F404273
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 205 | 634 | 645 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0001207|Ga0451577_0001207_27958_29955 |
| Length | 656 |
| Sequence | MASTLSLILLYLVAAVAGVVLCRSLKLPPMLGYLVVGVLIGPNALALAKDSTAVRVLAEFGVVFLMFVIGLEFNLPKLRSMRTMVFGLGLSQVALTILGAVAGNVLLALGFAWIGVQWDLDWQGAVVLGSAMAMSSTAIVVKMMAERLELESEHGRRVMGVLLFQDLAVVPLLVLIPALDSSGSDMIRSLGLALVKAIGVLALXXXGGQKLMRWWLTLVARRKSDELFVLNLLLVTLGLAWLTEHAGLSLALGAFVAGMLIAETEYKHQVETDIRPFHDVLLGLFFITIGMKLDWRAVWGEWPLVLLLTLVPVAAKAALVAGLARAFRAAPGVALRTGLYLAQAGEFGFVLLTLGAENKLIHPQWVSPVLASMVLSMLATPLLIEYSNRIVMRLAASDWLMQSVALTAIAKKAIRTERHIIICGFGRSGQNLARLLEQEHMPYMALDLDPDRVRQAAAAGQSVVFGDAARLQSLMAAGLARASAVVISYPDTPSALKILDLVRQHAPQVPVVVRTIDDADLERLREAGAAEVVPEAVEGSLMLASHALALVGVPMRRVIRYRLLRGYFHGADDDTVEELNQARLLSVSLPHTAASIGSTLGELALHALDVNVVSVRRLDGRPATPHDELRLAGGDTLVLAGLPETLALAESKLLTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 57 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 68 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 76 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 77 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 122 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 123 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 129 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 130 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 131 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 132 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 133 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 134 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 138 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 144 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 145 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 146 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 147 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 148 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 149 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 150 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 151 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 152 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 153 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 154 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 168 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 169 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 172 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 173 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 174 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 175 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 176 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 177 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 178 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 179 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 180 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 182 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 183 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 184 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 185 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 186 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 