F404229
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 173 | 634 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10008697|Ga0307414_100086973 |
| Length | 238 |
| Sequence | MNKFLGYIFSPLFIFQPIQWLCYRLGGYKAHKISVDILNFFLTYCDFFLGSSVTFINHQSLPENRSIIFIAYDIPALIWFLRKYHVKFISKIELTRGIPSISFNLKYGGGANIDRKDSKQAVSEIIKLGRRMKEHTWSTMIFPEGTRSKDGRLKPFQVGGIATLLKVVPDALIVPVAIENSWKIVQYGSFPLSFGEQLKWTVLDPIEPAGRNAEEVTAAAENAIRTQLKQIPADLQDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 108 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 113 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 120 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 121 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 122 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 139 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 140 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 141 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 142 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 143 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 144 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 145 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 146 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 147 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 148 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 149 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 150 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 151 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 152 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 153 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 154 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 155 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 156 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 157 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 158 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 159 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 160 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 161 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 162 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 163 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 164 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 165 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 166 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 167 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 168 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 169 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 170 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 171 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 172 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 173 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.06 |
| Metatranscriptomes | 0 |
| Isolates | 6.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.99 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 79.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307414_10008697 | 3300032004 | Bacteria | 5782 |
| 2 | SwRhRL2b_contig_2665874 | 2162886007 | Bacteria | 8637 |
| 3 | JGI24736J21556_1003689 | 3300001904 | Bacteria | 2645 |
| 4 | JGI24737J22298_10013203 | 3300001990 | Bacteria | 2690 |
| 5 | JGI24737J22298_10048619 | 3300001990 | Bacteria | 1291 |
| 6 | JGI24735J21928_10013850 | 3300002067 | Bacteria | 2529 |
| 7 | JGI25162J39368_1000158 | 3300002737 | Bacteria | 74916 |
| 8 | JGI25162J39368_1001346 | 3300002737 | Bacteria | 13624 |
| 9 | JGI25164J39214_1002880 | 3300002772 | Bacteria | 2381 |
| 10 | JGI25152J39213_1000054 | 3300002773 | Bacteria | 76796 |
| 11 | JGI25150J39212_1000003 | 3300002774 | Bacteria | 508651 |
| 12 | JGI25150J39212_1000004 | 3300002774 | Bacteria | 417320 |
| 13 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 14 | JGI25165J46597_1000989 | 3300003214 | Bacteria | 18960 |
| 15 | JGI25153J46596_10000015 | 3300003215 | Bacteria | 289820 |
| 16 | rootH1_10041946 | 3300003316 | Bacteria | 8448 |
| 17 | rootH2_10044553 | 3300003320 | Bacteria | 4167 |
| 18 | rootH2_10076865 | 3300003320 | Bacteria | 4583 |
| 19 | rootH2_10163475 | 3300003320 | Bacteria | 1393 |
| 20 | rootH1_10012646 | 3300003323 | Bacteria | 62371 |
