F404273

General Info

Members Datasets Scaffolds Average Seq Length
317 205 634 645

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0001207|Ga0451577_0001207_27958_29955
Length 656
Sequence MASTLSLILLYLVAAVAGVVLCRSLKLPPMLGYLVVGVLIGPNALALAKDSTAVRVLAEFGVVFLMFVIGLEFNLPKLRSMRTMVFGLGLSQVALTILGAVAGNVLLALGFAWIGVQWDLDWQGAVVLGSAMAMSSTAIVVKMMAERLELESEHGRRVMGVLLFQDLAVVPLLVLIPALDSSGSDMIRSLGLALVKAIGVLALXXXGGQKLMRWWLTLVARRKSDELFVLNLLLVTLGLAWLTEHAGLSLALGAFVAGMLIAETEYKHQVETDIRPFHDVLLGLFFITIGMKLDWRAVWGEWPLVLLLTLVPVAAKAALVAGLARAFRAAPGVALRTGLYLAQAGEFGFVLLTLGAENKLIHPQWVSPVLASMVLSMLATPLLIEYSNRIVMRLAASDWLMQSVALTAIAKKAIRTERHIIICGFGRSGQNLARLLEQEHMPYMALDLDPDRVRQAAAAGQSVVFGDAARLQSLMAAGLARASAVVISYPDTPSALKILDLVRQHAPQVPVVVRTIDDADLERLREAGAAEVVPEAVEGSLMLASHALALVGVPMRRVIRYRLLRGYFHGADDDTVEELNQARLLSVSLPHTAASIGSTLGELALHALDVNVVSVRRLDGRPATPHDELRLAGGDTLVLAGLPETLALAESKLLTG

