F404167

General Info

Members Datasets Scaffolds Average Seq Length
317 194 634 81

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_11403355|Ga0157376_114033551
Length 92
Sequence MFGVSPAQEASMSYQPRHGFTGPSELYTSSAMPPLSLRQRLAVMWAVWRERTEMRRSLAQMDARSLRDAGISPAAAAYESGKPFWERVGCLR

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
157 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
187 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
191 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
192 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 1.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.55
Nodule 0
Rhizoplane 0.95
Rhizosphere 72.87
Stem 0
Stem Tuber 0
Unclassified 20.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_11403355 3300014969 Unclassified 730
2 JGI25406J46586_10042148 3300003203 Bacteria 1600
3 Ga0070658_10045503 3300005327 Bacteria 3549
4 Ga0070676_10458286 3300005328 Bacteria 898
5 Ga0070683_100639494 3300005329 Bacteria 1018
6 Ga0070670_101125029 3300005331 Bacteria 716
7 Ga0068869_101075407 3300005334 Unclassified 703
8 Ga0070680_100001241 3300005336 Bacteria 18376
9 Ga0070660_100448028 3300005339 Bacteria 1071
10 Ga0070689_100259909 3300005340 Unclassified 1435
11 Ga0070689_100263217 3300005340 Bacteria 1426
12 Ga0070691_10007631 3300005341 Bacteria 4958
13 Ga0070691_10057509 3300005341 Bacteria 1866
14 Ga0070661_100039838 3300005344 Bacteria 3425
15 Ga0070675_100265006 3300005354 Bacteria 1506
16 Ga0070674_100850788 3300005356 Bacteria 791
17 Ga0070673_101139951 3300005364 Bacteria 729
18 Ga0070673_101880423 3300005364 Bacteria 567
19 Ga0070688_100807913 3300005365 Bacteria 734
20 Ga0070659_100167619 3300005366 Bacteria 1798
21 Ga0070667_101719552 3300005367 Bacteria 590
22 Ga0070701_10695802 3300005438 Unclassified 683
23 Ga0070701_11106736 3300005438 Bacteria 558
24 Ga0070708_100056335 3300005445 Bacteria 3496
25 Ga0070681_10003085 3300005458 Bacteria 15467
26 Ga0070681_10596898 3300005458 Bacteria 1018
27 Ga0070681_10866618 3300005458 Archaea 821
28 Ga0070681_11010744 3300005458 Bacteria 751
29 Ga0068867_101846508 3300005459 Unclassified 569
30 Ga0070685_10412205 3300005466 Bacteria 938
31 Ga0070685_10447521 3300005466 Bacteria 904
32 Ga0070706_100025293 3300005467 Bacteria 5463
33 Ga0070707_100612116 3300005468 Bacteria 1052
34 Ga0070698_100001208 3300005471 Bacteria 28691
35 Ga0070699_100156522 3300005518 Bacteria 2016
36 Ga0070679_100023728 3300005530 Bacteria 6010
37 Ga0070684_100040638 3300005535 Bacteria 4006
38 Ga0068853_100564944 3300005539 Bacteria 1078
39 Ga0070665_100008704 3300005548 Bacteria 10271
40 Ga0070665_100203508 3300005548 Bacteria 1980
41 Ga0070665_100540960 3300005548 Bacteria 1177
42 Ga0070665_101828708 3300005548 Bacteria 614
43 Ga0070665_101871439 3300005548 Bacteria 606
44 Ga0068855_100017273 3300005563 Bacteria 8684
45 Ga0068855_100234363 3300005563 Bacteria 2053
46 Ga0068855_102147393 3300005563 Unclassified 561