| 21 | rootH1_10061983 | 3300003323 | Bacteria | 4339 |
| 22 | rootH1_10071187 | 3300003323 | Bacteria | 3657 |
| 23 | Ga0055536_1000006 | 3300003781 | Bacteria | 347733 |
| 24 | Ga0055530_10003396 | 3300003791 | Bacteria | 9087 |
| 25 | Ga0065714_10002609 | 3300005288 | Bacteria | 23390 |
| 26 | Ga0065714_10065739 | 3300005288 | Bacteria | 8667 |
| 27 | Ga0065714_10074750 | 3300005288 | Bacteria | 2994 |
| 28 | Ga0065714_10127129 | 3300005288 | Bacteria | 1253 |
| 29 | Ga0065704_10001668 | 3300005289 | Bacteria | 7109 |
| 30 | Ga0065704_10070323 | 3300005289 | Bacteria | 32863 |
| 31 | Ga0070658_10000008 | 3300005327 | Bacteria | 319912 |
| 32 | Ga0070658_10022913 | 3300005327 | Bacteria | 5013 |
| 33 | Ga0070658_10337676 | 3300005327 | Bacteria | 1288 |
| 34 | Ga0068868_100053548 | 3300005338 | Unclassified | 3179 |
| 35 | Ga0068868_100085533 | 3300005338 | Bacteria | 2534 |
| 36 | Ga0070660_100346398 | 3300005339 | Unclassified | 1223 |
| 37 | Ga0070691_10257972 | 3300005341 | Bacteria | 937 |
| 38 | Ga0070673_100025171 | 3300005364 | Bacteria | 4376 |
| 39 | Ga0070659_100001588 | 3300005366 | Bacteria | 16376 |
| 40 | Ga0070659_100001887 | 3300005366 | Bacteria | 14999 |
| 41 | Ga0070659_100139515 | 3300005366 | Bacteria | 1973 |
| 42 | Ga0070678_100054315 | 3300005456 | Unclassified | 2918 |
| 43 | Ga0070662_100000790 | 3300005457 | Bacteria | 19431 |
| 44 | Ga0070681_10006627 | 3300005458 | Bacteria | 11278 |
| 45 | Ga0068867_100045744 | 3300005459 | Bacteria | 3211 |
| 46 | Ga0070679_100002383 | 3300005530 | Bacteria | 17030 |
| 47 | Ga0068853_100006526 | 3300005539 | Bacteria | 9285 |
| 48 | Ga0070672_100194992 | 3300005543 | Bacteria | 1692 |
| 49 | Ga0070665_100000118 | 3300005548 | Bacteria | 149830 |
| 50 | Ga0068855_100000155 | 3300005563 | Bacteria | 86903 |
| 51 | Ga0068855_100002647 | 3300005563 | Bacteria | 22069 |
| 52 | Ga0068855_100007287 | 3300005563 | Bacteria | 13397 |
| 53 | Ga0068855_100010187 | 3300005563 | Bacteria | 11330 |
| 54 | Ga0068855_100080126 | 3300005563 | Bacteria | 3786 |
| 55 | Ga0068855_100129887 | 3300005563 | Bacteria | 2878 |
| 56 | Ga0068855_100324757 | 3300005563 | Unclassified | 1700 |
| 57 | Ga0068857_100012630 | 3300005577 | Bacteria | 7360 |
| 58 | Ga0068856_100082027 | 3300005614 | Bacteria | 3200 |
| 59 | Ga0068852_100002261 | 3300005616 | Bacteria | 13217 |
| 60 | Ga0068852_100265689 | 3300005616 | Unclassified | 1649 |
| 61 | Ga0068858_100399598 | 3300005842 | Bacteria | 1320 |
| 62 | Ga0075366_10002272 | 3300006195 | Bacteria | 9812 |
| 63 | Ga0075366_10247572 | 3300006195 | Bacteria | 1087 |
| 64 | Ga0097621_100000174 | 3300006237 | Bacteria | 40714 |
| 65 | Ga0075370_10128649 | 3300006353 | Unclassified | 1477 |
| 66 | Ga0068871_100000060 | 3300006358 | Bacteria | 59245 |
| 67 | Ga0068865_100000345 | 3300006881 | Bacteria | 25771 |
| 68 | Ga0105244_10033756 | 3300009036 | Bacteria | 2696 |
| 69 | Ga0105244_10089877 | 3300009036 | Bacteria | 1511 |
| 70 | Ga0105240_10000371 | 3300009093 | Bacteria | 84390 |
| 71 | Ga0105240_10004289 | 3300009093 | Bacteria | 21785 |
| 72 | Ga0105240_10017291 | 3300009093 | Bacteria | 9724 |
| 73 | Ga0105240_10027708 | 3300009093 | Bacteria | 7414 |
| 74 | Ga0105240_10062117 | 3300009093 | Bacteria | 4652 |
| 75 | Ga0105240_10069664 | 3300009093 | Bacteria | 4353 |
| 76 | Ga0105240_10138905 | 3300009093 | Bacteria | 2907 |
| 77 | Ga0105240_10220456 | 3300009093 | Bacteria | 2210 |
| 78 | Ga0105240_10281969 | 3300009093 | Bacteria | 1908 |
| 79 | Ga0105240_10450444 | 3300009093 | Unclassified | 1440 |
| 80 | Ga0105243_10008576 | 3300009148 | Bacteria | 7841 |
| 81 | Ga0105241_10003593 | 3300009174 | Bacteria | 11536 |
| 82 | Ga0105241_10004960 | 3300009174 | Bacteria | 9814 |
| 83 | Ga0105241_10015821 | 3300009174 | Bacteria | 5526 |
| 84 | Ga0105241_10110749 | 3300009174 | Bacteria | 2197 |
| 85 | Ga0105241_10191689 | 3300009174 | Bacteria | 1702 |
| 86 | Ga0105242_10501489 | 3300009176 | Bacteria | 1154 |
| 87 | Ga0105237_10002011 | 3300009545 | Bacteria | 25894 |
| 88 | Ga0105237_10002057 | 3300009545 | Bacteria | 25541 |
| 89 | Ga0105237_10002169 | 3300009545 | Bacteria | 24637 |
| 90 | Ga0105237_10003766 | 3300009545 | Bacteria | 17851 |
| 91 | Ga0105237_10004069 | 3300009545 | Bacteria | 17053 |