187 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 188 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 189 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 190 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 191 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 192 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 193 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 194 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 195 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 196 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 197 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 198 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 199 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 200 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 201 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 202 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 203 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 204 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 205 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.27 |
| Metatranscriptomes | 0 |
| Isolates | 4.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.82 |
| Nodule | 1.58 |
| Rhizoplane | 2.84 |
| Rhizosphere | 63.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451577_0001207 | 3300042876 | Bacteria | 36165 |
| 2 | JGI25152J39213_1001209 | 3300002773 | Bacteria | 11840 |
| 3 | JGI25153J46596_10004156 | 3300003215 | Bacteria | 7862 |
| 4 | JGI25153J46596_10004893 | 3300003215 | Bacteria | 7120 |
| 5 | rootH1_10010554 | 3300003316 | Bacteria | 5937 |
| 6 | rootH2_10036922 | 3300003320 | Bacteria | 6136 |
| 7 | rootL2_10002498 | 3300003322 | Bacteria | 21284 |
| 8 | JGI26128J50194_1000064 | 3300003347 | Bacteria | 3803 |
| 9 | Ga0055526_1001358 | 3300003771 | Bacteria | 17500 |
| 10 | Ga0055526_1003640 | 3300003771 | Bacteria | 9652 |
| 11 | Ga0055524_1000767 | 3300003775 | Bacteria | 21616 |
| 12 | Ga0055524_1004842 | 3300003775 | Bacteria | 6132 |
| 13 | Ga0055530_10002059 | 3300003791 | Bacteria | 13520 |
| 14 | Ga0055540_1000093 | 3300003792 | Bacteria | 98452 |
| 15 | Ga0055540_1001500 | 3300003792 | Bacteria | 13871 |
| 16 | Ga0055540_1001920 | 3300003792 | Bacteria | 11616 |
| 17 | Ga0055531_10000381 | 3300003794 | Bacteria | 42797 |
| 18 | Ga0055531_10000519 | 3300003794 | Bacteria | 34728 |
| 19 | Ga0055531_10002435 | 3300003794 | Bacteria | 12458 |
| 20 | Ga0055531_10015092 | 3300003794 | Bacteria | 3429 |
| 21 | Ga0065165_1000304 | 3300005262 | Bacteria | 81791 |
| 22 | Ga0065165_1000757 | 3300005262 | Bacteria | 43947 |
| 23 | Ga0065165_1002631 | 3300005262 | Bacteria | 14600 |
| 24 | Ga0070676_10001764 | 3300005328 | Bacteria | 11005 |
| 25 | Ga0070690_100009814 | 3300005330 | Bacteria | 5556 |
| 26 | Ga0070690_100014100 | 3300005330 | Bacteria | 4737 |
| 27 | Ga0070677_10019849 | 3300005333 | Bacteria | 2441 |
| 28 | Ga0068869_100006725 | 3300005334 | Bacteria | 7306 |
| 29 | Ga0068868_100001433 | 3300005338 | Bacteria | 16455 |
| 30 | Ga0068868_100056975 | 3300005338 | Bacteria | 3087 |
| 31 | Ga0070661_100015155 | 3300005344 | Bacteria | 5439 |
| 32 | Ga0070668_100074089 | 3300005347 | Bacteria | 2655 |
