F404229

General Info

Members Datasets Scaffolds Average Seq Length
317 173 634 246

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10008697|Ga0307414_100086973
Length 238
Sequence MNKFLGYIFSPLFIFQPIQWLCYRLGGYKAHKISVDILNFFLTYCDFFLGSSVTFINHQSLPENRSIIFIAYDIPALIWFLRKYHVKFISKIELTRGIPSISFNLKYGGGANIDRKDSKQAVSEIIKLGRRMKEHTWSTMIFPEGTRSKDGRLKPFQVGGIATLLKVVPDALIVPVAIENSWKIVQYGSFPLSFGEQLKWTVLDPIEPAGRNAEEVTAAAENAIRTQLKQIPADLQDA

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
143 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
144 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
148 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
149 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
150 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
151 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
152 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
153 2738541283 Pedobacter sp. OK701 Isolate Unclassified
154 2738541284 Pedobacter sp. YR016 Isolate Unclassified
155 2738541302 Pedobacter sp. CF074 Isolate Unclassified
156 2739367651 Pedobacter sp. OK291 Isolate Unclassified
157 2739367656 Pedobacter sp. CF523 Isolate Unclassified
158 2739367663 Pedobacter sp. YR510 Isolate Unclassified
159 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
160 2818991437 Pedobacter terrae 518 Isolate Unclassified
161 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
162 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
163 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
164 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
165 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
166 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
167 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
168 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
169 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
170 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
171 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
172 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
173 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.06
Metatranscriptomes 0
Isolates 6.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.99
Nodule 0
Rhizoplane 0
Rhizosphere 79.5
Stem 0
Stem Tuber 0
Unclassified 5.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10008697 3300032004 Bacteria 5782
2 SwRhRL2b_contig_2665874 2162886007 Bacteria 8637
3 JGI24736J21556_1003689 3300001904 Bacteria 2645
4 JGI24737J22298_10013203 3300001990 Bacteria 2690
5 JGI24737J22298_10048619 3300001990 Bacteria 1291
6 JGI24735J21928_10013850 3300002067 Bacteria 2529
7 JGI25162J39368_1000158 3300002737 Bacteria 74916
8 JGI25162J39368_1001346 3300002737 Bacteria 13624
9 JGI25164J39214_1002880 3300002772 Bacteria 2381
10 JGI25152J39213_1000054 3300002773 Bacteria 76796
11 JGI25150J39212_1000003 3300002774 Bacteria 508651
12 JGI25150J39212_1000004 3300002774 Bacteria 417320
13 JGI25151J46595_10000002 3300003187 Bacteria 731381
14 JGI25165J46597_1000989 3300003214 Bacteria 18960
15 JGI25153J46596_10000015 3300003215 Bacteria 289820
16 rootH1_10041946 3300003316 Bacteria 8448
17 rootH2_10044553 3300003320 Bacteria 4167
18 rootH2_10076865 3300003320 Bacteria 4583
19 rootH2_10163475 3300003320 Bacteria 1393