47 Ga0070664_100892206 3300005564 Bacteria 833
48 Ga0068857_100041540 3300005577 Bacteria 4078
49 Ga0068857_100276874 3300005577 Bacteria 1543
50 Ga0068857_101471614 3300005577 Bacteria 663
51 Ga0068854_100641654 3300005578 Bacteria 911
52 Ga0068856_100288737 3300005614 Bacteria 1657
53 Ga0068856_100359964 3300005614 Bacteria 1473
54 Ga0070702_101594194 3300005615 Unclassified 540
55 Ga0068852_102494654 3300005616 Unclassified 537
56 Ga0068859_100122431 3300005617 Bacteria 2668
57 Ga0068859_101311619 3300005617 Bacteria 798
58 Ga0068861_101526950 3300005719 Bacteria 656
59 Ga0068851_10180493 3300005834 Bacteria 1169
60 Ga0068851_10856815 3300005834 Bacteria 567
61 Ga0068858_100557382 3300005842 Bacteria 1110
62 Ga0068858_102247028 3300005842 Unclassified 539
63 Ga0068862_100563640 3300005844 Bacteria 1089
64 Ga0068862_100762779 3300005844 Bacteria 942
65 Ga0081455_10001706 3300005937 Bacteria 26586
66 Ga0081455_10018608 3300005937 Bacteria 6604
67 Ga0081455_10641037 3300005937 Bacteria 686
68 Ga0081539_10001294 3300005985 Bacteria 43916
69 Ga0075365_10054758 3300006038 Bacteria 2646
70 Ga0075365_10095809 3300006038 Bacteria 2027
71 Ga0075365_10152195 3300006038 Bacteria 1609
72 Ga0075365_10177330 3300006038 Bacteria 1489
73 Ga0075365_10381451 3300006038 Bacteria 994
74 Ga0075365_10577241 3300006038 Bacteria 795
75 Ga0075365_10729853 3300006038 Bacteria 700
76 Ga0075365_10927605 3300006038 Unclassified 614
77 Ga0075365_11081519 3300006038 Unclassified 565
78 Ga0075368_10053094 3300006042 Bacteria 1613
79 Ga0075368_10064505 3300006042 Bacteria 1471
80 Ga0075368_10125049 3300006042 Bacteria 1067
81 Ga0075363_100469476 3300006048 Unclassified 745
82 Ga0075363_100581070 3300006048 Bacteria 670
83 Ga0075364_10311557 3300006051 Bacteria 1072
84 Ga0075364_10732094 3300006051 Bacteria 675
85 Ga0075362_10056113 3300006177 Bacteria 1772
86 Ga0075362_10076569 3300006177 Bacteria 1536
87 Ga0075362_10189819 3300006177 Bacteria 998
88 Ga0075367_10017903 3300006178 Bacteria 3898
89 Ga0075367_10133243 3300006178 Bacteria 1537
90 Ga0075367_10232828 3300006178 Bacteria 1153
91 Ga0075367_10364990 3300006178 Bacteria 912
92 Ga0075369_10005835 3300006186 Bacteria 4627
93 Ga0075369_10015859 3300006186 Bacteria 3031
94 Ga0075366_10064769 3300006195 Bacteria 2174
95 Ga0075366_10077487 3300006195 Bacteria 1984
96 Ga0075366_10080732 3300006195 Bacteria 1942
97 Ga0075366_10138887 3300006195 Bacteria 1468
98 Ga0075366_10286719 3300006195 Bacteria 1007
99 Ga0097621_101036926 3300006237 Unclassified 768
100 Ga0075370_10042811 3300006353 Bacteria 2558
101 Ga0075370_10077550 3300006353 Bacteria 1907
102 Ga0075370_10138396 3300006353 Bacteria 1423
103 Ga0068865_100293655 3300006881 Bacteria 1298
104 Ga0068865_100298623 3300006881 Bacteria 1288
105 Ga0097620_100122431 3300006931 Bacteria 2668
106 Ga0097620_101311746 3300006931 Bacteria 798
107 Ga0099794_10037493 3300007265 Bacteria 2295
108 Ga0099794_10335219 3300007265 Bacteria 786