| 33 | Ga0070669_100006667 | 3300005353 | Bacteria | 8314 |
| 34 | Ga0070675_100003315 | 3300005354 | Bacteria | 12210 |
| 35 | Ga0070675_100005579 | 3300005354 | Bacteria | 9635 |
| 36 | Ga0070671_100008293 | 3300005355 | Bacteria | 8313 |
| 37 | Ga0070671_100046334 | 3300005355 | Bacteria | 3616 |
| 38 | Ga0070674_100004102 | 3300005356 | Bacteria | 8277 |
| 39 | Ga0070674_100038562 | 3300005356 | Bacteria | 3220 |
| 40 | Ga0070673_100004055 | 3300005364 | Bacteria | 9225 |
| 41 | Ga0070673_100022956 | 3300005364 | Bacteria | 4552 |
| 42 | Ga0070659_100018492 | 3300005366 | Bacteria | 5258 |
| 43 | Ga0070659_100046600 | 3300005366 | Bacteria | 3398 |
| 44 | Ga0070667_100022153 | 3300005367 | Bacteria | 5271 |
| 45 | Ga0070663_100000964 | 3300005455 | Bacteria | 15641 |
| 46 | Ga0070678_100002517 | 3300005456 | Bacteria | 10055 |
| 47 | Ga0070678_100060412 | 3300005456 | Bacteria | 2790 |
| 48 | Ga0070678_100081533 | 3300005456 | Bacteria | 2453 |
| 49 | Ga0070662_100073557 | 3300005457 | Bacteria | 2525 |
| 50 | Ga0068867_100000004 | 3300005459 | Bacteria | 180739 |
| 51 | Ga0068867_100003698 | 3300005459 | Bacteria | 10761 |
| 52 | Ga0068867_100011554 | 3300005459 | Bacteria | 6233 |
| 53 | Ga0070706_100004299 | 3300005467 | Bacteria | 13799 |
| 54 | Ga0070698_100052058 | 3300005471 | Bacteria | 4168 |
| 55 | Ga0070679_100006893 | 3300005530 | Bacteria | 10595 |
| 56 | Ga0070672_100010971 | 3300005543 | Bacteria | 6305 |
| 57 | Ga0070693_100026423 | 3300005547 | Bacteria | 3134 |
| 58 | Ga0068856_100008539 | 3300005614 | Bacteria | 9955 |
| 59 | Ga0068856_100017593 | 3300005614 | Bacteria | 6927 |
| 60 | Ga0070702_100002781 | 3300005615 | Bacteria | 7671 |
| 61 | Ga0068852_100012535 | 3300005616 | Bacteria | 6441 |
| 62 | Ga0068859_100016053 | 3300005617 | Bacteria | 7524 |
| 63 | Ga0068864_100001208 | 3300005618 | Bacteria | 21454 |
| 64 | Ga0068864_100002757 | 3300005618 | Bacteria | 14488 |
| 65 | Ga0068864_100009046 | 3300005618 | Bacteria | 8209 |
| 66 | Ga0068864_100013477 | 3300005618 | Bacteria | 6778 |
| 67 | Ga0068861_100023628 | 3300005719 | Bacteria | 4436 |
| 68 | Ga0068863_100002785 | 3300005841 | Bacteria | 17318 |
| 69 | Ga0068858_100001797 | 3300005842 | Bacteria | 21879 |
| 70 | Ga0068858_100018840 | 3300005842 | Bacteria | 6460 |
| 71 | Ga0068858_100025782 | 3300005842 | Bacteria | 5468 |
| 72 | Ga0068860_100004827 | 3300005843 | Bacteria | 13727 |
| 73 | Ga0068862_100015253 | 3300005844 | Bacteria | 6381 |
| 74 | Ga0068862_100042321 | 3300005844 | Bacteria | 3880 |
| 75 | Ga0075365_10009510 | 3300006038 | Bacteria | 5594 |
| 76 | Ga0075367_10016014 | 3300006178 | Bacteria | 4088 |
| 77 | Ga0075367_10032723 | 3300006178 | Bacteria | 2994 |
| 78 | Ga0075366_10006106 | 3300006195 | Bacteria | 6567 |
| 79 | Ga0075366_10023425 | 3300006195 | Bacteria | 3596 |
| 80 | Ga0097621_100011919 | 3300006237 | Bacteria | 6430 |
| 81 | Ga0075370_10006993 | 3300006353 | Bacteria | 5718 |
| 82 | Ga0068871_100070815 | 3300006358 | Bacteria | 2866 |
| 83 | Ga0075429_100003990 | 3300006880 | Bacteria | 12633 |
| 84 | Ga0068865_100036742 | 3300006881 | Bacteria | 3304 |
| 85 | Ga0097620_100016053 | 3300006931 | Bacteria | 7524 |