20 rootH1_10012646 3300003323 Bacteria 62371
21 rootH1_10061983 3300003323 Bacteria 4339
22 rootH1_10071187 3300003323 Bacteria 3657
23 Ga0055536_1000006 3300003781 Bacteria 347733
24 Ga0055530_10003396 3300003791 Bacteria 9087
25 Ga0065714_10002609 3300005288 Bacteria 23390
26 Ga0065714_10065739 3300005288 Bacteria 8667
27 Ga0065714_10074750 3300005288 Bacteria 2994
28 Ga0065714_10127129 3300005288 Bacteria 1253
29 Ga0065704_10001668 3300005289 Bacteria 7109
30 Ga0065704_10070323 3300005289 Bacteria 32863
31 Ga0070658_10000008 3300005327 Bacteria 319912
32 Ga0070658_10022913 3300005327 Bacteria 5013
33 Ga0070658_10337676 3300005327 Bacteria 1288
34 Ga0068868_100053548 3300005338 Unclassified 3179
35 Ga0068868_100085533 3300005338 Bacteria 2534
36 Ga0070660_100346398 3300005339 Unclassified 1223
37 Ga0070691_10257972 3300005341 Bacteria 937
38 Ga0070673_100025171 3300005364 Bacteria 4376
39 Ga0070659_100001588 3300005366 Bacteria 16376
40 Ga0070659_100001887 3300005366 Bacteria 14999
41 Ga0070659_100139515 3300005366 Bacteria 1973
42 Ga0070678_100054315 3300005456 Unclassified 2918
43 Ga0070662_100000790 3300005457 Bacteria 19431
44 Ga0070681_10006627 3300005458 Bacteria 11278
45 Ga0068867_100045744 3300005459 Bacteria 3211
46 Ga0070679_100002383 3300005530 Bacteria 17030
47 Ga0068853_100006526 3300005539 Bacteria 9285
48 Ga0070672_100194992 3300005543 Bacteria 1692
49 Ga0070665_100000118 3300005548 Bacteria 149830
50 Ga0068855_100000155 3300005563 Bacteria 86903
51 Ga0068855_100002647 3300005563 Bacteria 22069
52 Ga0068855_100007287 3300005563 Bacteria 13397
53 Ga0068855_100010187 3300005563 Bacteria 11330
54 Ga0068855_100080126 3300005563 Bacteria 3786
55 Ga0068855_100129887 3300005563 Bacteria 2878
56 Ga0068855_100324757 3300005563 Unclassified 1700
57 Ga0068857_100012630 3300005577 Bacteria 7360
58 Ga0068856_100082027 3300005614 Bacteria 3200
59 Ga0068852_100002261 3300005616 Bacteria 13217
60 Ga0068852_100265689 3300005616 Unclassified 1649
61 Ga0068858_100399598 3300005842 Bacteria 1320
62 Ga0075366_10002272 3300006195 Bacteria 9812
63 Ga0075366_10247572 3300006195 Bacteria 1087
64 Ga0097621_100000174 3300006237 Bacteria 40714
65 Ga0075370_10128649 3300006353 Unclassified 1477
66 Ga0068871_100000060 3300006358 Bacteria 59245
67 Ga0068865_100000345 3300006881 Bacteria 25771
68 Ga0105244_10033756 3300009036 Bacteria 2696
69 Ga0105244_10089877 3300009036 Bacteria 1511
70 Ga0105240_10000371 3300009093 Bacteria 84390
71 Ga0105240_10004289 3300009093 Bacteria 21785
72 Ga0105240_10017291 3300009093 Bacteria 9724
73 Ga0105240_10027708 3300009093 Bacteria 7414
74 Ga0105240_10062117 3300009093 Bacteria 4652
75 Ga0105240_10069664 3300009093 Bacteria 4353
76 Ga0105240_10138905 3300009093 Bacteria 2907
77 Ga0105240_10220456 3300009093 Bacteria 2210
78 Ga0105240_10281969 3300009093 Bacteria 1908
79 Ga0105240_10450444 3300009093 Unclassified 1440
80 Ga0105243_10008576 3300009148 Bacteria 7841
81 Ga0105241_10003593 3300009174 Bacteria 11536
82 Ga0105241_10004960 3300009174 Bacteria 9814
83 Ga0105241_10015821 3300009174 Bacteria 5526
84 Ga0105241_10110749 3300009174 Bacteria 2197
85 Ga0105241_10191689 3300009174 Bacteria 1702
86 Ga0105242_10501489 3300009176 Bacteria 1154
87 Ga0105237_10002011 3300009545 Bacteria 25894