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
68 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
122 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
123 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
145 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
146 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
147 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
148 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
149 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
177 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
182 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
183 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
189 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
191 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
192 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
193 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
194 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
195 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
196 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
197 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
198 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
199 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
200 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
201 2643221660 Methylibium sp. Root1272 Isolate Unclassified
202 2738541337 Pelomonas sp. BT06 Isolate Unclassified
203 2831864461 Roseateles noduli HZ7 Isolate Nodule
204 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
205 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 0
Isolates 4.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.82
Nodule 1.58
Rhizoplane 2.84
Rhizosphere 63.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0001207 3300042876 Bacteria 36165
2 JGI25152J39213_1001209 3300002773 Bacteria 11840
3 JGI25153J46596_10004156 3300003215 Bacteria 7862
4 JGI25153J46596_10004893 3300003215 Bacteria 7120
5 rootH1_10010554 3300003316 Bacteria 5937
6 rootH2_10036922 3300003320 Bacteria 6136
7 rootL2_10002498 3300003322 Bacteria 21284
8 JGI26128J50194_1000064 3300003347 Bacteria 3803
9 Ga0055526_1001358 3300003771 Bacteria 17500
10 Ga0055526_1003640 3300003771 Bacteria 9652
11 Ga0055524_1000767 3300003775 Bacteria 21616
12 Ga0055524_1004842 3300003775 Bacteria 6132
13 Ga0055530_10002059 3300003791 Bacteria 13520
14 Ga0055540_1000093 3300003792 Bacteria 98452
15 Ga0055540_1001500 3300003792 Bacteria 13871
16 Ga0055540_1001920 3300003792 Bacteria 11616
17 Ga0055531_10000381 3300003794 Bacteria 42797
18 Ga0055531_10000519 3300003794 Bacteria 34728
19 Ga0055531_10002435 3300003794 Bacteria 12458
20 Ga0055531_10015092 3300003794 Bacteria 3429
21 Ga0065165_1000304 3300005262 Bacteria 81791
22 Ga0065165_1000757 3300005262 Bacteria 43947
23 Ga0065165_1002631 3300005262 Bacteria 14600
24 Ga0070676_10001764 3300005328 Bacteria 11005
25 Ga0070690_100009814 3300005330 Bacteria 5556
26 Ga0070690_100014100 3300005330 Bacteria 4737
27 Ga0070677_10019849 3300005333 Bacteria 2441
28 Ga0068869_100006725 3300005334 Bacteria 7306
29 Ga0068868_100001433 3300005338 Bacteria 16455
30 Ga0068868_100056975 3300005338 Bacteria 3087
31 Ga0070661_100015155 3300005344 Bacteria 5439
32 Ga0070668_100074089 3300005347 Bacteria 2655
33 Ga0070669_100006667 3300005353 Bacteria 8314
34 Ga0070675_100003315 3300005354 Bacteria 12210
35 Ga0070675_100005579 3300005354 Bacteria 9635
36 Ga0070671_100008293 3300005355 Bacteria 8313
37 Ga0070671_100046334 3300005355 Bacteria 3616
38 Ga0070674_100004102 3300005356 Bacteria 8277
39 Ga0070674_100038562 3300005356 Bacteria 3220
40 Ga0070673_100004055 3300005364 Bacteria 9225
41 Ga0070673_100022956 3300005364 Bacteria 4552
42 Ga0070659_100018492 3300005366 Bacteria 5258
43 Ga0070659_100046600 3300005366 Bacteria 3398
44 Ga0070667_100022153 3300005367 Bacteria 5271
45 Ga0070663_100000964 3300005455 Bacteria 15641
46 Ga0070678_100002517 3300005456 Bacteria 10055
47 Ga0070678_100060412 3300005456 Bacteria 2790