| 86 | Ga0099823_1000015 | 3300006944 | Bacteria | 88096 |
| 87 | Ga0079104_1000138 | 3300006946 | Bacteria | 103200 |
| 88 | Ga0105240_10009585 | 3300009093 | Bacteria | 13711 |
| 89 | Ga0105240_10017227 | 3300009093 | Bacteria | 9745 |
| 90 | Ga0105245_10035094 | 3300009098 | Bacteria | 4450 |
| 91 | Ga0105243_10027034 | 3300009148 | Bacteria | 4394 |
| 92 | Ga0105242_10002020 | 3300009176 | Bacteria | 15962 |
| 93 | Ga0105242_10057743 | 3300009176 | Bacteria | 3179 |
| 94 | Ga0105248_10005310 | 3300009177 | Bacteria | 14180 |
| 95 | Ga0105248_10016999 | 3300009177 | Bacteria | 8012 |
| 96 | Ga0105237_10000416 | 3300009545 | Bacteria | 60732 |
| 97 | Ga0105238_10015940 | 3300009551 | Bacteria | 7603 |
| 98 | Ga0105238_10025061 | 3300009551 | Bacteria | 6080 |
| 99 | Ga0105249_10005308 | 3300009553 | Bacteria | 11126 |
| 100 | Ga0105249_10016976 | 3300009553 | Bacteria | 6458 |
| 101 | Ga0105239_10004117 | 3300010375 | Bacteria | 17476 |
| 102 | Ga0157317_1000016 | 3300012475 | Bacteria | 3707 |
| 103 | Ga0157319_1000052 | 3300012497 | Bacteria | 13081 |
| 104 | Ga0157374_10018030 | 3300013296 | Bacteria | 6224 |
| 105 | Ga0157374_10100243 | 3300013296 | Bacteria | 2776 |
| 106 | Ga0157374_10181844 | 3300013296 | Bacteria | 2054 |
| 107 | Ga0163162_10053777 | 3300013306 | Bacteria | 4047 |
| 108 | Ga0157375_10008643 | 3300013308 | Bacteria | 8921 |
| 109 | Ga0157380_10021063 | 3300014326 | Bacteria | 4885 |
| 110 | Ga0157377_10000010 | 3300014745 | Bacteria | 380929 |
| 111 | Ga0157377_10003708 | 3300014745 | Bacteria | 6933 |
| 112 | Ga0157379_10005448 | 3300014968 | Bacteria | 10934 |
| 113 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 114 | Ga0213872_10000266 | 3300021361 | Bacteria | 45265 |
| 115 | Ga0213872_10000942 | 3300021361 | Bacteria | 20402 |
| 116 | Ga0209258_102381 | 3300025242 | Bacteria | 4942 |
| 117 | Ga0209129_1000038 | 3300025258 | Bacteria | 322778 |
| 118 | Ga0209565_1009008 | 3300025263 | Bacteria | 2569 |
| 119 | Ga0209673_1006481 | 3300025273 | Bacteria | 5643 |
| 120 | Ga0209673_1007269 | 3300025273 | Bacteria | 5143 |
| 121 | Ga0209673_1015514 | 3300025273 | Bacteria | 2889 |
| 122 | Ga0209564_1000030 | 3300025295 | Bacteria | 503296 |
| 123 | Ga0209564_1000129 | 3300025295 | Bacteria | 195163 |
| 124 | Ga0209758_1000197 | 3300025297 | Bacteria | 133706 |
| 125 | Ga0209758_1000213 | 3300025297 | Bacteria | 126745 |
| 126 | Ga0209050_1000665 | 3300025298 | Bacteria | 52282 |
| 127 | Ga0209050_1000720 | 3300025298 | Bacteria | 48448 |
| 128 | Ga0209050_1004254 | 3300025298 | Bacteria | 9835 |
| 129 | Ga0209050_1004534 | 3300025298 | Bacteria | 9337 |
| 130 | Ga0209256_1000627 | 3300025299 | Bacteria | 48553 |
| 131 | Ga0209256_1002480 | 3300025299 | Bacteria | 14960 |
| 132 | Ga0209256_1003003 | 3300025299 | Bacteria | 12523 |
| 133 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 134 | Ga0209051_1000241 | 3300025303 | Bacteria | 91816 |
| 135 | Ga0209051_1006375 | 3300025303 | Bacteria | 6669 |
| 136 | Ga0209051_1012210 | 3300025303 | Bacteria | 4167 |
| 137 | Ga0209051_1015559 | 3300025303 | Bacteria | 3492 |
| 138 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 139 | Ga0209257_1000117 | 3300025304 | Bacteria | 227328 |