109 Ga0099795_10546051 3300007788 Unclassified 546
110 Ga0105240_10015907 3300009093 Bacteria 10206
111 Ga0105240_10102262 3300009093 Bacteria 3483
112 Ga0105240_10359612 3300009093 Bacteria 1649
113 Ga0111539_10676374 3300009094 Bacteria 1202
114 Ga0105245_10916269 3300009098 Bacteria 918
115 Ga0105245_11307245 3300009098 Unclassified 774
116 Ga0105245_12295918 3300009098 Unclassified 593
117 Ga0105247_10447934 3300009101 Bacteria 930
118 Ga0105243_10803458 3300009148 Bacteria 927
119 Ga0105241_10282377 3300009174 Bacteria 1418
120 Ga0105242_12012201 3300009176 Unclassified 620
121 Ga0105248_11594622 3300009177 Bacteria 739
122 Ga0105248_12320986 3300009177 Unclassified 611
123 Ga0105237_11995717 3300009545 Archaea 589
124 Ga0105238_10056422 3300009551 Bacteria 3941
125 Ga0105238_11048673 3300009551 Unclassified 837
126 Ga0105249_12654523 3300009553 Unclassified 573
127 Ga0105028_124652 3300009993 Bacteria 662
128 Ga0105239_10883877 3300010375 Bacteria 1025
129 Ga0105239_11628109 3300010375 Unclassified 747
130 Ga0105246_10213837 3300011119 Bacteria 1507
131 Ga0157373_10119896 3300013100 Bacteria 1849
132 Ga0157370_10168180 3300013104 Bacteria 2038
133 Ga0157369_10142949 3300013105 Bacteria 2531
134 Ga0157374_11495496 3300013296 Archaea 698
135 Ga0157378_13129222 3300013297 Unclassified 514
136 Ga0163162_11474058 3300013306 Bacteria 775
137 Ga0157372_12269693 3300013307 Bacteria 623
138 Ga0157372_12409762 3300013307 Unclassified 604
139 Ga0157372_12525393 3300013307 Archaea 590
140 Ga0157372_13168968 3300013307 Unclassified 525
141 Ga0182008_10409812 3300014497 Unclassified 730
142 Ga0157379_10717378 3300014968 Bacteria 939
143 Ga0157376_10625840 3300014969 Unclassified 1074
144 Ga0157376_11894971 3300014969 Bacteria 633
145 Ga0197907_10074666 3300020069 Bacteria 574
146 Ga0206356_10270514 3300020070 Unclassified 541
147 Ga0206354_11230951 3300020081 Archaea 649
148 Ga0206353_11253160 3300020082 Bacteria 1128
149 Ga0213872_10021095 3300021361 Bacteria 3000
150 Ga0213871_10009838 3300021441 Bacteria 2153
151 Ga0224712_10233400 3300022467 Unclassified 845
152 Ga0207426_1022042 3300025302 Bacteria 2192
153 Ga0207697_10081025 3300025315 Bacteria 1368
154 Ga0207656_10573761 3300025321 Archaea 575
155 Ga0207710_10229700 3300025900 Bacteria 923
156 Ga0207688_10376413 3300025901 Bacteria 878
157 Ga0207647_10118477 3300025904 Bacteria 1562
158 Ga0207645_10120830 3300025907 Bacteria 1700
159 Ga0207705_10013851 3300025909 Bacteria 5814
160 Ga0207684_10129217 3300025910 Bacteria 2168
161 Ga0207707_10027217 3300025912 Bacteria 5000
162 Ga0207707_10137952 3300025912 Bacteria 2132
163 Ga0207707_10816836 3300025912 Bacteria 776
164 Ga0207707_11610939 3300025912 Bacteria 511
165 Ga0207695_10031242 3300025913 Bacteria 5845
166 Ga0207695_10167532 3300025913 Bacteria 2124
167 Ga0207660_10137179 3300025917 Bacteria 1867
168 Ga0207660_10484875 3300025917 Archaea 1002
169 Ga0207657_10156849 3300025919 Bacteria 1851
170 Ga0207657_10641824 3300025919 Unclassified 827