| 92 | Ga0105237_10599225 | 3300009545 | Bacteria | 1109 |
| 93 | Ga0105237_10674844 | 3300009545 | Unclassified | 1040 |
| 94 | Ga0105238_10059039 | 3300009551 | Bacteria | 3844 |
| 95 | Ga0105238_10091214 | 3300009551 | Bacteria | 3034 |
| 96 | Ga0105238_10773313 | 3300009551 | Bacteria | 975 |
| 97 | Ga0105239_10000166 | 3300010375 | Bacteria | 94743 |
| 98 | Ga0105239_10000278 | 3300010375 | Bacteria | 75485 |
| 99 | Ga0105239_10000865 | 3300010375 | Bacteria | 43041 |
| 100 | Ga0105239_10002482 | 3300010375 | Bacteria | 23507 |
| 101 | Ga0105239_10010943 | 3300010375 | Bacteria | 10133 |
| 102 | Ga0105239_10026667 | 3300010375 | Bacteria | 6360 |
| 103 | Ga0105239_10028716 | 3300010375 | Bacteria | 6116 |
| 104 | Ga0105239_10077373 | 3300010375 | Bacteria | 3661 |
| 105 | Ga0105239_10094945 | 3300010375 | Bacteria | 3294 |
| 106 | Ga0105246_10027502 | 3300011119 | Bacteria | 3727 |
| 107 | Ga0157373_10000262 | 3300013100 | Bacteria | 42799 |
| 108 | Ga0157373_10000678 | 3300013100 | Bacteria | 26681 |
| 109 | Ga0157373_10019649 | 3300013100 | Bacteria | 4914 |
| 110 | Ga0157373_10196989 | 3300013100 | Unclassified | 1420 |
| 111 | Ga0157371_10000107 | 3300013102 | Bacteria | 126477 |
| 112 | Ga0157371_10000117 | 3300013102 | Bacteria | 121069 |
| 113 | Ga0157371_10001520 | 3300013102 | Bacteria | 23949 |
| 114 | Ga0157371_10003549 | 3300013102 | Bacteria | 14071 |
| 115 | Ga0157371_10009852 | 3300013102 | Bacteria | 7487 |
| 116 | Ga0157371_10367716 | 3300013102 | Unclassified | 1049 |
| 117 | Ga0157370_10003772 | 3300013104 | Bacteria | 17695 |
| 118 | Ga0157370_10018299 | 3300013104 | Bacteria | 7047 |
| 119 | Ga0157370_10021228 | 3300013104 | Bacteria | 6473 |
| 120 | Ga0157370_10036382 | 3300013104 | Bacteria | 4777 |
| 121 | Ga0157370_10091862 | 3300013104 | Bacteria | 2849 |
| 122 | Ga0157370_10117441 | 3300013104 | Bacteria | 2485 |
| 123 | Ga0157370_10138605 | 3300013104 | Bacteria | 2267 |
| 124 | Ga0157369_10000047 | 3300013105 | Bacteria | 172682 |
| 125 | Ga0157369_10038399 | 3300013105 | Bacteria | 5236 |
| 126 | Ga0157369_10536572 | 3300013105 | Bacteria | 1210 |
| 127 | Ga0157374_10000301 | 3300013296 | Bacteria | 45768 |
| 128 | Ga0157374_10002065 | 3300013296 | Bacteria | 16892 |
| 129 | Ga0157374_10223794 | 3300013296 | Unclassified | 1847 |
| 130 | Ga0157378_10031756 | 3300013297 | Bacteria | 4665 |
| 131 | Ga0157378_10347233 | 3300013297 | Bacteria | 1449 |
| 132 | Ga0163162_10000012 | 3300013306 | Bacteria | 292674 |
| 133 | Ga0163162_10000895 | 3300013306 | Bacteria | 27750 |
| 134 | Ga0163162_10473650 | 3300013306 | Bacteria | 1384 |
| 135 | Ga0163162_10575559 | 3300013306 | Bacteria | 1253 |
| 136 | Ga0157372_10000238 | 3300013307 | Bacteria | 60988 |
| 137 | Ga0157372_10019063 | 3300013307 | Bacteria | 7386 |
| 138 | Ga0157372_10046042 | 3300013307 | Bacteria | 4841 |
| 139 | Ga0157375_10004936 | 3300013308 | Bacteria | 11601 |
| 140 | Ga0157375_10006259 | 3300013308 | Bacteria | 10369 |
| 141 | Ga0157375_10029791 | 3300013308 | Bacteria | 5138 |
| 142 | Ga0157375_10078439 | 3300013308 | Bacteria | 3336 |
| 143 | Ga0182008_10000132 | 3300014497 | Bacteria | 56231 |
| 144 | Ga0182008_10000294 | 3300014497 | Bacteria | 39204 |
| 145 | Ga0182008_10029039 | 3300014497 | Bacteria | 2795 |
| 146 | Ga0182008_10224664 | 3300014497 | Bacteria | 962 |
| 147 | Ga0157377_10010267 | 3300014745 | Bacteria | 4625 |
| 148 | Ga0182006_1000179 | 3300015261 | Bacteria | 66779 |
| 149 | Ga0182006_1000349 | 3300015261 | Bacteria | 38806 |
| 150 | Ga0182006_1012363 | 3300015261 | Bacteria | 3731 |
| 151 | Ga0182007_10011302 | 3300015262 | Bacteria | 3478 |
| 152 | Ga0182007_10053393 | 3300015262 | Bacteria | 1330 |
| 153 | Ga0163161_10000800 | 3300017792 | Bacteria | 24627 |
| 154 | Ga0163161_10000830 | 3300017792 | Bacteria | 24159 |
| 155 | Ga0163161_10001299 | 3300017792 | Bacteria | 18626 |
| 156 | Ga0163161_10026693 | 3300017792 | Bacteria | 4091 |
| 157 | Ga0163161_10028373 | 3300017792 | Bacteria | 3975 |
| 158 | Ga0163161_10049327 | 3300017792 | Bacteria | 3042 |
| 159 | Ga0209563_118427 | 3300025230 | Unclassified | 820 |
| 160 | Ga0207427_100122 | 3300025231 | Bacteria | 99064 |
| 161 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 162 | Ga0209437_100280 | 3300025233 | Bacteria | 74968 |