48 Ga0070678_100081533 3300005456 Bacteria 2453
49 Ga0070662_100073557 3300005457 Bacteria 2525
50 Ga0068867_100000004 3300005459 Bacteria 180739
51 Ga0068867_100003698 3300005459 Bacteria 10761
52 Ga0068867_100011554 3300005459 Bacteria 6233
53 Ga0070706_100004299 3300005467 Bacteria 13799
54 Ga0070698_100052058 3300005471 Bacteria 4168
55 Ga0070679_100006893 3300005530 Bacteria 10595
56 Ga0070672_100010971 3300005543 Bacteria 6305
57 Ga0070693_100026423 3300005547 Bacteria 3134
58 Ga0068856_100008539 3300005614 Bacteria 9955
59 Ga0068856_100017593 3300005614 Bacteria 6927
60 Ga0070702_100002781 3300005615 Bacteria 7671
61 Ga0068852_100012535 3300005616 Bacteria 6441
62 Ga0068859_100016053 3300005617 Bacteria 7524
63 Ga0068864_100001208 3300005618 Bacteria 21454
64 Ga0068864_100002757 3300005618 Bacteria 14488
65 Ga0068864_100009046 3300005618 Bacteria 8209
66 Ga0068864_100013477 3300005618 Bacteria 6778
67 Ga0068861_100023628 3300005719 Bacteria 4436
68 Ga0068863_100002785 3300005841 Bacteria 17318
69 Ga0068858_100001797 3300005842 Bacteria 21879
70 Ga0068858_100018840 3300005842 Bacteria 6460
71 Ga0068858_100025782 3300005842 Bacteria 5468
72 Ga0068860_100004827 3300005843 Bacteria 13727
73 Ga0068862_100015253 3300005844 Bacteria 6381
74 Ga0068862_100042321 3300005844 Bacteria 3880
75 Ga0075365_10009510 3300006038 Bacteria 5594
76 Ga0075367_10016014 3300006178 Bacteria 4088
77 Ga0075367_10032723 3300006178 Bacteria 2994
78 Ga0075366_10006106 3300006195 Bacteria 6567
79 Ga0075366_10023425 3300006195 Bacteria 3596
80 Ga0097621_100011919 3300006237 Bacteria 6430
81 Ga0075370_10006993 3300006353 Bacteria 5718
82 Ga0068871_100070815 3300006358 Bacteria 2866
83 Ga0075429_100003990 3300006880 Bacteria 12633
84 Ga0068865_100036742 3300006881 Bacteria 3304
85 Ga0097620_100016053 3300006931 Bacteria 7524
86 Ga0099823_1000015 3300006944 Bacteria 88096
87 Ga0079104_1000138 3300006946 Bacteria 103200
88 Ga0105240_10009585 3300009093 Bacteria 13711
89 Ga0105240_10017227 3300009093 Bacteria 9745
90 Ga0105245_10035094 3300009098 Bacteria 4450
91 Ga0105243_10027034 3300009148 Bacteria 4394
92 Ga0105242_10002020 3300009176 Bacteria 15962
93 Ga0105242_10057743 3300009176 Bacteria 3179
94 Ga0105248_10005310 3300009177 Bacteria 14180
95 Ga0105248_10016999 3300009177 Bacteria 8012
96 Ga0105237_10000416 3300009545 Bacteria 60732
97 Ga0105238_10015940 3300009551 Bacteria 7603
98 Ga0105238_10025061 3300009551 Bacteria 6080
99 Ga0105249_10005308 3300009553 Bacteria 11126
100 Ga0105249_10016976 3300009553 Bacteria 6458
101 Ga0105239_10004117 3300010375 Bacteria 17476
102 Ga0157317_1000016 3300012475 Bacteria 3707
103 Ga0157319_1000052 3300012497 Bacteria 13081
104 Ga0157374_10018030 3300013296 Bacteria 6224
105 Ga0157374_10100243 3300013296 Bacteria 2776
106 Ga0157374_10181844 3300013296 Bacteria 2054
107 Ga0163162_10053777 3300013306 Bacteria 4047
108 Ga0157375_10008643 3300013308 Bacteria 8921
109 Ga0157380_10021063 3300014326 Bacteria 4885
110 Ga0157377_10000010 3300014745 Bacteria 380929
111 Ga0157377_10003708 3300014745 Bacteria 6933
112 Ga0157379_10005448 3300014968 Bacteria 10934
113 Ga0183362_10004 3300015683 Bacteria 569303
114 Ga0213872_10000266 3300021361 Bacteria 45265
115 Ga0213872_10000942 3300021361 Bacteria 20402
116 Ga0209258_102381 3300025242 Bacteria 4942
117 Ga0209129_1000038 3300025258 Bacteria 322778
118 Ga0209565_1009008 3300025263 Bacteria 2569
119 Ga0209673_1006481 3300025273 Bacteria 5643
120 Ga0209673_1007269 3300025273 Bacteria 5143
121 Ga0209673_1015514 3300025273 Bacteria 2889
122 Ga0209564_1000030 3300025295 Bacteria 503296
123 Ga0209564_1000129 3300025295 Bacteria 195163
124 Ga0209758_1000197 3300025297 Bacteria 133706
125 Ga0209758_1000213 3300025297 Bacteria 126745
126 Ga0209050_1000665 3300025298 Bacteria 52282
127 Ga0209050_1000720 3300025298 Bacteria 48448
128 Ga0209050_1004254 3300025298 Bacteria 9835
129 Ga0209050_1004534 3300025298 Bacteria 9337
130 Ga0209256_1000627 3300025299 Bacteria 48553
131 Ga0209256_1002480 3300025299 Bacteria 14960