171 Ga0207649_10166772 3300025920 Bacteria 1530
172 Ga0207652_10121688 3300025921 Bacteria 2322
173 Ga0207646_10078850 3300025922 Bacteria 2944
174 Ga0207681_10318137 3300025923 Bacteria 1237
175 Ga0207694_10059748 3300025924 Bacteria 2966
176 Ga0207650_10133713 3300025925 Bacteria 1943
177 Ga0207650_11374932 3300025925 Unclassified 601
178 Ga0207659_10538476 3300025926 Bacteria 991
179 Ga0207687_10572691 3300025927 Bacteria 949
180 Ga0207690_10875860 3300025932 Archaea 744
181 Ga0207669_10195983 3300025937 Bacteria 1462
182 Ga0207661_11342919 3300025944 Archaea 656
183 Ga0207679_10370686 3300025945 Bacteria 1253
184 Ga0207667_10041746 3300025949 Bacteria 4878
185 Ga0207667_10342395 3300025949 Bacteria 1526
186 Ga0207651_10668837 3300025960 Unclassified 913
187 Ga0207651_10949400 3300025960 Bacteria 767
188 Ga0207640_11312790 3300025981 Bacteria 646
189 Ga0207677_11639183 3300026023 Unclassified 596
190 Ga0207639_10221169 3300026041 Bacteria 1635
191 Ga0207708_10499597 3300026075 Bacteria 1019
192 Ga0207702_10177453 3300026078 Bacteria 1959
193 Ga0207702_10519627 3300026078 Bacteria 1162
194 Ga0207648_12020874 3300026089 Unclassified 538
195 Ga0207674_10026439 3300026116 Bacteria 6163
196 Ga0207674_10140734 3300026116 Bacteria 2372
197 Ga0207674_10652222 3300026116 Bacteria 1016
198 Ga0207698_11292393 3300026142 Archaea 744
199 Ga0207428_10275178 3300027907 Bacteria 1251
200 Ga0268266_10006545 3300028379 Bacteria 10659
201 Ga0268266_10152629 3300028379 Bacteria 2083
202 Ga0268266_10448558 3300028379 Bacteria 1226
203 Ga0268266_11234510 3300028379 Unclassified 723
204 Ga0268266_11861693 3300028379 Bacteria 576
205 Ga0268265_11189049 3300028380 Bacteria 760
206 Ga0268265_11460486 3300028380 Unclassified 687
207 Ga0268265_11807775 3300028380 Unclassified 617
208 Ga0265332_10279176 3300031238 Unclassified 690
209 Ga0265332_10304342 3300031238 Bacteria 658
210 Ga0265325_10125519 3300031241 Bacteria 1234
211 Ga0265331_10080081 3300031250 Bacteria 1519
212 Ga0265316_10510965 3300031344 Bacteria 858
213 Ga0265314_10580198 3300031711 Unclassified 580
214 Ga0307411_10545095 3300032005 Bacteria 989
215 Ga0373930_0143299 3300034816 Bacteria 595
216 Ga0373928_0178761 3300035084 Unclassified 602
217 Ga0373934_0090837 3300035086 Bacteria 1231
218 Ga0373940_0279340 3300035088 Unclassified 570
219 Ga0373932_0074821 3300035112 Bacteria 1058
220 Ga0373939_0398510 3300035114 Unclassified 570
221 Ga0373941_0095971 3300035115 Bacteria 1025
222 Ga0373961_0315929 3300035241 Unclassified 581
223 Ga0373931_0084610 3300035691 Bacteria 1757
224 Ga0373927_0156311 3300035695 Bacteria 1494
225 Ga0373933_0241453 3300035724 Bacteria 1162
226 Ga0373937_0123180 3300036401 Bacteria 2417
227 Ga0373937_0829647 3300036401 Unclassified 873
228 Ga0373925_1010362 3300037068 Bacteria 685
229 Ga0395899_0038719 3300037312 Bacteria 3570
230 Ga0395899_0046489 3300037312 Bacteria 3233
231 Ga0395899_0069432 3300037312 Bacteria 2580