| 163 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 164 | Ga0209026_1000852 | 3300025250 | Bacteria | 15983 |
| 165 | Ga0209026_1009890 | 3300025250 | Bacteria | 1826 |
| 166 | Ga0209129_1000014 | 3300025258 | Bacteria | 509018 |
| 167 | Ga0209129_1006753 | 3300025258 | Bacteria | 3612 |
| 168 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 169 | Ga0209233_1002773 | 3300025261 | Bacteria | 6299 |
| 170 | Ga0209233_1007433 | 3300025261 | Bacteria | 3473 |
| 171 | Ga0209455_1004572 | 3300025272 | Bacteria | 4489 |
| 172 | Ga0209676_1000039 | 3300025292 | Bacteria | 443158 |
| 173 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 174 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 175 | Ga0209050_1000033 | 3300025298 | Bacteria | 442615 |
| 176 | Ga0207655_1098021 | 3300025728 | Bacteria | 1016 |
| 177 | Ga0207647_10000071 | 3300025904 | Bacteria | 79170 |
| 178 | Ga0207645_10000229 | 3300025907 | Bacteria | 46502 |
| 179 | Ga0207705_10000026 | 3300025909 | Bacteria | 256051 |
| 180 | Ga0207705_10033906 | 3300025909 | Bacteria | 3648 |
| 181 | Ga0207705_10327940 | 3300025909 | Bacteria | 1177 |
| 182 | Ga0207654_10001012 | 3300025911 | Bacteria | 15381 |
| 183 | Ga0207654_10008957 | 3300025911 | Bacteria | 5077 |
| 184 | Ga0207707_10025235 | 3300025912 | Bacteria | 5199 |
| 185 | Ga0207695_10000142 | 3300025913 | Bacteria | 214715 |
| 186 | Ga0207695_10013341 | 3300025913 | Bacteria | 9806 |
| 187 | Ga0207695_10014435 | 3300025913 | Bacteria | 9358 |
| 188 | Ga0207695_10017626 | 3300025913 | Bacteria | 8299 |
| 189 | Ga0207695_10067185 | 3300025913 | Bacteria | 3678 |
| 190 | Ga0207695_10094760 | 3300025913 | Bacteria | 2991 |
| 191 | Ga0207695_10273080 | 3300025913 | Bacteria | 1586 |
| 192 | Ga0207695_10402995 | 3300025913 | Bacteria | 1252 |
| 193 | Ga0207671_10000110 | 3300025914 | Bacteria | 126480 |
| 194 | Ga0207671_10001334 | 3300025914 | Bacteria | 28837 |
| 195 | Ga0207671_10010547 | 3300025914 | Bacteria | 7608 |
| 196 | Ga0207671_10014241 | 3300025914 | Bacteria | 6294 |
| 197 | Ga0207671_10040706 | 3300025914 | Bacteria | 3439 |
| 198 | Ga0207660_10087296 | 3300025917 | Bacteria | 2305 |
| 199 | Ga0207657_10023346 | 3300025919 | Bacteria | 5761 |
| 200 | Ga0207657_10311403 | 3300025919 | Unclassified | 1246 |
| 201 | Ga0207652_10008028 | 3300025921 | Bacteria | 8469 |
| 202 | Ga0207694_10021244 | 3300025924 | Bacteria | 4917 |
| 203 | Ga0207694_10058698 | 3300025924 | Bacteria | 2993 |
| 204 | Ga0207644_10066744 | 3300025931 | Bacteria | 2620 |
| 205 | Ga0207690_10004024 | 3300025932 | Bacteria | 8680 |
| 206 | Ga0207690_10008902 | 3300025932 | Bacteria | 5959 |
| 207 | Ga0207706_10001203 | 3300025933 | Bacteria | 26147 |
| 208 | Ga0207686_10323012 | 3300025934 | Bacteria | 1154 |
| 209 | Ga0207704_10000047 | 3300025938 | Bacteria | 84386 |
| 210 | Ga0207691_10159830 | 3300025940 | Bacteria | 1977 |
| 211 | Ga0207667_10000015 | 3300025949 | Bacteria | 417534 |
| 212 | Ga0207667_10000953 | 3300025949 | Bacteria | 36919 |
| 213 | Ga0207667_10025051 | 3300025949 | Bacteria | 6540 |
| 214 | Ga0207667_10038089 | 3300025949 | Bacteria | 5137 |
| 215 | Ga0207667_10070286 | 3300025949 | Bacteria | 3644 |
| 216 | Ga0207667_10168451 | 3300025949 | Bacteria | 2252 |
| 217 | Ga0207667_10554387 | 3300025949 | Bacteria | 1162 |
| 218 | Ga0207677_10107092 | 3300026023 | Bacteria | 2073 |
| 219 | Ga0207703_10228243 | 3300026035 | Bacteria | 1668 |
| 220 | Ga0207639_10005859 | 3300026041 | Bacteria | 8324 |
| 221 | Ga0207702_10144506 | 3300026078 | Bacteria | 2157 |
| 222 | Ga0207648_10001813 | 3300026089 | Bacteria | 23430 |
| 223 | Ga0207674_10091574 | 3300026116 | Bacteria | 3030 |
| 224 | Ga0207683_10001294 | 3300026121 | Bacteria | 22621 |
| 225 | Ga0207698_10042241 | 3300026142 | Bacteria | 3404 |
| 226 | Ga0207698_10406950 | 3300026142 | Unclassified | 1302 |
| 227 | Ga0268266_10000121 | 3300028379 | Bacteria | 154995 |
| 228 | Ga0307517_10000198 | 3300028786 | Bacteria | 102181 |
| 229 | Ga0265338_10020641 | 3300028800 | Bacteria | 6918 |
| 230 | Ga0265338_10236657 | 3300028800 | Unclassified | 1355 |
| 231 | Ga0307408_100000464 | 3300031548 | Bacteria | 35518 |
| 232 | Ga0307405_10000009 | 3300031731 | Bacteria | 259388 |