| 140 | Ga0209257_1002798 | 3300025304 | Bacteria | 16425 |
| 141 | Ga0209257_1003755 | 3300025304 | Bacteria | 12548 |
| 142 | Ga0209257_1007051 | 3300025304 | Bacteria | 6950 |
| 143 | Ga0207642_10004055 | 3300025899 | Bacteria | 4690 |
| 144 | Ga0207680_10001011 | 3300025903 | Bacteria | 13260 |
| 145 | Ga0207680_10011475 | 3300025903 | Bacteria | 4479 |
| 146 | Ga0207645_10015709 | 3300025907 | Bacteria | 5022 |
| 147 | Ga0207684_10026545 | 3300025910 | Bacteria | 4938 |
| 148 | Ga0207671_10010715 | 3300025914 | Bacteria | 7538 |
| 149 | Ga0207662_10004068 | 3300025918 | Bacteria | 7635 |
| 150 | Ga0207649_10003379 | 3300025920 | Bacteria | 8727 |
| 151 | Ga0207652_10013150 | 3300025921 | Bacteria | 6700 |
| 152 | Ga0207646_10076129 | 3300025922 | Bacteria | 2998 |
| 153 | Ga0207681_10011557 | 3300025923 | Bacteria | 5424 |
| 154 | Ga0207681_10057940 | 3300025923 | Bacteria | 2650 |
| 155 | Ga0207694_10051410 | 3300025924 | Bacteria | 3194 |
| 156 | Ga0207650_10018010 | 3300025925 | Bacteria | 4951 |
| 157 | Ga0207659_10004962 | 3300025926 | Bacteria | 8066 |
| 158 | Ga0207659_10013973 | 3300025926 | Bacteria | 5165 |
| 159 | Ga0207659_10057494 | 3300025926 | Bacteria | 2789 |
| 160 | Ga0207644_10000278 | 3300025931 | Bacteria | 33992 |
| 161 | Ga0207706_10005445 | 3300025933 | Bacteria | 11860 |
| 162 | Ga0207706_10097605 | 3300025933 | Bacteria | 2584 |
| 163 | Ga0207709_10041432 | 3300025935 | Bacteria | 2763 |
| 164 | Ga0207704_10006529 | 3300025938 | Bacteria | 5447 |
| 165 | Ga0207691_10013575 | 3300025940 | Bacteria | 7789 |
| 166 | Ga0207691_10028626 | 3300025940 | Bacteria | 5216 |
| 167 | Ga0207711_10010091 | 3300025941 | Bacteria | 7848 |
| 168 | Ga0207711_10010274 | 3300025941 | Bacteria | 7774 |
| 169 | Ga0207711_10019160 | 3300025941 | Bacteria | 5696 |
| 170 | Ga0207689_10003774 | 3300025942 | Bacteria | 13801 |
| 171 | Ga0207689_10019919 | 3300025942 | Bacteria | 5651 |
| 172 | Ga0207679_10000629 | 3300025945 | Bacteria | 23458 |
| 173 | Ga0207667_10012502 | 3300025949 | Bacteria | 9772 |
| 174 | Ga0207651_10000886 | 3300025960 | Bacteria | 13121 |
| 175 | Ga0207712_10005871 | 3300025961 | Bacteria | 7737 |
| 176 | Ga0207640_10014888 | 3300025981 | Bacteria | 4488 |
| 177 | Ga0207658_10000458 | 3300025986 | Bacteria | 38200 |
| 178 | Ga0207658_10001308 | 3300025986 | Bacteria | 19644 |
| 179 | Ga0207658_10009817 | 3300025986 | Bacteria | 6498 |
| 180 | Ga0207677_10006515 | 3300026023 | Bacteria | 6413 |
| 181 | Ga0207677_10054826 | 3300026023 | Bacteria | 2723 |
| 182 | Ga0207703_10002931 | 3300026035 | Bacteria | 14518 |
| 183 | Ga0207703_10006896 | 3300026035 | Bacteria | 9042 |
| 184 | Ga0207678_10001133 | 3300026067 | Bacteria | 24407 |
| 185 | Ga0207641_10016799 | 3300026088 | Bacteria | 5992 |
| 186 | Ga0207641_10028442 | 3300026088 | Bacteria | 4619 |
| 187 | Ga0207648_10000002 | 3300026089 | Bacteria | 307909 |
| 188 | Ga0207648_10008460 | 3300026089 | Bacteria | 9961 |
| 189 | Ga0207676_10000221 | 3300026095 | Bacteria | 49106 |
| 190 | Ga0207676_10013111 | 3300026095 | Bacteria | 5950 |
| 191 | Ga0207676_10046860 | 3300026095 | Bacteria | 3347 |
| 192 | Ga0207675_100001459 | 3300026118 | Bacteria | 23702 |
| 193 | Ga0207675_100028750 | 3300026118 | Bacteria | 5179 |