232 Ga0395900_0191298 3300037418 Bacteria 2075
233 Ga0395900_0271450 3300037418 Bacteria 1690
234 Ga0395900_1089684 3300037418 Bacteria 716
235 Ga0395898_0177693 3300037466 Bacteria 2034
236 Ga0395905_1363495 3300037471 Unclassified 613
237 Ga0395901_0001004 3300038443 Bacteria 30516
238 Ga0395901_0057519 3300038443 Bacteria 4044
239 Ga0395901_0106386 3300038443 Bacteria 2944
240 Ga0436365_0957444 3300039437 Bacteria 975
241 Ga0436360_0041678 3300039438 Unclassified 948
242 Ga0436360_0048664 3300039438 Bacteria 3795
243 Ga0436361_0705189 3300039447 Bacteria 5316
244 Ga0436362_1069785 3300039453 Bacteria 2222
245 Ga0436362_1275183 3300039453 Bacteria 730
246 Ga0451789_0991220 3300041443 Unclassified 858
247 Ga0451791_0896702 3300041451 Unclassified 893
248 Ga0451807_0841591 3300041486 Unclassified 763
249 Ga0451833_1261752 3300041491 Bacteria 719
250 Ga0439458_0023025 3300042157 Bacteria 1451
251 Ga0466963_0056364 3300044694 Bacteria 2615
252 Ga0466964_0753221 3300044706 Unclassified 547
253 Ga0466957_0221113 3300044842 Bacteria 1250
254 Ga0466967_0753899 3300045976 Unclassified 965
255 Ga0495675_0760616 3300047444 Unclassified 539
256 Ga0501034_0001445 3300049571 Bacteria 31511
257 Ga0501034_0004609 3300049571 Bacteria 15277
258 Ga0501034_0409998 3300049571 Unclassified 1277
259 Ga0501034_0516064 3300049571 Bacteria 1107
260 Ga0501043_0314221 3300049579 Bacteria 1195
261 Ga0501046_0076488 3300049580 Bacteria 2593
262 Ga0501047_0368113 3300049581 Bacteria 1272
263 Ga0501068_0020664 3300049584 Bacteria 3839
264 Ga0501070_0181279 3300049586 Bacteria 1733
265 Ga0501070_0181738 3300049586 Bacteria 1731
266 Ga0501083_0485677 3300049744 Unclassified 804
267 Ga0501044_0008008 3300049823 Bacteria 11614
268 Ga0501044_1017269 3300049823 Unclassified 700
269 nmdc:mga03683_129650_c1 3300050489 Bacteria 1127
270 nmdc:mga03683_1326_c3 3300050489 Bacteria 1896
271 nmdc:mga03683_264157_c1 3300050489 Bacteria 802
272 nmdc:mga03683_307638_c1 3300050489 Bacteria 744
273 nmdc:mga03683_638767_c1 3300050489 Unclassified 523
274 nmdc:mga03683_79543_c1 3300050489 Bacteria 1413
275 nmdc:mga03683_96962_c1 3300050489 Unclassified 1292
276 nmdc:mga03n38_257252_c1 3300050490 Bacteria 924
277 nmdc:mga03n38_427683_c1 3300050490 Bacteria 733
278 nmdc:mga00v17_249254_c1 3300050491 Bacteria 1151
279 nmdc:mga00v17_576800_c1 3300050491 Bacteria 726
280 nmdc:mga00v17_864596_c1 3300050491 Unclassified 574
281 nmdc:mga0yw44_114792_c1 3300050492 Bacteria 1729
282 nmdc:mga0yw44_134164_c1 3300050492 Bacteria 1605
283 nmdc:mga0yw44_13422_c1 3300050492 Bacteria 4314
284 nmdc:mga0yw44_196439_c2 3300050492 Unclassified 532
285 nmdc:mga0yw44_220108_c1 3300050492 Bacteria 1258
286 nmdc:mga0yw44_229090_c1 3300050492 Bacteria 1233
287 nmdc:mga0yw44_865620_c1 3300050492 Unclassified 613
288 nmdc:mga0yw44_985965_c1 3300050492 Bacteria 570
289 nmdc:mga0k408_236404_c1 3300050493 Bacteria 1091
290 nmdc:mga0k408_51799_c1 3300050493 Bacteria 2378