| 233 | Ga0307412_10000050 | 3300031911 | Bacteria | 151527 |
| 234 | Ga0307412_10363650 | 3300031911 | Bacteria | 1166 |
| 235 | Ga0307414_10000344 | 3300032004 | Bacteria | 26282 |
| 236 | Ga0307414_10003900 | 3300032004 | Bacteria | 8034 |
| 237 | Ga0307414_10035597 | 3300032004 | Bacteria | 3315 |
| 238 | Ga0307414_10208467 | 3300032004 | Bacteria | 1595 |
| 239 | Ga0307414_10379010 | 3300032004 | Bacteria | 1222 |
| 240 | Ga0307411_10567536 | 3300032005 | Bacteria | 971 |
| 241 | Ga0307510_10010234 | 3300033180 | Bacteria | 11150 |
| 242 | Ga0395899_0000027 | 3300037312 | Bacteria | 337387 |
| 243 | Ga0395899_0014872 | 3300037312 | Bacteria | 5939 |
| 244 | Ga0395900_0000140 | 3300037418 | Bacteria | 121917 |
| 245 | Ga0395900_0000275 | 3300037418 | Bacteria | 78207 |
| 246 | Ga0395900_0028740 | 3300037418 | Bacteria | 5700 |
| 247 | Ga0395900_0205832 | 3300037418 | Bacteria | 1989 |
| 248 | Ga0395898_0001454 | 3300037466 | Bacteria | 33553 |
| 249 | Ga0395898_0074989 | 3300037466 | Bacteria | 3268 |
| 250 | Ga0395905_0000248 | 3300037471 | Bacteria | 81042 |
| 251 | Ga0395905_0009775 | 3300037471 | Bacteria | 9353 |
| 252 | Ga0395901_0000145 | 3300038443 | Bacteria | 91739 |
| 253 | Ga0395901_0003259 | 3300038443 | Bacteria | 16332 |
| 254 | Ga0395901_0066168 | 3300038443 | Bacteria | 3765 |
| 255 | Ga0451837_1327160 | 3300041494 | Bacteria | 950 |
| 256 | Ga0439448_0005766 | 3300042005 | Bacteria | 3537 |
| 257 | Ga0466966_0071647 | 3300044684 | Bacteria | 2171 |
| 258 | Ga0495627_020454 | 3300046453 | Bacteria | 2205 |
| 259 | Ga0495651_0059768 | 3300046462 | Bacteria | 2922 |
| 260 | Ga0495605_0195103 | 3300046474 | Bacteria | 884 |
| 261 | Ga0495596_0013880 | 3300046500 | Bacteria | 3403 |
| 262 | Ga0495607_0151610 | 3300046501 | Bacteria | 1186 |
| 263 | Ga0495606_0081978 | 3300046507 | Bacteria | 2004 |
| 264 | Ga0495610_0000076 | 3300046512 | Bacteria | 118246 |
| 265 | Ga0495610_0000696 | 3300046512 | Bacteria | 32341 |
| 266 | Ga0495610_0046314 | 3300046512 | Bacteria | 2146 |
| 267 | Ga0495637_0005787 | 3300046520 | Bacteria | 6262 |
| 268 | Ga0495648_0248561 | 3300046524 | Bacteria | 860 |
| 269 | Ga0495609_0007600 | 3300046538 | Bacteria | 5388 |
| 270 | Ga0495625_0019056 | 3300046660 | Bacteria | 5339 |
| 271 | Ga0495661_0003969 | 3300046665 | Bacteria | 10802 |
| 272 | Ga0495661_0018080 | 3300046665 | Bacteria | 4642 |
| 273 | Ga0495669_0074091 | 3300046684 | Bacteria | 1556 |
| 274 | Ga0495683_0054777 | 3300047323 | Bacteria | 1987 |
| 275 | Ga0495687_002555 | 3300047443 | Bacteria | 14392 |
| 276 | Ga0495686_0000785 | 3300047472 | Bacteria | 41504 |
| 277 | Ga0495686_0001903 | 3300047472 | Bacteria | 20836 |
| 278 | Ga0495686_0096808 | 3300047472 | Bacteria | 1785 |
| 279 | Ga0495686_0293654 | 3300047472 | Unclassified | 899 |
| 280 | Ga0496121_0000007 | 3300048924 | Bacteria | 942516 |
| 281 | Ga0496122_0004298 | 3300048925 | Bacteria | 17852 |
| 282 | Ga0496123_0005429 | 3300048926 | Bacteria | 12835 |
| 283 | Ga0496125_0028448 | 3300048928 | Bacteria | 5048 |
| 284 | Ga0501240_002808 | 3300049673 | Bacteria | 1880 |
| 285 | Ga0501241_001867 | 3300049758 | Bacteria | 4146 |
| 286 | Ga0501280_002435 | 3300049776 | Bacteria | 3106 |
| 287 | nmdc:mga0k408_1125_c1 | 3300050493 | Bacteria | 14653 |
| 288 | nmdc:mga0k408_194394_c1 | 3300050493 | Bacteria | 1211 |
| 289 | nmdc:mga07m45_180693_c1 | 3300050496 | Unclassified | 1227 |
| 290 | nmdc:mga07m45_18614_c1 | 3300050496 | Bacteria | 3753 |
| 291 | Ga0500635_0171207 | 3300053080 | Bacteria | 836 |
| 292 | Ga0500651_0000350 | 3300053093 | Bacteria | 25883 |
| 293 | Ga0500608_001457 | 3300053122 | Bacteria | 8457 |
| 294 | Ga0500618_000005 | 3300053125 | Bacteria | 253092 |
| 295 | Ga0500622_0000860 | 3300053156 | Bacteria | 25927 |
| 296 | 2586208797 | 2585427687 | Bacteria | 5544917 |
| 297 | 2738759094 | 2738541283 | Bacteria | 7222293 |
| 298 | 2738761796 | 2738541284 | Bacteria | 5199923 |
| 299 | 2738854854 | 2738541302 | Bacteria | 5944758 |
| 300 | 2739587031 | 2739367651 | Bacteria | 6359826 |
| 301 | 2739618221 | 2739367656 | Bacteria | 5152243 |
| 302 | 2739646328 | 2739367663 | Bacteria | 5040914 |
| 303 | 2776615558 | 2775506987 | Bacteria | 5373360 |