132 Ga0209256_1003003 3300025299 Bacteria 12523
133 Ga0209051_1000004 3300025303 Bacteria 1155596
134 Ga0209051_1000241 3300025303 Bacteria 91816
135 Ga0209051_1006375 3300025303 Bacteria 6669
136 Ga0209051_1012210 3300025303 Bacteria 4167
137 Ga0209051_1015559 3300025303 Bacteria 3492
138 Ga0209257_1000015 3300025304 Bacteria 908141
139 Ga0209257_1000117 3300025304 Bacteria 227328
140 Ga0209257_1002798 3300025304 Bacteria 16425
141 Ga0209257_1003755 3300025304 Bacteria 12548
142 Ga0209257_1007051 3300025304 Bacteria 6950
143 Ga0207642_10004055 3300025899 Bacteria 4690
144 Ga0207680_10001011 3300025903 Bacteria 13260
145 Ga0207680_10011475 3300025903 Bacteria 4479
146 Ga0207645_10015709 3300025907 Bacteria 5022
147 Ga0207684_10026545 3300025910 Bacteria 4938
148 Ga0207671_10010715 3300025914 Bacteria 7538
149 Ga0207662_10004068 3300025918 Bacteria 7635
150 Ga0207649_10003379 3300025920 Bacteria 8727
151 Ga0207652_10013150 3300025921 Bacteria 6700
152 Ga0207646_10076129 3300025922 Bacteria 2998
153 Ga0207681_10011557 3300025923 Bacteria 5424
154 Ga0207681_10057940 3300025923 Bacteria 2650
155 Ga0207694_10051410 3300025924 Bacteria 3194
156 Ga0207650_10018010 3300025925 Bacteria 4951
157 Ga0207659_10004962 3300025926 Bacteria 8066
158 Ga0207659_10013973 3300025926 Bacteria 5165
159 Ga0207659_10057494 3300025926 Bacteria 2789
160 Ga0207644_10000278 3300025931 Bacteria 33992
161 Ga0207706_10005445 3300025933 Bacteria 11860
162 Ga0207706_10097605 3300025933 Bacteria 2584
163 Ga0207709_10041432 3300025935 Bacteria 2763
164 Ga0207704_10006529 3300025938 Bacteria 5447
165 Ga0207691_10013575 3300025940 Bacteria 7789
166 Ga0207691_10028626 3300025940 Bacteria 5216
167 Ga0207711_10010091 3300025941 Bacteria 7848
168 Ga0207711_10010274 3300025941 Bacteria 7774
169 Ga0207711_10019160 3300025941 Bacteria 5696
170 Ga0207689_10003774 3300025942 Bacteria 13801
171 Ga0207689_10019919 3300025942 Bacteria 5651
172 Ga0207679_10000629 3300025945 Bacteria 23458
173 Ga0207667_10012502 3300025949 Bacteria 9772
174 Ga0207651_10000886 3300025960 Bacteria 13121
175 Ga0207712_10005871 3300025961 Bacteria 7737
176 Ga0207640_10014888 3300025981 Bacteria 4488
177 Ga0207658_10000458 3300025986 Bacteria 38200
178 Ga0207658_10001308 3300025986 Bacteria 19644
179 Ga0207658_10009817 3300025986 Bacteria 6498
180 Ga0207677_10006515 3300026023 Bacteria 6413
181 Ga0207677_10054826 3300026023 Bacteria 2723
182 Ga0207703_10002931 3300026035 Bacteria 14518
183 Ga0207703_10006896 3300026035 Bacteria 9042
184 Ga0207678_10001133 3300026067 Bacteria 24407
185 Ga0207641_10016799 3300026088 Bacteria 5992
186 Ga0207641_10028442 3300026088 Bacteria 4619
187 Ga0207648_10000002 3300026089 Bacteria 307909
188 Ga0207648_10008460 3300026089 Bacteria 9961
189 Ga0207676_10000221 3300026095 Bacteria 49106
190 Ga0207676_10013111 3300026095 Bacteria 5950
191 Ga0207676_10046860 3300026095 Bacteria 3347
192 Ga0207675_100001459 3300026118 Bacteria 23702
193 Ga0207675_100028750 3300026118 Bacteria 5179
194 Ga0207675_100054087 3300026118 Bacteria 3745
195 Ga0207675_100068034 3300026118 Bacteria 3329
196 Ga0207683_10099714 3300026121 Bacteria 2592
197 Ga0209281_1000023 3300027111 Bacteria 519955
198 Ga0209389_1000831 3300027296 Bacteria 19759
199 Ga0209968_1001303 3300027526 Bacteria 3807
200 Ga0209966_1000293 3300027695 Bacteria 16920
201 Ga0209974_10003338 3300027876 Bacteria 5799
202 Ga0268265_10012573 3300028380 Bacteria 5739
203 Ga0268264_10000963 3300028381 Bacteria 29539
204 Ga0268264_10030770 3300028381 Bacteria 4399
205 Ga0307515_10000013 3300028794 Bacteria 568456
206 Ga0307515_10000239 3300028794 Bacteria 135971
207 Ga0307515_10000567 3300028794 Bacteria 87086
208 Ga0307515_10007744 3300028794 Bacteria 21142
209 Ga0307515_10017686 3300028794 Bacteria 12965
210 Ga0307515_10019632 3300028794 Bacteria 12138
211 Ga0307515_10024901 3300028794 Bacteria 10389
212 Ga0307515_10030252 3300028794 Bacteria 9104
213 Ga0307515_10036002 3300028794 Bacteria 8025