291 nmdc:mga0k408_73480_c1 3300050493 Bacteria 1997
292 nmdc:mga0k408_78215_c1 3300050493 Bacteria 1934
293 nmdc:mga06z11_13450_c1 3300050494 Bacteria 3594
294 nmdc:mga06z11_304571_c1 3300050494 Bacteria 948
295 nmdc:mga06z11_901337_c1 3300050494 Unclassified 539
296 nmdc:mga04h51_180099_c1 3300050495 Bacteria 822
297 nmdc:mga07m45_32923_c1 3300050496 Bacteria 2876
298 nmdc:mga07m45_892094_c1 3300050496 Unclassified 509
299 nmdc:mga08y16_543668_c1 3300050511 Bacteria 1176
300 nmdc:mga08y16_715120_c1 3300050511 Bacteria 1000
301 nmdc:mga0sz30_75875_c1 3300050516 Bacteria 1451
302 nmdc:mga0sz30_77_c1 3300050516 Bacteria 37634
303 Ga0500578_0653904 3300053086 Bacteria 571
304 Ga0500643_065529 3300053087 Bacteria 1014
305 Ga0500643_137002 3300053087 Unclassified 658
306 Ga0500644_0010230 3300053088 Bacteria 2533
307 Ga0500644_0261617 3300053088 Bacteria 732
308 Ga0500647_0022657 3300053091 Bacteria 2941
309 Ga0500583_0588846 3300053092 Bacteria 513
310 Ga0500651_0017479 3300053093 Bacteria 4426
311 Ga0500651_0514290 3300053093 Unclassified 659
312 Ga0500651_0529645 3300053093 Bacteria 647
313 Ga0500650_0208643 3300053098 Bacteria 888
314 Ga0500595_120430 3300053119 Unclassified 742
315 Ga0500577_0282846 3300053142 Unclassified 723
316 Ga0500616_0004217 3300053153 Bacteria 10358
317 Ga0500552_022064 3300053733 Bacteria 916
318 Ga0157376_11403355
319 JGI25406J46586_10042148
320 Ga0070658_10045503
321 Ga0070676_10458286
322 Ga0070683_100639494
323 Ga0070670_101125029
324 Ga0068869_101075407
325 Ga0070680_100001241
326 Ga0070660_100448028
327 Ga0070689_100259909
328 Ga0070689_100263217
329 Ga0070691_10007631
330 Ga0070691_10057509
331 Ga0070661_100039838
332 Ga0070675_100265006
333 Ga0070674_100850788
334 Ga0070673_101139951
335 Ga0070673_101880423
336 Ga0070688_100807913
337 Ga0070659_100167619
338 Ga0070667_101719552
339 Ga0070701_10695802
340 Ga0070701_11106736
341 Ga0070708_100056335
342 Ga0070681_10003085
343 Ga0070681_10596898
344 Ga0070681_10866618
345 Ga0070681_11010744
346 Ga0068867_101846508
347 Ga0070685_10412205
348 Ga0070685_10447521
349 Ga0070706_100025293
350 Ga0070707_100612116
351 Ga0070698_100001208
352 Ga0070699_100156522
353 Ga0070679_100023728
354 Ga0070684_100040638
355 Ga0068853_100564944
356 Ga0070665_100008704
357 Ga0070665_100203508
358 Ga0070665_100540960
359 Ga0070665_101828708
360 Ga0070665_101871439
361 Ga0068855_100017273
362 Ga0068855_100234363
363 Ga0068855_102147393
364 Ga0070664_100892206
365 Ga0068857_100041540
366 Ga0068857_100276874
367 Ga0068857_101471614
368 Ga0068854_100641654
369 Ga0068856_100288737
370 Ga0068856_100359964
371 Ga0070702_101594194
372 Ga0068852_102494654
373 Ga0068859_100122431
374 Ga0068859_101311619
375 Ga0068861_101526950
376 Ga0068851_10180493
377 Ga0068851_10856815
378 Ga0068858_100557382
379 Ga0068858_102247028
380 Ga0068862_100563640
381 Ga0068862_100762779
382 Ga0081455_10001706
383 Ga0081455_10018608
384 Ga0081455_10641037
385 Ga0081539_10001294
386 Ga0075365_10054758