| 304 | 2819547484 | 2818991437 | Bacteria | 5805520 |
| 305 | 2842727523 | 2842722452 | Bacteria | 6263924 |
| 306 | 2842911268 | 2842909656 | Bacteria | 6185908 |
| 307 | 2849286478 | 2849281842 | Bacteria | 6065644 |
| 308 | 2852626484 | 2852623160 | Bacteria | 4376875 |
| 309 | 2857631489 | 2857627736 | Bacteria | 5625397 |
| 310 | 2884934911 | 2884933994 | Bacteria | 4535041 |
| 311 | 2895501526 | 2895498888 | Bacteria | 5283788 |
| 312 | 2902051304 | 2902048731 | Bacteria | 4976191 |
| 313 | 2904448913 | 2904445276 | Bacteria | 5310396 |
| 314 | 2919190748 | 2919186247 | Bacteria | 6244071 |
| 315 | 2919437911 | 2919437846 | Bacteria | 6199444 |
| 316 | 2939669042 | 2939664404 | Bacteria | 6364494 |
| 317 | 2946003193 | 2945997725 | Bacteria | 6404843 |
| 318 | Ga0307414_10008697 | |||
| 319 | SwRhRL2b_contig_2665874 | |||
| 320 | JGI24736J21556_1003689 | |||
| 321 | JGI24737J22298_10013203 | |||
| 322 | JGI24737J22298_10048619 | |||
| 323 | JGI24735J21928_10013850 | |||
| 324 | JGI25162J39368_1000158 | |||
| 325 | JGI25162J39368_1001346 | |||
| 326 | JGI25164J39214_1002880 | |||
| 327 | JGI25152J39213_1000054 | |||
| 328 | JGI25150J39212_1000003 | |||
| 329 | JGI25150J39212_1000004 | |||
| 330 | JGI25151J46595_10000002 | |||
| 331 | JGI25165J46597_1000989 | |||
| 332 | JGI25153J46596_10000015 | |||
| 333 | rootH1_10041946 | |||
| 334 | rootH2_10044553 | |||
| 335 | rootH2_10076865 | |||
| 336 | rootH2_10163475 | |||
| 337 | rootH1_10012646 | |||
| 338 | rootH1_10061983 | |||
| 339 | rootH1_10071187 | |||
| 340 | Ga0055536_1000006 | |||
| 341 | Ga0055530_10003396 | |||
| 342 | Ga0065714_10002609 | |||
| 343 | Ga0065714_10065739 | |||
| 344 | Ga0065714_10074750 | |||
| 345 | Ga0065714_10127129 | |||
| 346 | Ga0065704_10001668 | |||
| 347 | Ga0065704_10070323 | |||
| 348 | Ga0070658_10000008 | |||
| 349 | Ga0070658_10022913 | |||
| 350 | Ga0070658_10337676 | |||
| 351 | Ga0068868_100053548 | |||
| 352 | Ga0068868_100085533 | |||
| 353 | Ga0070660_100346398 | |||
| 354 | Ga0070691_10257972 | |||
| 355 | Ga0070673_100025171 | |||
| 356 | Ga0070659_100001588 | |||
| 357 | Ga0070659_100001887 | |||
| 358 | Ga0070659_100139515 | |||
| 359 | Ga0070678_100054315 | |||
| 360 | Ga0070662_100000790 | |||
| 361 | Ga0070681_10006627 | |||
| 362 | Ga0068867_100045744 | |||
| 363 | Ga0070679_100002383 | |||
| 364 | Ga0068853_100006526 | |||
| 365 | Ga0070672_100194992 | |||
| 366 | Ga0070665_100000118 | |||
| 367 | Ga0068855_100000155 | |||
| 368 | Ga0068855_100002647 | |||
| 369 | Ga0068855_100007287 | |||
| 370 | Ga0068855_100010187 | |||
| 371 | Ga0068855_100080126 | |||
| 372 | Ga0068855_100129887 | |||
| 373 | Ga0068855_100324757 | |||
| 374 | Ga0068857_100012630 | |||
| 375 | Ga0068856_100082027 | |||
| 376 | Ga0068852_100002261 | |||
| 377 | Ga0068852_100265689 | |||
| 378 | Ga0068858_100399598 | |||
| 379 | Ga0075366_10002272 | |||
| 380 | Ga0075366_10247572 | |||
| 381 | Ga0097621_100000174 | |||
| 382 | Ga0075370_10128649 | |||
| 383 | Ga0068871_100000060 | |||
| 384 | Ga0068865_100000345 | |||
| 385 | Ga0105244_10033756 | |||
| 386 | Ga0105244_10089877 | |||
| 387 | Ga0105240_10000371 | |||
| 388 | Ga0105240_10004289 | |||
| 389 | Ga0105240_10017291 | |||
| 390 | Ga0105240_10027708 | |||
| 391 | Ga0105240_10062117 | |||
| 392 | Ga0105240_10069664 | |||
| 393 | Ga0105240_10138905 | |||
| 394 | Ga0105240_10220456 | |||
| 395 | Ga0105240_10281969 | |||
| 396 | Ga0105240_10450444 | |||
| 397 | Ga0105243_10008576 | |||
| 398 | Ga0105241_10003593 | |||
| 399 | Ga0105241_10004960 | |||
| 400 | Ga0105241_10015821 | |||
| 401 | Ga0105241_10110749 | |||
| 402 | Ga0105241_10191689 | |||
| 403 | Ga0105242_10501489 | |||
| 404 | Ga0105237_10002011 | |||
| 405 | Ga0105237_10002057 | |||
| 406 | Ga0105237_10002169 | |||
| 407 | Ga0105237_10003766 | |||
| 408 | Ga0105237_10004069 | |||
| 409 | Ga0105237_10599225 | |||
| 410 | Ga0105237_10674844 | |||
| 411 | Ga0105238_10059039 | |||
| 412 | Ga0105238_10091214 | |||
| 413 | Ga0105238_10773313 | |||
| 414 | Ga0105239_10000166 | |||
| 415 | Ga0105239_10000278 | |||
| 416 | Ga0105239_10000865 | |||
| 417 | Ga0105239_10002482 | |||
| 418 | Ga0105239_10010943 | |||
| 419 | Ga0105239_10026667 | |||
| 420 | Ga0105239_10028716 | |||
| 421 | Ga0105239_10077373 | |||