214 Ga0307513_10005283 3300031456 Bacteria 17092
215 Ga0307513_10051534 3300031456 Bacteria 4439
216 Ga0307509_10000135 3300031507 Bacteria 109066
217 Ga0307509_10024044 3300031507 Bacteria 6830
218 Ga0307509_10079640 3300031507 Bacteria 3390
219 Ga0307408_100013788 3300031548 Bacteria 5366
220 Ga0307508_10000133 3300031616 Bacteria 87867
221 Ga0307508_10000616 3300031616 Bacteria 42729
222 Ga0307508_10002482 3300031616 Bacteria 19455
223 Ga0307514_10001199 3300031649 Bacteria 34587
224 Ga0307516_10000677 3300031730 Bacteria 46191
225 Ga0307516_10004964 3300031730 Bacteria 16154
226 Ga0307516_10006913 3300031730 Bacteria 13176
227 Ga0307409_100001800 3300031995 Bacteria 10843
228 Ga0307411_10023052 3300032005 Bacteria 3679
229 Ga0307510_10004514 3300033180 Bacteria 16378
230 Ga0307510_10016068 3300033180 Bacteria 8840
231 Ga0373931_0016749 3300035691 Bacteria 3613
232 Ga0395899_0043642 3300037312 Bacteria 3344
233 Ga0395900_0046497 3300037418 Bacteria 4469
234 Ga0395900_0060214 3300037418 Bacteria 3908
235 Ga0395905_0001764 3300037471 Bacteria 25149
236 Ga0395905_0012470 3300037471 Bacteria 8183
237 Ga0395901_0033366 3300038443 Bacteria 5314
238 Ga0395901_0038945 3300038443 Bacteria 4917
239 Ga0395901_0051852 3300038443 Bacteria 4265
240 Ga0436361_0147437 3300039447 Bacteria 84337
241 Ga0436361_0518335 3300039447 Bacteria 20591
242 Ga0436361_0916410 3300039447 Bacteria 83869
243 Ga0436361_1131420 3300039447 Bacteria 9171
244 Ga0439462_0002198 3300042015 Bacteria 4500
245 Ga0450919_000069 3300042121 Bacteria 9607
246 Ga0450892_000365 3300042130 Bacteria 5373
247 Ga0439459_0000443 3300042438 Bacteria 5326
248 Ga0450916_000897 3300042530 Bacteria 2834
249 Ga0450918_000772 3300042531 Bacteria 6776
250 Ga0466969_0000023 3300044656 Bacteria 97322
251 Ga0453683_0007442 3300044673 Bacteria 7427
252 Ga0466966_0003120 3300044684 Bacteria 10904
253 Ga0466961_0005290 3300044693 Bacteria 8122
254 Ga0466961_0044527 3300044693 Bacteria 2839
255 Ga0466959_0000270 3300045049 Bacteria 31887
256 Ga0451576_0016862 3300045051 Bacteria 8048
257 Ga0451576_0020010 3300045051 Bacteria 7295
258 Ga0451576_0125957 3300045051 Bacteria 2669
259 Ga0466958_0048434 3300045836 Bacteria 2568
260 Ga0466967_0039904 3300045976 Bacteria 4039
261 Ga0466967_0066206 3300045976 Bacteria 3218
262 Ga0495592_0002137 3300046454 Bacteria 13908
263 Ga0495583_0000022 3300046506 Bacteria 282544
264 Ga0495606_0001282 3300046507 Bacteria 34808
265 Ga0495625_0035346 3300046660 Bacteria 3684
266 Ga0495669_0034036 3300046684 Bacteria 2245
267 Ga0495649_0000099 3300046694 Bacteria 75713
268 Ga0495676_0039312 3300047321 Bacteria 3919
269 Ga0495686_0000992 3300047472 Bacteria 34617
270 Ga0495593_0046830 3300047673 Bacteria 2303
271 Ga0496102_0045029 3300048905 Bacteria 4005
272 Ga0496104_0021304 3300048907 Bacteria 5949
273 Ga0496106_0010243 3300048909 Bacteria 6930
274 Ga0496108_0037893 3300048911 Bacteria 4017
275 Ga0496108_0088089 3300048911 Bacteria 2637
276 Ga0496113_0029266 3300048916 Bacteria 3975
277 Ga0496113_0057403 3300048916 Bacteria 2925
278 Ga0496114_0001249 3300048917 Bacteria 19250
279 Ga0496115_0084686 3300048918 Bacteria 2585
280 Ga0496124_0000089 3300048927 Bacteria 192423
281 Ga0496125_0068898 3300048928 Bacteria 2780
282 Ga0501198_000003 3300049649 Bacteria 175301
283 Ga0501222_000001 3300049662 Bacteria 307689
284 Ga0501222_002412 3300049662 Bacteria 2593
285 nmdc:mga0k408_18090_c1 3300050493 Bacteria 3930
286 nmdc:mga0k408_18507_c1 3300050493 Bacteria 3889
287 nmdc:mga0k408_2194_c1 3300050493 Bacteria 10472
288 nmdc:mga0k408_33948_c1 3300050493 Bacteria 2919
289 nmdc:mga07m45_2131_c1 3300050496 Bacteria 9210
290 nmdc:mga07m45_6432_c2 3300050496 Bacteria 3897
291 nmdc:mga07m45_7479_c1 3300050496 Bacteria 5584
292 nmdc:mga09592_13623_c1 3300050508 Bacteria 6644
293 Ga0500578_0000393 3300053086 Bacteria 53719
294 Ga0500593_001995 3300053117 Bacteria 7399
295 Ga0500652_001236 3300053131 Bacteria 8122
296 Ga0500559_0000388 3300053136 Bacteria 32263
297 Ga0500568_0024399 3300053139 Bacteria 2561