| 194 | Ga0207675_100054087 | 3300026118 | Bacteria | 3745 |
| 195 | Ga0207675_100068034 | 3300026118 | Bacteria | 3329 |
| 196 | Ga0207683_10099714 | 3300026121 | Bacteria | 2592 |
| 197 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 198 | Ga0209389_1000831 | 3300027296 | Bacteria | 19759 |
| 199 | Ga0209968_1001303 | 3300027526 | Bacteria | 3807 |
| 200 | Ga0209966_1000293 | 3300027695 | Bacteria | 16920 |
| 201 | Ga0209974_10003338 | 3300027876 | Bacteria | 5799 |
| 202 | Ga0268265_10012573 | 3300028380 | Bacteria | 5739 |
| 203 | Ga0268264_10000963 | 3300028381 | Bacteria | 29539 |
| 204 | Ga0268264_10030770 | 3300028381 | Bacteria | 4399 |
| 205 | Ga0307515_10000013 | 3300028794 | Bacteria | 568456 |
| 206 | Ga0307515_10000239 | 3300028794 | Bacteria | 135971 |
| 207 | Ga0307515_10000567 | 3300028794 | Bacteria | 87086 |
| 208 | Ga0307515_10007744 | 3300028794 | Bacteria | 21142 |
| 209 | Ga0307515_10017686 | 3300028794 | Bacteria | 12965 |
| 210 | Ga0307515_10019632 | 3300028794 | Bacteria | 12138 |
| 211 | Ga0307515_10024901 | 3300028794 | Bacteria | 10389 |
| 212 | Ga0307515_10030252 | 3300028794 | Bacteria | 9104 |
| 213 | Ga0307515_10036002 | 3300028794 | Bacteria | 8025 |
| 214 | Ga0307513_10005283 | 3300031456 | Bacteria | 17092 |
| 215 | Ga0307513_10051534 | 3300031456 | Bacteria | 4439 |
| 216 | Ga0307509_10000135 | 3300031507 | Bacteria | 109066 |
| 217 | Ga0307509_10024044 | 3300031507 | Bacteria | 6830 |
| 218 | Ga0307509_10079640 | 3300031507 | Bacteria | 3390 |
| 219 | Ga0307408_100013788 | 3300031548 | Bacteria | 5366 |
| 220 | Ga0307508_10000133 | 3300031616 | Bacteria | 87867 |
| 221 | Ga0307508_10000616 | 3300031616 | Bacteria | 42729 |
| 222 | Ga0307508_10002482 | 3300031616 | Bacteria | 19455 |
| 223 | Ga0307514_10001199 | 3300031649 | Bacteria | 34587 |
| 224 | Ga0307516_10000677 | 3300031730 | Bacteria | 46191 |
| 225 | Ga0307516_10004964 | 3300031730 | Bacteria | 16154 |
| 226 | Ga0307516_10006913 | 3300031730 | Bacteria | 13176 |
| 227 | Ga0307409_100001800 | 3300031995 | Bacteria | 10843 |
| 228 | Ga0307411_10023052 | 3300032005 | Bacteria | 3679 |
| 229 | Ga0307510_10004514 | 3300033180 | Bacteria | 16378 |
| 230 | Ga0307510_10016068 | 3300033180 | Bacteria | 8840 |
| 231 | Ga0373931_0016749 | 3300035691 | Bacteria | 3613 |
| 232 | Ga0395899_0043642 | 3300037312 | Bacteria | 3344 |
| 233 | Ga0395900_0046497 | 3300037418 | Bacteria | 4469 |
| 234 | Ga0395900_0060214 | 3300037418 | Bacteria | 3908 |
| 235 | Ga0395905_0001764 | 3300037471 | Bacteria | 25149 |
| 236 | Ga0395905_0012470 | 3300037471 | Bacteria | 8183 |
| 237 | Ga0395901_0033366 | 3300038443 | Bacteria | 5314 |
| 238 | Ga0395901_0038945 | 3300038443 | Bacteria | 4917 |
| 239 | Ga0395901_0051852 | 3300038443 | Bacteria | 4265 |
| 240 | Ga0436361_0147437 | 3300039447 | Bacteria | 84337 |
| 241 | Ga0436361_0518335 | 3300039447 | Bacteria | 20591 |
| 242 | Ga0436361_0916410 | 3300039447 | Bacteria | 83869 |
| 243 | Ga0436361_1131420 | 3300039447 | Bacteria | 9171 |
| 244 | Ga0439462_0002198 | 3300042015 | Bacteria | 4500 |
| 245 | Ga0450919_000069 | 3300042121 | Bacteria | 9607 |
| 246 | Ga0450892_000365 | 3300042130 | Bacteria | 5373 |