387 Ga0075365_10095809
388 Ga0075365_10152195
389 Ga0075365_10177330
390 Ga0075365_10381451
391 Ga0075365_10577241
392 Ga0075365_10729853
393 Ga0075365_10927605
394 Ga0075365_11081519
395 Ga0075368_10053094
396 Ga0075368_10064505
397 Ga0075368_10125049
398 Ga0075363_100469476
399 Ga0075363_100581070
400 Ga0075364_10311557
401 Ga0075364_10732094
402 Ga0075362_10056113
403 Ga0075362_10076569
404 Ga0075362_10189819
405 Ga0075367_10017903
406 Ga0075367_10133243
407 Ga0075367_10232828
408 Ga0075367_10364990
409 Ga0075369_10005835
410 Ga0075369_10015859
411 Ga0075366_10064769
412 Ga0075366_10077487
413 Ga0075366_10080732
414 Ga0075366_10138887
415 Ga0075366_10286719
416 Ga0097621_101036926
417 Ga0075370_10042811
418 Ga0075370_10077550
419 Ga0075370_10138396
420 Ga0068865_100293655
421 Ga0068865_100298623
422 Ga0097620_100122431
423 Ga0097620_101311746
424 Ga0099794_10037493
425 Ga0099794_10335219
426 Ga0099795_10546051
427 Ga0105240_10015907
428 Ga0105240_10102262
429 Ga0105240_10359612
430 Ga0111539_10676374
431 Ga0105245_10916269
432 Ga0105245_11307245
433 Ga0105245_12295918
434 Ga0105247_10447934
435 Ga0105243_10803458
436 Ga0105241_10282377
437 Ga0105242_12012201
438 Ga0105248_11594622
439 Ga0105248_12320986
440 Ga0105237_11995717
441 Ga0105238_10056422
442 Ga0105238_11048673
443 Ga0105249_12654523
444 Ga0105028_124652
445 Ga0105239_10883877
446 Ga0105239_11628109
447 Ga0105246_10213837
448 Ga0157373_10119896
449 Ga0157370_10168180
450 Ga0157369_10142949
451 Ga0157374_11495496
452 Ga0157378_13129222
453 Ga0163162_11474058
454 Ga0157372_12269693
455 Ga0157372_12409762
456 Ga0157372_12525393
457 Ga0157372_13168968
458 Ga0182008_10409812
459 Ga0157379_10717378
460 Ga0157376_10625840
461 Ga0157376_11894971
462 Ga0197907_10074666
463 Ga0206356_10270514
464 Ga0206354_11230951
465 Ga0206353_11253160
466 Ga0213872_10021095
467 Ga0213871_10009838
468 Ga0224712_10233400
469 Ga0207426_1022042
470 Ga0207697_10081025
471 Ga0207656_10573761
472 Ga0207710_10229700
473 Ga0207688_10376413
474 Ga0207647_10118477
475 Ga0207645_10120830
476 Ga0207705_10013851
477 Ga0207684_10129217
478 Ga0207707_10027217
479 Ga0207707_10137952
480 Ga0207707_10816836
481 Ga0207707_11610939
482 Ga0207695_10031242
483 Ga0207695_10167532
484 Ga0207660_10137179
485 Ga0207660_10484875
486 Ga0207657_10156849
487 Ga0207657_10641824
488 Ga0207649_10166772
489 Ga0207652_10121688
490 Ga0207646_10078850
491 Ga0207681_10318137
492 Ga0207694_10059748
493 Ga0207650_10133713
494 Ga0207650_11374932
495 Ga0207659_10538476
496 Ga0207687_10572691
497 Ga0207690_10875860
498 Ga0207669_10195983
499 Ga0207661_11342919
500 Ga0207679_10370686
501 Ga0207667_10041746
502 Ga0207667_10342395
503 Ga0207651_10668837
504 Ga0207651_10949400
505 Ga0207640_11312790
506 Ga0207677_11639183
507 Ga0207639_10221169
508 Ga0207708_10499597
509 Ga0207702_10177453
510 Ga0207702_10519627
511 Ga0207648_12020874
512 Ga0207674_10026439
513 Ga0207674_10140734
514 Ga0207674_10652222