298 Ga0500619_000167 3300053154 Bacteria 16030
299 Ga0500622_0004817 3300053156 Bacteria 8285
300 Ga0500645_009060 3300053730 Bacteria 3360
301 Ga0590071_001162 3300059421 Bacteria 7115
302 Ga0466962_0032184 3300061719 Bacteria 2510
303 2587729030 2585428057 Bacteria 6737412
304 2587733597 2585428058 Bacteria 6853932
305 2587757980 2585428062 Bacteria 6842168
306 2588293996 2588253510 Bacteria 6901809
307 2643744592 2643221544 Bacteria 5886209
308 2643967101 2643221592 Bacteria 6608788
309 2644139931 2643221625 Bacteria 6512927
310 2644255653 2643221646 Bacteria 6433402
311 2644271171 2643221648 Bacteria 6521465
312 2644305434 2643221654 Bacteria 5273570
313 2644339499 2643221660 Bacteria 4208257
314 2739054117 2738541337 Bacteria 6183410
315 2831864888 2831864461 Bacteria 6502356
316 2886850758 2886848708 Bacteria 5632523
317 2928120026 2928115317 Bacteria 6477646
318 Ga0451577_0001207
319 JGI25152J39213_1001209
320 JGI25153J46596_10004156
321 JGI25153J46596_10004893
322 rootH1_10010554
323 rootH2_10036922
324 rootL2_10002498
325 JGI26128J50194_1000064
326 Ga0055526_1001358
327 Ga0055526_1003640
328 Ga0055524_1000767
329 Ga0055524_1004842
330 Ga0055530_10002059
331 Ga0055540_1000093
332 Ga0055540_1001500
333 Ga0055540_1001920
334 Ga0055531_10000381
335 Ga0055531_10000519
336 Ga0055531_10002435
337 Ga0055531_10015092
338 Ga0065165_1000304
339 Ga0065165_1000757
340 Ga0065165_1002631
341 Ga0070676_10001764
342 Ga0070690_100009814
343 Ga0070690_100014100
344 Ga0070677_10019849
345 Ga0068869_100006725
346 Ga0068868_100001433
347 Ga0068868_100056975
348 Ga0070661_100015155
349 Ga0070668_100074089
350 Ga0070669_100006667
351 Ga0070675_100003315
352 Ga0070675_100005579
353 Ga0070671_100008293
354 Ga0070671_100046334
355 Ga0070674_100004102
356 Ga0070674_100038562
357 Ga0070673_100004055
358 Ga0070673_100022956
359 Ga0070659_100018492
360 Ga0070659_100046600
361 Ga0070667_100022153
362 Ga0070663_100000964
363 Ga0070678_100002517
364 Ga0070678_100060412
365 Ga0070678_100081533
366 Ga0070662_100073557
367 Ga0068867_100000004
368 Ga0068867_100003698
369 Ga0068867_100011554
370 Ga0070706_100004299
371 Ga0070698_100052058
372 Ga0070679_100006893
373 Ga0070672_100010971
374 Ga0070693_100026423
375 Ga0068856_100008539
376 Ga0068856_100017593
377 Ga0070702_100002781
378 Ga0068852_100012535
379 Ga0068859_100016053
380 Ga0068864_100001208
381 Ga0068864_100002757
382 Ga0068864_100009046
383 Ga0068864_100013477
384 Ga0068861_100023628
385 Ga0068863_100002785
386 Ga0068858_100001797
387 Ga0068858_100018840
388 Ga0068858_100025782
389 Ga0068860_100004827
390 Ga0068862_100015253
391 Ga0068862_100042321
392 Ga0075365_10009510
393 Ga0075367_10016014
394 Ga0075367_10032723
395 Ga0075366_10006106
396 Ga0075366_10023425
397 Ga0097621_100011919
398 Ga0075370_10006993
399 Ga0068871_100070815
400 Ga0075429_100003990
401 Ga0068865_100036742
402 Ga0097620_100016053
403 Ga0099823_1000015
404 Ga0079104_1000138
405 Ga0105240_10009585
406 Ga0105240_10017227
407 Ga0105245_10035094
408 Ga0105243_10027034
409 Ga0105242_10002020
410 Ga0105242_10057743
411 Ga0105248_10005310
412 Ga0105248_10016999
413 Ga0105237_10000416
414 Ga0105238_10015940
415 Ga0105238_10025061
416 Ga0105249_10005308
417 Ga0105249_10016976
418 Ga0105239_10004117
419 Ga0157317_1000016
420 Ga0157319_1000052
421 Ga0157374_10018030
422 Ga0157374_10100243
423 Ga0157374_10181844
424 Ga0163162_10053777
425 Ga0157375_10008643
426 Ga0157380_10021063
427 Ga0157377_10000010
428 Ga0157377_10003708
429 Ga0157379_10005448
430 Ga0183362_10004
431 Ga0213872_10000266
432 Ga0213872_10000942
433 Ga0209258_102381
434 Ga0209129_1000038
435 Ga0209565_1009008
436 Ga0209673_1006481
437 Ga0209673_1007269
438 Ga0209673_1015514
439 Ga0209564_1000030
440 Ga0209564_1000129
441 Ga0209758_1000197
442 Ga0209758_1000213
443 Ga0209050_1000665
444 Ga0209050_1000720
445 Ga0209050_1004254
446 Ga0209050_1004534
447 Ga0209256_1000627
448 Ga0209256_1002480
449 Ga0209256_1003003
450 Ga0209051_1000004
451 Ga0209051_1000241
452 Ga0209051_1006375
453 Ga0209051_1012210
454 Ga0209051_1015559
455 Ga0209257_1000015
456 Ga0209257_1000117
457 Ga0209257_1002798
458 Ga0209257_1003755
459 Ga0209257_1007051
460 Ga0207642_10004055
461 Ga0207680_10001011
462 Ga0207680_10011475
463 Ga0207645_10015709
464 Ga0207684_10026545
465 Ga0207671_10010715
466 Ga0207662_10004068
467 Ga0207649_10003379
468 Ga0207652_10013150
469 Ga0207646_10076129
470 Ga0207681_10011557
471 Ga0207681_10057940
472 Ga0207694_10051410
473 Ga0207650_10018010
474 Ga0207659_10004962
475 Ga0207659_10013973
476 Ga0207659_10057494
477 Ga0207644_10000278
478 Ga0207706_10005445
479 Ga0207706_10097605
480 Ga0207709_10041432
481 Ga0207704_10006529
482 Ga0207691_10013575
483 Ga0207691_10028626
484 Ga0207711_10010091
485 Ga0207711_10010274
486 Ga0207711_10019160
487 Ga0207689_10003774
488 Ga0207689_10019919
489 Ga0207679_10000629
490 Ga0207667_10012502
491 Ga0207651_10000886
492 Ga0207712_10005871
493 Ga0207640_10014888
494 Ga0207658_10000458
495 Ga0207658_10001308
496 Ga0207658_10009817
497 Ga0207677_10006515
498 Ga0207677_10054826
499 Ga0207703_10002931
500 Ga0207703_10006896
501 Ga0207678_10001133
502 Ga0207641_10016799
503 Ga0207641_10028442
504 Ga0207648_10000002
505 Ga0207648_10008460
506 Ga0207676_10000221
507 Ga0207676_10013111
508 Ga0207676_10046860
509 Ga0207675_100001459
510 Ga0207675_100028750
511 Ga0207675_100054087
512 Ga0207675_100068034
513 Ga0207683_10099714
514 Ga0209281_1000023
515 Ga0209389_1000831
516 Ga0209968_1001303
517 Ga0209966_1000293
518 Ga0209974_10003338
519 Ga0268265_10012573
520 Ga0268264_10000963
521 Ga0268264_10030770
522 Ga0307515_10000013
523 Ga0307515_10000239
524 Ga0307515_10000567
525 Ga0307515_10007744
526 Ga0307515_10017686
527 Ga0307515_10019632
528 Ga0307515_10024901
529 Ga0307515_10030252
530 Ga0307515_10036002
531 Ga0307513_10005283
532 Ga0307513_10051534
533 Ga0307509_10000135
534 Ga0307509_10024044
535 Ga0307509_10079640
536 Ga0307408_100013788
537 Ga0307508_10000133
538 Ga0307508_10000616
539 Ga0307508_10002482
540 Ga0307514_10001199
541 Ga0307516_10000677
542 Ga0307516_10004964
543 Ga0307516_10006913
544 Ga0307409_100001800
545 Ga0307411_10023052
546 Ga0307510_10004514
547 Ga0307510_10016068
548 Ga0373931_0016749
549 Ga0395899_0043642
550 Ga0395900_0046497
551 Ga0395900_0060214
552 Ga0395905_0001764
553 Ga0395905_0012470
554 Ga0395901_0033366
555 Ga0395901_0038945
556 Ga0395901_0051852
557 Ga0436361_0147437
558 Ga0436361_0518335
559 Ga0436361_0916410
560 Ga0436361_1131420
561 Ga0439462_0002198
562 Ga0450919_000069
563 Ga0450892_000365
564 Ga0439459_0000443
565 Ga0450916_000897
566 Ga0450918_000772
567 Ga0466969_0000023
568 Ga0453683_0007442
569 Ga0466966_0003120
570 Ga0466961_0005290
571 Ga0466961_0044527
572 Ga0466959_0000270
573 Ga0451576_0016862
574 Ga0451576_0020010
575 Ga0451576_0125957
576 Ga0466958_0048434
577 Ga0466967_0039904
578 Ga0466967_0066206
579 Ga0495592_0002137
580 Ga0495583_0000022
581 Ga0495606_0001282
582 Ga0495625_0035346
583 Ga0495669_0034036
584 Ga0495649_0000099
585 Ga0495676_0039312
586 Ga0495686_0000992
587 Ga0495593_0046830
588 Ga0496102_0045029
589 Ga0496104_0021304
590 Ga0496106_0010243
591 Ga0496108_0037893
592 Ga0496108_0088089
593 Ga0496113_0029266
594 Ga0496113_0057403
595 Ga0496114_0001249
596 Ga0496115_0084686
597 Ga0496124_0000089
598 Ga0496125_0068898
599 Ga0501198_000003
600 Ga0501222_000001
601 Ga0501222_002412
602 nmdc:mga0k408_18090_c1
603 nmdc:mga0k408_18507_c1
604 nmdc:mga0k408_2194_c1
605 nmdc:mga0k408_33948_c1
606 nmdc:mga07m45_2131_c1
607 nmdc:mga07m45_6432_c2
608 nmdc:mga07m45_7479_c1
609 nmdc:mga09592_13623_c1
610 Ga0500578_0000393
611 Ga0500593_001995
612 Ga0500652_001236
613 Ga0500559_0000388
614 Ga0500568_0024399
615 Ga0500619_000167
616 Ga0500622_0004817
617 Ga0500645_009060
618 Ga0590071_001162
619 Ga0466962_0032184
620 2587729030
621 2587733597
622 2587757980
623 2588293996
624 2643744592
625 2643967101
626 2644139931
627 2644255653
628 2644271171
629 2644305434
630 2644339499
631 2739054117
632 2831864888
633 2886850758
634 2928120026