88 Ga0105237_10002057 3300009545 Bacteria 25541
89 Ga0105237_10002169 3300009545 Bacteria 24637
90 Ga0105237_10003766 3300009545 Bacteria 17851
91 Ga0105237_10004069 3300009545 Bacteria 17053
92 Ga0105237_10599225 3300009545 Bacteria 1109
93 Ga0105237_10674844 3300009545 Unclassified 1040
94 Ga0105238_10059039 3300009551 Bacteria 3844
95 Ga0105238_10091214 3300009551 Bacteria 3034
96 Ga0105238_10773313 3300009551 Bacteria 975
97 Ga0105239_10000166 3300010375 Bacteria 94743
98 Ga0105239_10000278 3300010375 Bacteria 75485
99 Ga0105239_10000865 3300010375 Bacteria 43041
100 Ga0105239_10002482 3300010375 Bacteria 23507
101 Ga0105239_10010943 3300010375 Bacteria 10133
102 Ga0105239_10026667 3300010375 Bacteria 6360
103 Ga0105239_10028716 3300010375 Bacteria 6116
104 Ga0105239_10077373 3300010375 Bacteria 3661
105 Ga0105239_10094945 3300010375 Bacteria 3294
106 Ga0105246_10027502 3300011119 Bacteria 3727
107 Ga0157373_10000262 3300013100 Bacteria 42799
108 Ga0157373_10000678 3300013100 Bacteria 26681
109 Ga0157373_10019649 3300013100 Bacteria 4914
110 Ga0157373_10196989 3300013100 Unclassified 1420
111 Ga0157371_10000107 3300013102 Bacteria 126477
112 Ga0157371_10000117 3300013102 Bacteria 121069
113 Ga0157371_10001520 3300013102 Bacteria 23949
114 Ga0157371_10003549 3300013102 Bacteria 14071
115 Ga0157371_10009852 3300013102 Bacteria 7487
116 Ga0157371_10367716 3300013102 Unclassified 1049
117 Ga0157370_10003772 3300013104 Bacteria 17695
118 Ga0157370_10018299 3300013104 Bacteria 7047
119 Ga0157370_10021228 3300013104 Bacteria 6473
120 Ga0157370_10036382 3300013104 Bacteria 4777
121 Ga0157370_10091862 3300013104 Bacteria 2849
122 Ga0157370_10117441 3300013104 Bacteria 2485
123 Ga0157370_10138605 3300013104 Bacteria 2267
124 Ga0157369_10000047 3300013105 Bacteria 172682
125 Ga0157369_10038399 3300013105 Bacteria 5236
126 Ga0157369_10536572 3300013105 Bacteria 1210
127 Ga0157374_10000301 3300013296 Bacteria 45768
128 Ga0157374_10002065 3300013296 Bacteria 16892
129 Ga0157374_10223794 3300013296 Unclassified 1847
130 Ga0157378_10031756 3300013297 Bacteria 4665
131 Ga0157378_10347233 3300013297 Bacteria 1449
132 Ga0163162_10000012 3300013306 Bacteria 292674
133 Ga0163162_10000895 3300013306 Bacteria 27750
134 Ga0163162_10473650 3300013306 Bacteria 1384
135 Ga0163162_10575559 3300013306 Bacteria 1253
136 Ga0157372_10000238 3300013307 Bacteria 60988
137 Ga0157372_10019063 3300013307 Bacteria 7386
138 Ga0157372_10046042 3300013307 Bacteria 4841
139 Ga0157375_10004936 3300013308 Bacteria 11601
140 Ga0157375_10006259 3300013308 Bacteria 10369
141 Ga0157375_10029791 3300013308 Bacteria 5138
142 Ga0157375_10078439 3300013308 Bacteria 3336
143 Ga0182008_10000132 3300014497 Bacteria 56231
144 Ga0182008_10000294 3300014497 Bacteria 39204
145 Ga0182008_10029039 3300014497 Bacteria 2795
146 Ga0182008_10224664 3300014497 Bacteria 962
147 Ga0157377_10010267 3300014745 Bacteria 4625
148 Ga0182006_1000179 3300015261 Bacteria 66779
149 Ga0182006_1000349 3300015261 Bacteria 38806
150 Ga0182006_1012363 3300015261 Bacteria 3731
151 Ga0182007_10011302 3300015262 Bacteria 3478
152 Ga0182007_10053393 3300015262 Bacteria 1330
153 Ga0163161_10000800 3300017792 Bacteria 24627
154 Ga0163161_10000830 3300017792 Bacteria 24159