| 422 | Ga0105239_10094945 | |||
| 423 | Ga0105246_10027502 | |||
| 424 | Ga0157373_10000262 | |||
| 425 | Ga0157373_10000678 | |||
| 426 | Ga0157373_10019649 | |||
| 427 | Ga0157373_10196989 | |||
| 428 | Ga0157371_10000107 | |||
| 429 | Ga0157371_10000117 | |||
| 430 | Ga0157371_10001520 | |||
| 431 | Ga0157371_10003549 | |||
| 432 | Ga0157371_10009852 | |||
| 433 | Ga0157371_10367716 | |||
| 434 | Ga0157370_10003772 | |||
| 435 | Ga0157370_10018299 | |||
| 436 | Ga0157370_10021228 | |||
| 437 | Ga0157370_10036382 | |||
| 438 | Ga0157370_10091862 | |||
| 439 | Ga0157370_10117441 | |||
| 440 | Ga0157370_10138605 | |||
| 441 | Ga0157369_10000047 | |||
| 442 | Ga0157369_10038399 | |||
| 443 | Ga0157369_10536572 | |||
| 444 | Ga0157374_10000301 | |||
| 445 | Ga0157374_10002065 | |||
| 446 | Ga0157374_10223794 | |||
| 447 | Ga0157378_10031756 | |||
| 448 | Ga0157378_10347233 | |||
| 449 | Ga0163162_10000012 | |||
| 450 | Ga0163162_10000895 | |||
| 451 | Ga0163162_10473650 | |||
| 452 | Ga0163162_10575559 | |||
| 453 | Ga0157372_10000238 | |||
| 454 | Ga0157372_10019063 | |||
| 455 | Ga0157372_10046042 | |||
| 456 | Ga0157375_10004936 | |||
| 457 | Ga0157375_10006259 | |||
| 458 | Ga0157375_10029791 | |||
| 459 | Ga0157375_10078439 | |||
| 460 | Ga0182008_10000132 | |||
| 461 | Ga0182008_10000294 | |||
| 462 | Ga0182008_10029039 | |||
| 463 | Ga0182008_10224664 | |||
| 464 | Ga0157377_10010267 | |||
| 465 | Ga0182006_1000179 | |||
| 466 | Ga0182006_1000349 | |||
| 467 | Ga0182006_1012363 | |||
| 468 | Ga0182007_10011302 | |||
| 469 | Ga0182007_10053393 | |||
| 470 | Ga0163161_10000800 | |||
| 471 | Ga0163161_10000830 | |||
| 472 | Ga0163161_10001299 | |||
| 473 | Ga0163161_10026693 | |||
| 474 | Ga0163161_10028373 | |||
| 475 | Ga0163161_10049327 | |||
| 476 | Ga0209563_118427 | |||
| 477 | Ga0207427_100122 | |||
| 478 | Ga0209437_100048 | |||
| 479 | Ga0209437_100280 | |||
| 480 | Ga0207425_1000003 | |||
| 481 | Ga0209026_1000852 | |||
| 482 | Ga0209026_1009890 | |||
| 483 | Ga0209129_1000014 | |||
| 484 | Ga0209129_1006753 | |||
| 485 | Ga0209233_1000029 | |||
| 486 | Ga0209233_1002773 | |||
| 487 | Ga0209233_1007433 | |||
| 488 | Ga0209455_1004572 | |||
| 489 | Ga0209676_1000039 | |||
| 490 | Ga0209025_1000007 | |||
| 491 | Ga0209758_1000012 | |||
| 492 | Ga0209050_1000033 | |||
| 493 | Ga0207655_1098021 | |||
| 494 | Ga0207647_10000071 | |||
| 495 | Ga0207645_10000229 | |||
| 496 | Ga0207705_10000026 | |||
| 497 | Ga0207705_10033906 | |||
| 498 | Ga0207705_10327940 | |||
| 499 | Ga0207654_10001012 | |||
| 500 | Ga0207654_10008957 | |||
| 501 | Ga0207707_10025235 | |||
| 502 | Ga0207695_10000142 | |||
| 503 | Ga0207695_10013341 | |||
| 504 | Ga0207695_10014435 | |||
| 505 | Ga0207695_10017626 | |||
| 506 | Ga0207695_10067185 | |||
| 507 | Ga0207695_10094760 | |||
| 508 | Ga0207695_10273080 | |||
| 509 | Ga0207695_10402995 | |||
| 510 | Ga0207671_10000110 | |||
| 511 | Ga0207671_10001334 | |||
| 512 | Ga0207671_10010547 | |||
| 513 | Ga0207671_10014241 | |||
| 514 | Ga0207671_10040706 | |||
| 515 | Ga0207660_10087296 | |||
| 516 | Ga0207657_10023346 | |||
| 517 | Ga0207657_10311403 | |||
| 518 | Ga0207652_10008028 | |||
| 519 | Ga0207694_10021244 | |||
| 520 | Ga0207694_10058698 | |||
| 521 | Ga0207644_10066744 | |||
| 522 | Ga0207690_10004024 | |||
| 523 | Ga0207690_10008902 | |||
| 524 | Ga0207706_10001203 | |||
| 525 | Ga0207686_10323012 | |||
| 526 | Ga0207704_10000047 | |||
| 527 | Ga0207691_10159830 | |||
| 528 | Ga0207667_10000015 | |||
| 529 | Ga0207667_10000953 | |||
| 530 | Ga0207667_10025051 | |||
| 531 | Ga0207667_10038089 | |||
| 532 | Ga0207667_10070286 | |||
| 533 | Ga0207667_10168451 | |||
| 534 | Ga0207667_10554387 | |||
| 535 | Ga0207677_10107092 | |||
| 536 | Ga0207703_10228243 | |||
| 537 | Ga0207639_10005859 | |||
| 538 | Ga0207702_10144506 | |||
| 539 | Ga0207648_10001813 | |||
| 540 | Ga0207674_10091574 | |||
| 541 | Ga0207683_10001294 | |||
| 542 | Ga0207698_10042241 | |||
| 543 | Ga0207698_10406950 | |||
| 544 | Ga0268266_10000121 | |||
| 545 | Ga0307517_10000198 | |||
| 546 | Ga0265338_10020641 | |||
| 547 | Ga0265338_10236657 | |||
| 548 | Ga0307408_100000464 | |||
| 549 | Ga0307405_10000009 | |||
| 550 | Ga0307412_10000050 | |||