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

420

535

0.98

PF02080

TrkA_C

TrkA-C domain

584

654

0.93

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

10

385

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eei-assembly1.cif.gz_B unbound c. ammoniagenes monoamine oxidase (mao) 0.9365 426 456
8eek-assembly2.cif.gz_B c. ammoniagenes monoamine oxidase (mao) bound to tyramine 0.9364 426 456
6n04-assembly1.cif.gz_A the x-ray crystal structure of absh3, an fad dependent reductase from the abyssomicin biosynthesis pathway in streptomyces 0.934 425 455
8eek-assembly1.cif.gz_A c. ammoniagenes monoamine oxidase (mao) bound to tyramine 0.934 426 456
8eef-assembly1.cif.gz_A c. ammoniagenes monoamine oxidase (mao) bound to octopamine 0.9334 426 456
ID Description Score Start End Superfamily
af_O05882_87_159_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9395 600 668 3.30.70.1450
af_E0AHD3_2_449_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9339 424 456 3.50.50.60
af_P60869_303_372_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9336 599 668 3.30.70.1450
af_P9WFZ3_136_217_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9299 596 669 3.30.70.1450
af_A0A1D6MVG0_125_298_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9152 225 396 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A529PZQ1-F1-model_v4 Potassium transporter 0.9343 426 537 GO:0005886
GO:0006813
GO:0015297
AF-A0A7Y0S198-F1-model_v4 Glutathione-regulated potassium-efflux system protein KefB 0.9257 455 538 GO:0005886
GO:0006813
GO:0015297
AF-A0A524PVD3-F1-model_v4 deleted 0.9219 15 401
AF-A0A843DLB2-F1-model_v4 Cation:proton antiporter 0.9195 11 363 GO:0015297
GO:0016020
GO:1902600
AF-A0A529PZQ1-F1-model_v4 Potassium transporter 0.9111 426 537 GO:0005886
GO:0006813
GO:0015297

Map