| 247 | Ga0439459_0000443 | 3300042438 | Bacteria | 5326 |
| 248 | Ga0450916_000897 | 3300042530 | Bacteria | 2834 |
| 249 | Ga0450918_000772 | 3300042531 | Bacteria | 6776 |
| 250 | Ga0466969_0000023 | 3300044656 | Bacteria | 97322 |
| 251 | Ga0453683_0007442 | 3300044673 | Bacteria | 7427 |
| 252 | Ga0466966_0003120 | 3300044684 | Bacteria | 10904 |
| 253 | Ga0466961_0005290 | 3300044693 | Bacteria | 8122 |
| 254 | Ga0466961_0044527 | 3300044693 | Bacteria | 2839 |
| 255 | Ga0466959_0000270 | 3300045049 | Bacteria | 31887 |
| 256 | Ga0451576_0016862 | 3300045051 | Bacteria | 8048 |
| 257 | Ga0451576_0020010 | 3300045051 | Bacteria | 7295 |
| 258 | Ga0451576_0125957 | 3300045051 | Bacteria | 2669 |
| 259 | Ga0466958_0048434 | 3300045836 | Bacteria | 2568 |
| 260 | Ga0466967_0039904 | 3300045976 | Bacteria | 4039 |
| 261 | Ga0466967_0066206 | 3300045976 | Bacteria | 3218 |
| 262 | Ga0495592_0002137 | 3300046454 | Bacteria | 13908 |
| 263 | Ga0495583_0000022 | 3300046506 | Bacteria | 282544 |
| 264 | Ga0495606_0001282 | 3300046507 | Bacteria | 34808 |
| 265 | Ga0495625_0035346 | 3300046660 | Bacteria | 3684 |
| 266 | Ga0495669_0034036 | 3300046684 | Bacteria | 2245 |
| 267 | Ga0495649_0000099 | 3300046694 | Bacteria | 75713 |
| 268 | Ga0495676_0039312 | 3300047321 | Bacteria | 3919 |
| 269 | Ga0495686_0000992 | 3300047472 | Bacteria | 34617 |
| 270 | Ga0495593_0046830 | 3300047673 | Bacteria | 2303 |
| 271 | Ga0496102_0045029 | 3300048905 | Bacteria | 4005 |
| 272 | Ga0496104_0021304 | 3300048907 | Bacteria | 5949 |
| 273 | Ga0496106_0010243 | 3300048909 | Bacteria | 6930 |
| 274 | Ga0496108_0037893 | 3300048911 | Bacteria | 4017 |
| 275 | Ga0496108_0088089 | 3300048911 | Bacteria | 2637 |
| 276 | Ga0496113_0029266 | 3300048916 | Bacteria | 3975 |
| 277 | Ga0496113_0057403 | 3300048916 | Bacteria | 2925 |
| 278 | Ga0496114_0001249 | 3300048917 | Bacteria | 19250 |
| 279 | Ga0496115_0084686 | 3300048918 | Bacteria | 2585 |
| 280 | Ga0496124_0000089 | 3300048927 | Bacteria | 192423 |
| 281 | Ga0496125_0068898 | 3300048928 | Bacteria | 2780 |
| 282 | Ga0501198_000003 | 3300049649 | Bacteria | 175301 |
| 283 | Ga0501222_000001 | 3300049662 | Bacteria | 307689 |
| 284 | Ga0501222_002412 | 3300049662 | Bacteria | 2593 |
| 285 | nmdc:mga0k408_18090_c1 | 3300050493 | Bacteria | 3930 |
| 286 | nmdc:mga0k408_18507_c1 | 3300050493 | Bacteria | 3889 |
| 287 | nmdc:mga0k408_2194_c1 | 3300050493 | Bacteria | 10472 |
| 288 | nmdc:mga0k408_33948_c1 | 3300050493 | Bacteria | 2919 |
| 289 | nmdc:mga07m45_2131_c1 | 3300050496 | Bacteria | 9210 |
| 290 | nmdc:mga07m45_6432_c2 | 3300050496 | Bacteria | 3897 |
| 291 | nmdc:mga07m45_7479_c1 | 3300050496 | Bacteria | 5584 |
| 292 | nmdc:mga09592_13623_c1 | 3300050508 | Bacteria | 6644 |
| 293 | Ga0500578_0000393 | 3300053086 | Bacteria | 53719 |
| 294 | Ga0500593_001995 | 3300053117 | Bacteria | 7399 |
| 295 | Ga0500652_001236 | 3300053131 | Bacteria | 8122 |
| 296 | Ga0500559_0000388 | 3300053136 | Bacteria | 32263 |
| 297 | Ga0500568_0024399 | 3300053139 | Bacteria | 2561 |
| 298 | Ga0500619_000167 | 3300053154 | Bacteria | 16030 |
| 299 | Ga0500622_0004817 | 3300053156 | Bacteria | 8285 |
| 300 | Ga0500645_009060 | 3300053730 | Bacteria | 3360 |