| 551 | Ga0307412_10363650 | |||
| 552 | Ga0307414_10000344 | |||
| 553 | Ga0307414_10003900 | |||
| 554 | Ga0307414_10035597 | |||
| 555 | Ga0307414_10208467 | |||
| 556 | Ga0307414_10379010 | |||
| 557 | Ga0307411_10567536 | |||
| 558 | Ga0307510_10010234 | |||
| 559 | Ga0395899_0000027 | |||
| 560 | Ga0395899_0014872 | |||
| 561 | Ga0395900_0000140 | |||
| 562 | Ga0395900_0000275 | |||
| 563 | Ga0395900_0028740 | |||
| 564 | Ga0395900_0205832 | |||
| 565 | Ga0395898_0001454 | |||
| 566 | Ga0395898_0074989 | |||
| 567 | Ga0395905_0000248 | |||
| 568 | Ga0395905_0009775 | |||
| 569 | Ga0395901_0000145 | |||
| 570 | Ga0395901_0003259 | |||
| 571 | Ga0395901_0066168 | |||
| 572 | Ga0451837_1327160 | |||
| 573 | Ga0439448_0005766 | |||
| 574 | Ga0466966_0071647 | |||
| 575 | Ga0495627_020454 | |||
| 576 | Ga0495651_0059768 | |||
| 577 | Ga0495605_0195103 | |||
| 578 | Ga0495596_0013880 | |||
| 579 | Ga0495607_0151610 | |||
| 580 | Ga0495606_0081978 | |||
| 581 | Ga0495610_0000076 | |||
| 582 | Ga0495610_0000696 | |||
| 583 | Ga0495610_0046314 | |||
| 584 | Ga0495637_0005787 | |||
| 585 | Ga0495648_0248561 | |||
| 586 | Ga0495609_0007600 | |||
| 587 | Ga0495625_0019056 | |||
| 588 | Ga0495661_0003969 | |||
| 589 | Ga0495661_0018080 | |||
| 590 | Ga0495669_0074091 | |||
| 591 | Ga0495683_0054777 | |||
| 592 | Ga0495687_002555 | |||
| 593 | Ga0495686_0000785 | |||
| 594 | Ga0495686_0001903 | |||
| 595 | Ga0495686_0096808 | |||
| 596 | Ga0495686_0293654 | |||
| 597 | Ga0496121_0000007 | |||
| 598 | Ga0496122_0004298 | |||
| 599 | Ga0496123_0005429 | |||
| 600 | Ga0496125_0028448 | |||
| 601 | Ga0501240_002808 | |||
| 602 | Ga0501241_001867 | |||
| 603 | Ga0501280_002435 | |||
| 604 | nmdc:mga0k408_1125_c1 | |||
| 605 | nmdc:mga0k408_194394_c1 | |||
| 606 | nmdc:mga07m45_180693_c1 | |||
| 607 | nmdc:mga07m45_18614_c1 | |||
| 608 | Ga0500635_0171207 | |||
| 609 | Ga0500651_0000350 | |||
| 610 | Ga0500608_001457 | |||
| 611 | Ga0500618_000005 | |||
| 612 | Ga0500622_0000860 | |||
| 613 | 2586208797 | |||
| 614 | 2738759094 | |||
| 615 | 2738761796 | |||
| 616 | 2738854854 | |||
| 617 | 2739587031 | |||
| 618 | 2739618221 | |||
| 619 | 2739646328 | |||
| 620 | 2776615558 | |||
| 621 | 2819547484 | |||
| 622 | 2842727523 | |||
| 623 | 2842911268 | |||
| 624 | 2849286478 | |||
| 625 | 2852626484 | |||
| 626 | 2857631489 | |||
| 627 | 2884934911 | |||
| 628 | 2895501526 | |||
| 629 | 2902051304 | |||
| 630 | 2904448913 | |||
| 631 | 2919190748 | |||
| 632 | 2919437911 | |||
| 633 | 2939669042 | |||
| 634 | 2946003193 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kym-assembly2.cif.gz_B | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.8338 | 1 | 243 |
| 5kym-assembly1.cif.gz_A | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.8325 | 1 | 243 |
| 5kym-assembly2.cif.gz_B | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.8145 | 1 | 243 |
| 5kym-assembly1.cif.gz_A | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.8044 | 1 | 243 |
| 8e50-assembly1.cif.gz_A | cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa | 0.5635 | 20 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6YDI9_312_439_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8762 | 74 | 189 | 3.40.50.620 |
| af_A0A0R0I9W2_89_248_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8732 | 10 | 56 | 1.20.1250.20 |
| af_Q9VYJ4_80_210_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8709 | 73 | 189 | 3.40.50.620 |
| af_Q93841_73_201_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8697 | 73 | 189 | 3.40.50.620 |
| af_Q54EU4_95_228_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8691 | 68 | 189 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T5J8E1-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9889 | 1 | 244 |
GO:0003841
GO:0006654 GO:0016020 |
| AF-A0A2T5J8E1-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9849 | 1 | 244 |
GO:0003841
GO:0006654 GO:0016020 |
| AF-A0A4Q3H179-F1-model_v4 | deleted | 0.9821 | 28 | 247 |
|
| AF-A0A6M1NI86-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9812 | 1 | 241 |
GO:0003841
GO:0006654 GO:0016020 |
| AF-U2HH60-F1-model_v4 | Phospholipid/glycerol acyltransferase domain-containing protein | 0.9795 | 1 | 241 |
GO:0003841
GO:0006654 GO:0016020 |