155 Ga0163161_10001299 3300017792 Bacteria 18626
156 Ga0163161_10026693 3300017792 Bacteria 4091
157 Ga0163161_10028373 3300017792 Bacteria 3975
158 Ga0163161_10049327 3300017792 Bacteria 3042
159 Ga0209563_118427 3300025230 Unclassified 820
160 Ga0207427_100122 3300025231 Bacteria 99064
161 Ga0209437_100048 3300025233 Bacteria 405107
162 Ga0209437_100280 3300025233 Bacteria 74968
163 Ga0207425_1000003 3300025245 Bacteria 1145342
164 Ga0209026_1000852 3300025250 Bacteria 15983
165 Ga0209026_1009890 3300025250 Bacteria 1826
166 Ga0209129_1000014 3300025258 Bacteria 509018
167 Ga0209129_1006753 3300025258 Bacteria 3612
168 Ga0209233_1000029 3300025261 Bacteria 641642
169 Ga0209233_1002773 3300025261 Bacteria 6299
170 Ga0209233_1007433 3300025261 Bacteria 3473
171 Ga0209455_1004572 3300025272 Bacteria 4489
172 Ga0209676_1000039 3300025292 Bacteria 443158
173 Ga0209025_1000007 3300025294 Bacteria 1145109
174 Ga0209758_1000012 3300025297 Bacteria 949866
175 Ga0209050_1000033 3300025298 Bacteria 442615
176 Ga0207655_1098021 3300025728 Bacteria 1016
177 Ga0207647_10000071 3300025904 Bacteria 79170
178 Ga0207645_10000229 3300025907 Bacteria 46502
179 Ga0207705_10000026 3300025909 Bacteria 256051
180 Ga0207705_10033906 3300025909 Bacteria 3648
181 Ga0207705_10327940 3300025909 Bacteria 1177
182 Ga0207654_10001012 3300025911 Bacteria 15381
183 Ga0207654_10008957 3300025911 Bacteria 5077
184 Ga0207707_10025235 3300025912 Bacteria 5199
185 Ga0207695_10000142 3300025913 Bacteria 214715
186 Ga0207695_10013341 3300025913 Bacteria 9806
187 Ga0207695_10014435 3300025913 Bacteria 9358
188 Ga0207695_10017626 3300025913 Bacteria 8299
189 Ga0207695_10067185 3300025913 Bacteria 3678
190 Ga0207695_10094760 3300025913 Bacteria 2991
191 Ga0207695_10273080 3300025913 Bacteria 1586
192 Ga0207695_10402995 3300025913 Bacteria 1252
193 Ga0207671_10000110 3300025914 Bacteria 126480
194 Ga0207671_10001334 3300025914 Bacteria 28837
195 Ga0207671_10010547 3300025914 Bacteria 7608
196 Ga0207671_10014241 3300025914 Bacteria 6294
197 Ga0207671_10040706 3300025914 Bacteria 3439
198 Ga0207660_10087296 3300025917 Bacteria 2305
199 Ga0207657_10023346 3300025919 Bacteria 5761
200 Ga0207657_10311403 3300025919 Unclassified 1246
201 Ga0207652_10008028 3300025921 Bacteria 8469
202 Ga0207694_10021244 3300025924 Bacteria 4917
203 Ga0207694_10058698 3300025924 Bacteria 2993
204 Ga0207644_10066744 3300025931 Bacteria 2620
205 Ga0207690_10004024 3300025932 Bacteria 8680
206 Ga0207690_10008902 3300025932 Bacteria 5959
207 Ga0207706_10001203 3300025933 Bacteria 26147
208 Ga0207686_10323012 3300025934 Bacteria 1154
209 Ga0207704_10000047 3300025938 Bacteria 84386
210 Ga0207691_10159830 3300025940 Bacteria 1977
211 Ga0207667_10000015 3300025949 Bacteria 417534
212 Ga0207667_10000953 3300025949 Bacteria 36919
213 Ga0207667_10025051 3300025949 Bacteria 6540
214 Ga0207667_10038089 3300025949 Bacteria 5137
215 Ga0207667_10070286 3300025949 Bacteria 3644
216 Ga0207667_10168451 3300025949 Bacteria 2252
217 Ga0207667_10554387 3300025949 Bacteria 1162
218 Ga0207677_10107092 3300026023 Bacteria 2073
219 Ga0207703_10228243 3300026035 Bacteria 1668
220 Ga0207639_10005859 3300026041 Bacteria 8324
221 Ga0207702_10144506 3300026078 Bacteria 2157
222 Ga0207648_10001813 3300026089 Bacteria 23430
223 Ga0207674_10091574 3300026116 Bacteria 3030
224 Ga0207683_10001294 3300026121 Bacteria 22621
225 Ga0207698_10042241 3300026142 Bacteria 3404
226 Ga0207698_10406950 3300026142 Unclassified 1302
227 Ga0268266_10000121 3300028379 Bacteria 154995
228 Ga0307517_10000198 3300028786 Bacteria 102181
229 Ga0265338_10020641 3300028800 Bacteria 6918
230 Ga0265338_10236657 3300028800 Unclassified 1355
231 Ga0307408_100000464 3300031548 Bacteria 35518
232 Ga0307405_10000009 3300031731 Bacteria 259388
233 Ga0307412_10000050 3300031911 Bacteria 151527
234 Ga0307412_10363650 3300031911 Bacteria 1166
235 Ga0307414_10000344 3300032004 Bacteria 26282
236 Ga0307414_10003900 3300032004 Bacteria 8034
237 Ga0307414_10035597 3300032004 Bacteria 3315
238 Ga0307414_10208467 3300032004 Bacteria 1595
239 Ga0307414_10379010 3300032004 Bacteria 1222
240 Ga0307411_10567536 3300032005 Bacteria 971
241 Ga0307510_10010234 3300033180 Bacteria 11150
242 Ga0395899_0000027 3300037312 Bacteria 337387
243 Ga0395899_0014872 3300037312 Bacteria 5939
244 Ga0395900_0000140 3300037418 Bacteria 121917
245 Ga0395900_0000275 3300037418 Bacteria 78207
246 Ga0395900_0028740 3300037418 Bacteria 5700
247 Ga0395900_0205832 3300037418 Bacteria 1989
248 Ga0395898_0001454 3300037466 Bacteria 33553
249 Ga0395898_0074989 3300037466 Bacteria 3268
250 Ga0395905_0000248 3300037471 Bacteria 81042
251 Ga0395905_0009775 3300037471 Bacteria 9353
252 Ga0395901_0000145 3300038443 Bacteria 91739
253 Ga0395901_0003259 3300038443 Bacteria 16332
254 Ga0395901_0066168 3300038443 Bacteria 3765
255 Ga0451837_1327160 3300041494 Bacteria 950
256 Ga0439448_0005766 3300042005 Bacteria 3537
257 Ga0466966_0071647 3300044684 Bacteria 2171
258 Ga0495627_020454 3300046453 Bacteria 2205
259 Ga0495651_0059768 3300046462 Bacteria 2922
260 Ga0495605_0195103 3300046474 Bacteria 884
261 Ga0495596_0013880 3300046500 Bacteria 3403
262 Ga0495607_0151610 3300046501 Bacteria 1186
263 Ga0495606_0081978 3300046507 Bacteria 2004
264 Ga0495610_0000076 3300046512 Bacteria 118246
265 Ga0495610_0000696 3300046512 Bacteria 32341
266 Ga0495610_0046314 3300046512 Bacteria 2146
267 Ga0495637_0005787 3300046520 Bacteria 6262
268 Ga0495648_0248561 3300046524 Bacteria 860
269 Ga0495609_0007600 3300046538 Bacteria 5388
270 Ga0495625_0019056 3300046660 Bacteria 5339
271 Ga0495661_0003969 3300046665 Bacteria 10802
272 Ga0495661_0018080 3300046665 Bacteria 4642
273 Ga0495669_0074091 3300046684 Bacteria 1556
274 Ga0495683_0054777 3300047323 Bacteria 1987
275 Ga0495687_002555 3300047443 Bacteria 14392
276 Ga0495686_0000785 3300047472 Bacteria 41504
277 Ga0495686_0001903 3300047472 Bacteria 20836
278 Ga0495686_0096808 3300047472 Bacteria 1785
279 Ga0495686_0293654 3300047472 Unclassified 899
280 Ga0496121_0000007 3300048924 Bacteria 942516
281 Ga0496122_0004298 3300048925 Bacteria 17852
282 Ga0496123_0005429 3300048926 Bacteria 12835
283 Ga0496125_0028448 3300048928 Bacteria 5048
284 Ga0501240_002808 3300049673 Bacteria 1880
285 Ga0501241_001867 3300049758 Bacteria 4146
286 Ga0501280_002435 3300049776 Bacteria 3106
287 nmdc:mga0k408_1125_c1 3300050493 Bacteria 14653
288 nmdc:mga0k408_194394_c1 3300050493 Bacteria 1211
289 nmdc:mga07m45_180693_c1 3300050496 Unclassified 1227
290 nmdc:mga07m45_18614_c1 3300050496 Bacteria 3753
291 Ga0500635_0171207 3300053080 Bacteria 836
292 Ga0500651_0000350 3300053093 Bacteria 25883
293 Ga0500608_001457 3300053122 Bacteria 8457
294 Ga0500618_000005 3300053125 Bacteria 253092
295 Ga0500622_0000860 3300053156 Bacteria 25927
296 2586208797 2585427687 Bacteria 5544917
297 2738759094 2738541283 Bacteria 7222293
298 2738761796 2738541284 Bacteria 5199923
299 2738854854 2738541302 Bacteria 5944758
300 2739587031 2739367651 Bacteria 6359826
301 2739618221 2739367656 Bacteria 5152243
302 2739646328 2739367663 Bacteria 5040914
303 2776615558 2775506987 Bacteria 5373360
304 2819547484 2818991437 Bacteria 5805520
305 2842727523 2842722452 Bacteria 6263924
306 2842911268 2842909656 Bacteria 6185908
307 2849286478 2849281842 Bacteria 6065644
308 2852626484 2852623160 Bacteria 4376875
309 2857631489 2857627736 Bacteria 5625397
310 2884934911 2884933994 Bacteria 4535041
311 2895501526 2895498888 Bacteria 5283788
312 2902051304 2902048731 Bacteria 4976191
313 2904448913 2904445276 Bacteria 5310396
314 2919190748 2919186247 Bacteria 6244071
315 2919437911 2919437846 Bacteria 6199444
316 2939669042 2939664404 Bacteria 6364494
317 2946003193 2945997725 Bacteria 6404843
318 Ga0307414_10008697
319 SwRhRL2b_contig_2665874
320 JGI24736J21556_1003689
321 JGI24737J22298_10013203
322 JGI24737J22298_10048619
323 JGI24735J21928_10013850
324 JGI25162J39368_1000158
325 JGI25162J39368_1001346
326 JGI25164J39214_1002880
327 JGI25152J39213_1000054
328 JGI25150J39212_1000003
329 JGI25150J39212_1000004
330 JGI25151J46595_10000002
331 JGI25165J46597_1000989
332 JGI25153J46596_10000015
333 rootH1_10041946
334 rootH2_10044553
335 rootH2_10076865
336 rootH2_10163475
337 rootH1_10012646
338 rootH1_10061983
339 rootH1_10071187
340 Ga0055536_1000006
341 Ga0055530_10003396
342 Ga0065714_10002609
343 Ga0065714_10065739
344 Ga0065714_10074750
345 Ga0065714_10127129
346 Ga0065704_10001668
347 Ga0065704_10070323
348 Ga0070658_10000008
349 Ga0070658_10022913
350 Ga0070658_10337676
351 Ga0068868_100053548
352 Ga0068868_100085533
353 Ga0070660_100346398
354 Ga0070691_10257972
355 Ga0070673_100025171
356 Ga0070659_100001588
357 Ga0070659_100001887
358 Ga0070659_100139515
359 Ga0070678_100054315
360 Ga0070662_100000790
361 Ga0070681_10006627
362 Ga0068867_100045744
363 Ga0070679_100002383
364 Ga0068853_100006526
365 Ga0070672_100194992
366 Ga0070665_100000118
367 Ga0068855_100000155
368 Ga0068855_100002647
369 Ga0068855_100007287
370 Ga0068855_100010187
371 Ga0068855_100080126
372 Ga0068855_100129887
373 Ga0068855_100324757
374 Ga0068857_100012630
375 Ga0068856_100082027
376 Ga0068852_100002261
377 Ga0068852_100265689
378 Ga0068858_100399598
379 Ga0075366_10002272
380 Ga0075366_10247572
381 Ga0097621_100000174
382 Ga0075370_10128649
383 Ga0068871_100000060
384 Ga0068865_100000345
385 Ga0105244_10033756
386 Ga0105244_10089877
387 Ga0105240_10000371
388 Ga0105240_10004289
389 Ga0105240_10017291
390 Ga0105240_10027708
391 Ga0105240_10062117
392 Ga0105240_10069664
393 Ga0105240_10138905
394 Ga0105240_10220456
395 Ga0105240_10281969
396 Ga0105240_10450444
397 Ga0105243_10008576
398 Ga0105241_10003593
399 Ga0105241_10004960
400 Ga0105241_10015821
401 Ga0105241_10110749
402 Ga0105241_10191689
403 Ga0105242_10501489
404 Ga0105237_10002011
405 Ga0105237_10002057
406 Ga0105237_10002169
407 Ga0105237_10003766
408 Ga0105237_10004069
409 Ga0105237_10599225
410 Ga0105237_10674844
411 Ga0105238_10059039
412 Ga0105238_10091214
413 Ga0105238_10773313
414 Ga0105239_10000166
415 Ga0105239_10000278
416 Ga0105239_10000865
417 Ga0105239_10002482
418 Ga0105239_10010943
419 Ga0105239_10026667
420 Ga0105239_10028716
421 Ga0105239_10077373
422 Ga0105239_10094945
423 Ga0105246_10027502
424 Ga0157373_10000262
425 Ga0157373_10000678
426 Ga0157373_10019649
427 Ga0157373_10196989
428 Ga0157371_10000107
429 Ga0157371_10000117
430 Ga0157371_10001520
431 Ga0157371_10003549
432 Ga0157371_10009852
433 Ga0157371_10367716
434 Ga0157370_10003772
435 Ga0157370_10018299
436 Ga0157370_10021228
437 Ga0157370_10036382
438 Ga0157370_10091862
439 Ga0157370_10117441
440 Ga0157370_10138605
441 Ga0157369_10000047
442 Ga0157369_10038399
443 Ga0157369_10536572
444 Ga0157374_10000301
445 Ga0157374_10002065
446 Ga0157374_10223794
447 Ga0157378_10031756
448 Ga0157378_10347233
449 Ga0163162_10000012
450 Ga0163162_10000895
451 Ga0163162_10473650
452 Ga0163162_10575559
453 Ga0157372_10000238
454 Ga0157372_10019063
455 Ga0157372_10046042
456 Ga0157375_10004936
457 Ga0157375_10006259
458 Ga0157375_10029791
459 Ga0157375_10078439
460 Ga0182008_10000132
461 Ga0182008_10000294
462 Ga0182008_10029039
463 Ga0182008_10224664
464 Ga0157377_10010267
465 Ga0182006_1000179
466 Ga0182006_1000349
467 Ga0182006_1012363
468 Ga0182007_10011302
469 Ga0182007_10053393
470 Ga0163161_10000800
471 Ga0163161_10000830
472 Ga0163161_10001299
473 Ga0163161_10026693
474 Ga0163161_10028373
475 Ga0163161_10049327
476 Ga0209563_118427
477 Ga0207427_100122
478 Ga0209437_100048
479 Ga0209437_100280
480 Ga0207425_1000003
481 Ga0209026_1000852
482 Ga0209026_1009890
483 Ga0209129_1000014
484 Ga0209129_1006753
485 Ga0209233_1000029
486 Ga0209233_1002773
487 Ga0209233_1007433
488 Ga0209455_1004572
489 Ga0209676_1000039
490 Ga0209025_1000007
491 Ga0209758_1000012
492 Ga0209050_1000033
493 Ga0207655_1098021
494 Ga0207647_10000071
495 Ga0207645_10000229
496 Ga0207705_10000026
497 Ga0207705_10033906
498 Ga0207705_10327940
499 Ga0207654_10001012
500 Ga0207654_10008957
501 Ga0207707_10025235
502 Ga0207695_10000142
503 Ga0207695_10013341
504 Ga0207695_10014435
505 Ga0207695_10017626
506 Ga0207695_10067185
507 Ga0207695_10094760
508 Ga0207695_10273080
509 Ga0207695_10402995
510 Ga0207671_10000110
511 Ga0207671_10001334
512 Ga0207671_10010547
513 Ga0207671_10014241
514 Ga0207671_10040706
515 Ga0207660_10087296
516 Ga0207657_10023346
517 Ga0207657_10311403
518 Ga0207652_10008028
519 Ga0207694_10021244
520 Ga0207694_10058698
521 Ga0207644_10066744
522 Ga0207690_10004024
523 Ga0207690_10008902
524 Ga0207706_10001203
525 Ga0207686_10323012
526 Ga0207704_10000047
527 Ga0207691_10159830
528 Ga0207667_10000015
529 Ga0207667_10000953
530 Ga0207667_10025051
531 Ga0207667_10038089
532 Ga0207667_10070286
533 Ga0207667_10168451
534 Ga0207667_10554387
535 Ga0207677_10107092
536 Ga0207703_10228243
537 Ga0207639_10005859
538 Ga0207702_10144506
539 Ga0207648_10001813
540 Ga0207674_10091574
541 Ga0207683_10001294
542 Ga0207698_10042241
543 Ga0207698_10406950
544 Ga0268266_10000121
545 Ga0307517_10000198