| 301 | Ga0590071_001162 | 3300059421 | Bacteria | 7115 |
| 302 | Ga0466962_0032184 | 3300061719 | Bacteria | 2510 |
| 303 | 2587729030 | 2585428057 | Bacteria | 6737412 |
| 304 | 2587733597 | 2585428058 | Bacteria | 6853932 |
| 305 | 2587757980 | 2585428062 | Bacteria | 6842168 |
| 306 | 2588293996 | 2588253510 | Bacteria | 6901809 |
| 307 | 2643744592 | 2643221544 | Bacteria | 5886209 |
| 308 | 2643967101 | 2643221592 | Bacteria | 6608788 |
| 309 | 2644139931 | 2643221625 | Bacteria | 6512927 |
| 310 | 2644255653 | 2643221646 | Bacteria | 6433402 |
| 311 | 2644271171 | 2643221648 | Bacteria | 6521465 |
| 312 | 2644305434 | 2643221654 | Bacteria | 5273570 |
| 313 | 2644339499 | 2643221660 | Bacteria | 4208257 |
| 314 | 2739054117 | 2738541337 | Bacteria | 6183410 |
| 315 | 2831864888 | 2831864461 | Bacteria | 6502356 |
| 316 | 2886850758 | 2886848708 | Bacteria | 5632523 |
| 317 | 2928120026 | 2928115317 | Bacteria | 6477646 |
| 318 | Ga0451577_0001207 | |||
| 319 | JGI25152J39213_1001209 | |||
| 320 | JGI25153J46596_10004156 | |||
| 321 | JGI25153J46596_10004893 | |||
| 322 | rootH1_10010554 | |||
| 323 | rootH2_10036922 | |||
| 324 | rootL2_10002498 | |||
| 325 | JGI26128J50194_1000064 | |||
| 326 | Ga0055526_1001358 | |||
| 327 | Ga0055526_1003640 | |||
| 328 | Ga0055524_1000767 | |||
| 329 | Ga0055524_1004842 | |||
| 330 | Ga0055530_10002059 | |||
| 331 | Ga0055540_1000093 | |||
| 332 | Ga0055540_1001500 | |||
| 333 | Ga0055540_1001920 | |||
| 334 | Ga0055531_10000381 | |||
| 335 | Ga0055531_10000519 | |||
| 336 | Ga0055531_10002435 | |||
| 337 | Ga0055531_10015092 | |||
| 338 | Ga0065165_1000304 | |||
| 339 | Ga0065165_1000757 | |||
| 340 | Ga0065165_1002631 | |||
| 341 | Ga0070676_10001764 | |||
| 342 | Ga0070690_100009814 | |||
| 343 | Ga0070690_100014100 | |||
| 344 | Ga0070677_10019849 | |||
| 345 | Ga0068869_100006725 | |||
| 346 | Ga0068868_100001433 | |||
| 347 | Ga0068868_100056975 | |||
| 348 | Ga0070661_100015155 | |||
| 349 | Ga0070668_100074089 | |||
| 350 | Ga0070669_100006667 | |||
| 351 | Ga0070675_100003315 | |||
| 352 | Ga0070675_100005579 | |||
| 353 | Ga0070671_100008293 | |||
| 354 | Ga0070671_100046334 | |||
| 355 | Ga0070674_100004102 | |||
| 356 | Ga0070674_100038562 | |||
| 357 | Ga0070673_100004055 | |||
| 358 | Ga0070673_100022956 | |||
| 359 | Ga0070659_100018492 | |||
| 360 | Ga0070659_100046600 | |||
| 361 | Ga0070667_100022153 | |||
| 362 | Ga0070663_100000964 | |||
| 363 | Ga0070678_100002517 | |||
| 364 | Ga0070678_100060412 | |||
| 365 | Ga0070678_100081533 | |||
| 366 | Ga0070662_100073557 | |||
| 367 | Ga0068867_100000004 | |||
| 368 | Ga0068867_100003698 | |||
| 369 | Ga0068867_100011554 | |||
| 370 | Ga0070706_100004299 | |||
| 371 | Ga0070698_100052058 | |||
| 372 | Ga0070679_100006893 | |||
| 373 | Ga0070672_100010971 | |||
| 374 | Ga0070693_100026423 | |||
| 375 | Ga0068856_100008539 | |||
| 376 | Ga0068856_100017593 | |||
| 377 | Ga0070702_100002781 | |||
| 378 | Ga0068852_100012535 | |||
| 379 | Ga0068859_100016053 | |||
| 380 | Ga0068864_100001208 | |||
| 381 | Ga0068864_100002757 | |||
| 382 | Ga0068864_100009046 | |||
| 383 | Ga0068864_100013477 | |||
| 384 | Ga0068861_100023628 | |||
| 385 | