
300 2522551840 2522125168 Bacteria 7376607
301 2586208655 2585427687 Bacteria 5544917
302 2738726235 2738541278 Bacteria 9755573
303 2738761190 2738541284 Bacteria 5199923
304 2738856609 2738541302 Bacteria 5944758
305 2739588147 2739367651 Bacteria 6359826
306 2776613446 2775506987 Bacteria 5373360
307 2819546047 2818991437 Bacteria 5805520
308 2842724055 2842722452 Bacteria 6263924
309 2842904098 2842903701 Bacteria 6986368
310 2842912213 2842909656 Bacteria 6185908
311 2904114556 2904113452 Bacteria 7796941
312 2904446310 2904445276 Bacteria 5310396
313 2929925536 2929921140 Bacteria 8649150
314 2945999134 2945997725 Bacteria 6404843
315 2954021584 2954016120 Bacteria 6446024
316 8003153484 8003151029 Bacteria 8187759
317 8022950682 8022948649 Bacteria 5366783
318 Ga0157369_10000016
319 SwRhRL2b_contig_3406522
320 JGI24737J22298_10011799
321 JGI25162J39368_1000089
322 JGI25154J39366_1000005
323 JGI25157J39369_1003368
324 rootH1_10063077
325 rootH2_10009255
326 rootH2_10023494
327 rootH2_10128114
328 rootH2_10223420
329 rootL2_10004033
330 rootL2_10007493
331 rootL2_10009529
332 rootL2_10025540
333 rootL2_10195964
334 rootL2_10282214
335 rootL2_10329458
336 rootH1_10000182
337 rootH1_10018034
338 rootH1_10063503
339 rootH1_10104772
340 rootH1_10267300
341 rootH1_10286945
342 JGI25160J50197_1023861
343 Ga0055531_10000020
344 Ga0065165_1000130
345 Ga0065165_1001175
346 Ga0065165_1017188
347 Ga0065714_10002421
348 Ga0065714_10006014
349 Ga0065714_10064446
350 Ga0065714_10163126
351 Ga0065714_10249437
352 Ga0065704_10000217
353 Ga0065704_10072208
354 Ga0065712_10084031
355 Ga0065707_10345578
356 Ga0070658_10098604
357 Ga0070670_100180424
358 Ga0070670_100283414
359 Ga0070670_100943442
360 Ga0070666_10105294
361 Ga0068868_100002476
362 Ga0070689_100266854
363 Ga0070675_100018088
364 Ga0070675_100207133
365 Ga0070671_100151363
366 Ga0070671_100905623
367 Ga0070673_100073853
368 Ga0070673_100536007
369 Ga0070688_100125542
370 Ga0070667_100413879
371 Ga0070663_100195752
372 Ga0070662_100000013
373 Ga0068867_100305129
374 Ga0068867_100333569
375 Ga0070699_100080952
376 Ga0070679_100001886
377 Ga0068853_100920597
378 Ga0070672_100063550
379 Ga0070672_100157142
380 Ga0068855_100019871
381 Ga0070664_100039741
382 Ga0068852_101066483
383 Ga0068859_100014120
384 Ga0068859_100132929
385 Ga0068864_100080594
386 Ga0068864_100273758
387 Ga0068861_100548887
388 Ga0068863_100028823
389 Ga0068860_100002825
390 Ga0068860_100004366
391 Ga0068862_100006968
392 Ga0075366_10610949
393 Ga0097621_100193090
394 Ga0075433_11047033
395 Ga0075429_100101715
396 Ga0097620_100014120
397 Ga0097620_100132932
398 Ga0105244_10188529
399 Ga0105240_10001477
400 Ga0105240_10054312
401 Ga0111539_10258084
402 Ga0105247_10194028
403 Ga0105241_10004581
404 Ga0105237_10107321
405 Ga0105237_10154652
406 Ga0105237_10383824
407 Ga0105249_10149614
408 Ga0105249_10385056
409 Ga0105239_10006397
410 Ga0105239_10007437
411 Ga0105246_10073947
412 Ga0105246_10194674
413 Ga0157373_10000041
414 Ga0157373_10013382
415 Ga0157373_10096995
416 Ga0157373_10153531
417 Ga0157373_10600540
418 Ga0157371_10000074
419 Ga0157371_10000293
420 Ga0157371_10001078
421 Ga0157371_10015855
422 Ga0157371_10069072
423 Ga0157371_10160180
424 Ga0157371_10381612
425 Ga0157370_10009018
426 Ga0157370_10172149
427 Ga0157370_10198948
428 Ga0157370_10393142
429 Ga0157374_10007387
430 Ga0157378_10010099
431 Ga0157378_10902271
432 Ga0163162_10006519
433 Ga0163162_10319745
434 Ga0163162_11081754
435 Ga0157372_10541529
436 Ga0157372_10808959
437 Ga0157372_11308663
438 Ga0157375_10113804
439 Ga0157375_10191994
440 Ga0163163_10101811
441 Ga0163163_10461870
442 Ga0157380_10007362
443 Ga0182008_10000001
444 Ga0182008_10001858
445 Ga0157377_10004693
446 Ga0157376_10312599
447 Ga0182006_1000149
448 Ga0182006_1001293
449 Ga0182006_1001776
450 Ga0182006_1007214
451 Ga0182007_10000002
452 Ga0163161_10000545
453 Ga0163161_10004401
454 Ga0163161_10006029