515 Ga0207698_11292393
516 Ga0207428_10275178
517 Ga0268266_10006545
518 Ga0268266_10152629
519 Ga0268266_10448558
520 Ga0268266_11234510
521 Ga0268266_11861693
522 Ga0268265_11189049
523 Ga0268265_11460486
524 Ga0268265_11807775
525 Ga0265332_10279176
526 Ga0265332_10304342
527 Ga0265325_10125519
528 Ga0265331_10080081
529 Ga0265316_10510965
530 Ga0265314_10580198
531 Ga0307411_10545095
532 Ga0373930_0143299
533 Ga0373928_0178761
534 Ga0373934_0090837
535 Ga0373940_0279340
536 Ga0373932_0074821
537 Ga0373939_0398510
538 Ga0373941_0095971
539 Ga0373961_0315929
540 Ga0373931_0084610
541 Ga0373927_0156311
542 Ga0373933_0241453
543 Ga0373937_0123180
544 Ga0373937_0829647
545 Ga0373925_1010362
546 Ga0395899_0038719
547 Ga0395899_0046489
548 Ga0395899_0069432
549 Ga0395900_0191298
550 Ga0395900_0271450
551 Ga0395900_1089684
552 Ga0395898_0177693
553 Ga0395905_1363495
554 Ga0395901_0001004
555 Ga0395901_0057519
556 Ga0395901_0106386
557 Ga0436365_0957444
558 Ga0436360_0041678
559 Ga0436360_0048664
560 Ga0436361_0705189
561 Ga0436362_1069785
562 Ga0436362_1275183
563 Ga0451789_0991220
564 Ga0451791_0896702
565 Ga0451807_0841591
566 Ga0451833_1261752
567 Ga0439458_0023025
568 Ga0466963_0056364
569 Ga0466964_0753221
570 Ga0466957_0221113
571 Ga0466967_0753899
572 Ga0495675_0760616
573 Ga0501034_0001445
574 Ga0501034_0004609
575 Ga0501034_0409998
576 Ga0501034_0516064
577 Ga0501043_0314221
578 Ga0501046_0076488
579 Ga0501047_0368113
580 Ga0501068_0020664
581 Ga0501070_0181279
582 Ga0501070_0181738
583 Ga0501083_0485677
584 Ga0501044_0008008
585 Ga0501044_1017269
586 nmdc:mga03683_129650_c1
587 nmdc:mga03683_1326_c3
588 nmdc:mga03683_264157_c1
589 nmdc:mga03683_307638_c1
590 nmdc:mga03683_638767_c1
591 nmdc:mga03683_79543_c1
592 nmdc:mga03683_96962_c1
593 nmdc:mga03n38_257252_c1
594 nmdc:mga03n38_427683_c1
595 nmdc:mga00v17_249254_c1
596 nmdc:mga00v17_576800_c1
597 nmdc:mga00v17_864596_c1
598 nmdc:mga0yw44_114792_c1
599 nmdc:mga0yw44_134164_c1
600 nmdc:mga0yw44_13422_c1
601 nmdc:mga0yw44_196439_c2
602 nmdc:mga0yw44_220108_c1
603 nmdc:mga0yw44_229090_c1
604 nmdc:mga0yw44_865620_c1
605 nmdc:mga0yw44_985965_c1
606 nmdc:mga0k408_236404_c1
607 nmdc:mga0k408_51799_c1
608 nmdc:mga0k408_73480_c1
609 nmdc:mga0k408_78215_c1
610 nmdc:mga06z11_13450_c1
611 nmdc:mga06z11_304571_c1
612 nmdc:mga06z11_901337_c1
613 nmdc:mga04h51_180099_c1
614 nmdc:mga07m45_32923_c1
615 nmdc:mga07m45_892094_c1
616 nmdc:mga08y16_543668_c1
617 nmdc:mga08y16_715120_c1
618 nmdc:mga0sz30_75875_c1
619 nmdc:mga0sz30_77_c1
620 Ga0500578_0653904
621 Ga0500643_065529
622 Ga0500643_137002
623 Ga0500644_0010230
624 Ga0500644_0261617
625 Ga0500647_0022657
626 Ga0500583_0588846
627 Ga0500651_0017479
628 Ga0500651_0514290
629 Ga0500651_0529645
630 Ga0500650_0208643
631 Ga0500595_120430
632 Ga0500577_0282846
633 Ga0500616_0004217
634 Ga0500552_022064

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06568

DUF1127

Domain of unknown function (DUF1127)

41

77

0.93

Map