546 Ga0265338_10020641
547 Ga0265338_10236657
548 Ga0307408_100000464
549 Ga0307405_10000009
550 Ga0307412_10000050
551 Ga0307412_10363650
552 Ga0307414_10000344
553 Ga0307414_10003900
554 Ga0307414_10035597
555 Ga0307414_10208467
556 Ga0307414_10379010
557 Ga0307411_10567536
558 Ga0307510_10010234
559 Ga0395899_0000027
560 Ga0395899_0014872
561 Ga0395900_0000140
562 Ga0395900_0000275
563 Ga0395900_0028740
564 Ga0395900_0205832
565 Ga0395898_0001454
566 Ga0395898_0074989
567 Ga0395905_0000248
568 Ga0395905_0009775
569 Ga0395901_0000145
570 Ga0395901_0003259
571 Ga0395901_0066168
572 Ga0451837_1327160
573 Ga0439448_0005766
574 Ga0466966_0071647
575 Ga0495627_020454
576 Ga0495651_0059768
577 Ga0495605_0195103
578 Ga0495596_0013880
579 Ga0495607_0151610
580 Ga0495606_0081978
581 Ga0495610_0000076
582 Ga0495610_0000696
583 Ga0495610_0046314
584 Ga0495637_0005787
585 Ga0495648_0248561
586 Ga0495609_0007600
587 Ga0495625_0019056
588 Ga0495661_0003969
589 Ga0495661_0018080
590 Ga0495669_0074091
591 Ga0495683_0054777
592 Ga0495687_002555
593 Ga0495686_0000785
594 Ga0495686_0001903
595 Ga0495686_0096808
596 Ga0495686_0293654
597 Ga0496121_0000007
598 Ga0496122_0004298
599 Ga0496123_0005429
600 Ga0496125_0028448
601 Ga0501240_002808
602 Ga0501241_001867
603 Ga0501280_002435
604 nmdc:mga0k408_1125_c1
605 nmdc:mga0k408_194394_c1
606 nmdc:mga07m45_180693_c1
607 nmdc:mga07m45_18614_c1
608 Ga0500635_0171207
609 Ga0500651_0000350
610 Ga0500608_001457
611 Ga0500618_000005
612 Ga0500622_0000860
613 2586208797
614 2738759094
615 2738761796
616 2738854854
617 2739587031
618 2739618221
619 2739646328
620 2776615558
621 2819547484
622 2842727523
623 2842911268
624 2849286478
625 2852626484
626 2857631489
627 2884934911
628 2895501526
629 2902051304
630 2904448913
631 2919190748
632 2919437911
633 2939669042
634 2946003193

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

50

179

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8338 1 243
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8325 1 243
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8145 1 243
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8044 1 243
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.5635 20 237
ID Description Score Start End Superfamily
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8762 74 189 3.40.50.620
af_A0A0R0I9W2_89_248_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8732 10 56 1.20.1250.20
af_Q9VYJ4_80_210_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8709 73 189 3.40.50.620
af_Q93841_73_201_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8697 73 189 3.40.50.620
af_Q54EU4_95_228_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8691 68 189 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2T5J8E1-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9889 1 244 GO:0003841
GO:0006654
GO:0016020
AF-A0A2T5J8E1-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9849 1 244 GO:0003841
GO:0006654
GO:0016020
AF-A0A4Q3H179-F1-model_v4 deleted 0.9821 28 247
AF-A0A6M1NI86-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9812 1 241 GO:0003841
GO:0006654
GO:0016020
AF-U2HH60-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.9795 1 241 GO:0003841
GO:0006654
GO:0016020

Map