455 Ga0163161_10407762
456 Ga0209437_100221
457 Ga0209646_1000017
458 Ga0209026_1000538
459 Ga0209129_1006804
460 Ga0209676_1000513
461 Ga0209758_1003107
462 Ga0207426_1000845
463 Ga0209257_1000001
464 Ga0207697_10252724
465 Ga0207656_10107999
466 Ga0207682_10073436
467 Ga0207682_10083087
468 Ga0207680_10213848
469 Ga0207647_10000044
470 Ga0207705_10815633
471 Ga0207654_10000191
472 Ga0207695_10003319
473 Ga0207671_10063951
474 Ga0207671_10096244
475 Ga0207652_10000027
476 Ga0207681_10428693
477 Ga0207650_10071689
478 Ga0207650_10684474
479 Ga0207644_10114456
480 Ga0207644_10294468
481 Ga0207706_10007721
482 Ga0207706_10482177
483 Ga0207670_10530229
484 Ga0207691_10017188
485 Ga0207691_10091894
486 Ga0207689_10013013
487 Ga0207651_10042145
488 Ga0207712_10441900
489 Ga0207640_10259242
490 Ga0207658_10039312
491 Ga0207658_10285225
492 Ga0207677_10015545
493 Ga0207678_10016157
494 Ga0207641_10016058
495 Ga0207648_10245611
496 Ga0207676_10170410
497 Ga0207698_10610951
498 Ga0207428_10465637
499 Ga0268265_10113717
500 Ga0268265_10135354
501 Ga0268264_10001199
502 Ga0268264_10102264
503 Ga0307517_10320316
504 Ga0307515_10132928
505 Ga0307511_10008784
506 Ga0316177_1160081
507 Ga0316176_1020647
508 Ga0316183_1166136
509 Ga0316181_1203439
510 Ga0307509_10053864
511 Ga0307509_10116848
512 Ga0307408_100044529
513 Ga0307405_10000006
514 Ga0307407_10000031
515 Ga0307412_10000033
516 Ga0307412_10696226
517 Ga0307416_100000002
518 Ga0307414_10013647
519 Ga0307414_10020310
520 Ga0307414_10043605
521 Ga0307414_10193623
522 Ga0307414_10228755
523 Ga0307414_10322361
524 Ga0307510_10003837
525 Ga0395900_0010020
526 Ga0395900_0052129
527 Ga0395898_0021382
528 Ga0395901_0007815
529 Ga0436361_0378332
530 Ga0439436_0106346
531 Ga0451791_1063627
532 Ga0439431_0020073
533 Ga0439449_0001224
534 Ga0439449_0171001
535 Ga0439457_009874
536 Ga0450897_000880
537 Ga0450894_016357
538 Ga0450898_017333
539 Ga0466972_0005294
540 Ga0466982_0048192
541 Ga0466965_0048292
542 Ga0466964_0144533
543 Ga0466964_0287973
544 Ga0466968_0012956
545 Ga0466959_0000002
546 Ga0495638_0000001
547 Ga0495606_0021707
548 Ga0495610_0000099
549 Ga0495610_0000967
550 Ga0495616_0048379
551 Ga0495632_0035578
552 Ga0495637_0004191
553 Ga0495611_0000167
554 Ga0495611_0321363
555 Ga0495625_0011431
556 Ga0495625_0013187
557 Ga0495687_093121
558 Ga0495686_0001016
559 Ga0495686_0003981
560 Ga0495686_0026060
561 Ga0495686_0053516
562 Ga0496126_0517883
563 Ga0495678_030606
564 Ga0501296_016429
565 Ga0501300_001597
566 Ga0501034_0140375
567 Ga0501198_001574
568 Ga0501202_004219
569 Ga0501202_010394
570 Ga0501217_001112
571 Ga0501217_004316
572 Ga0501223_000421
573 Ga0501224_002098
574 Ga0501236_001397
575 Ga0501243_037962
576 Ga0501246_032307
577 Ga0501247_010461
578 Ga0501251_002133
579 Ga0501257_000196
580 Ga0501257_001858
581 Ga0501257_018312
582 Ga0501261_002653
583 Ga0501221_002663
584 Ga0501225_0000181
585 Ga0501225_0003833
586 Ga0501245_001743
587 Ga0501241_001520
588 Ga0501241_014106
589 Ga0501268_012397
590 Ga0501270_006415
591 Ga0501212_006126
592 nmdc:mga0k408_261094_c1
593 nmdc:mga0k408_281177_c1
594 nmdc:mga09592_73692_c1
595 nmdc:mga08y16_34513_c1
596 Ga0500578_0000003
597 Ga0500644_0083424
598 Ga0500583_0074945
599 Ga0500651_0001588
600 Ga0500650_0018615
601 Ga0500556_0155537
602 Ga0500562_034315
603 Ga0500594_0164043
604 Ga0500652_011179
605 Ga0500577_0201919
606 Ga0500589_002134
607 Ga0500604_0018864
608 Ga0500616_0000009
609 Ga0500616_0020398
610 Ga0500616_0079353
611 Ga0500616_0352094
612 Ga0500622_0000015
613 Ga0500622_0000022
614 Ga0500622_0000077
615 Ga0500622_0001497
616 Ga0500634_0076114
617 2522551840
618 2586208655
619 2738726235
620 2738761190
621 2738856609
622 2739588147
623 2776613446
624 2819546047
625 2842724055
626 2842904098
627 2842912213
628 2904114556
629 2904446310
630 2929925536
631 2945999134
632 2954021584
633 8003153484
634 8022950682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13578

Methyltransf_24

Methyltransferase domain

76

174

0.95

PF08241

Methyltransf_11

Methyltransferase domain

76

171

0.86

PF01596

Methyltransf_3

O-methyltransferase

12

214

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cvv-assembly1.cif.gz_A crystal structure of catechol o-methyl transferase (comt) from niastella koreensis 0.899 8 192
1sui-assembly3.cif.gz_D alfalfa caffeoyl coenzyme a 3-o-methyltransferase 0.8854 11 191
7cvu-assembly1.cif.gz_A crystal structure of catechol o-methyl transferase (comt) from niastella koreensis 0.8731 8 194
2hnk-assembly2.cif.gz_B-2 crystal structure of sam-dependent o-methyltransferase from pathogenic bacterium leptospira interrogans 0.8696 3 192
5log-assembly1.cif.gz_A crystal structure of safc from myxococcus xanthus bound to sam 0.8687 4 194
ID Description Score Start End Superfamily
1suiD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8854 11 191 3.40.50.150
af_A0A0R0IR39_2_192_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8834 27 190 3.40.50.150
af_Q6EQW4_99_328_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8737 39 103 3.40.50.150
2hnkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8696 3 192 3.40.50.150
3cbgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8562 5 192 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Z8SDV7-F1-model_v4 SAM-dependent methyltransferase 0.9738 4 192 GO:0008171
GO:0032259
AF-A0A317HAZ0-F1-model_v4 SAM-dependent methyltransferase 0.969 3 192 GO:0008171
GO:0032259
AF-A0A1Z8SDV7-F1-model_v4 SAM-dependent methyltransferase 0.9687 4 192 GO:0008171
GO:0032259
AF-A0A839JG48-F1-model_v4 Class I SAM-dependent methyltransferase 0.968 34 194 GO:0008171
GO:0032259
AF-A0A0M8XX74-F1-model_v4 Methyltransferase 0.9667 14 192 GO:0008168
GO:0032259

Map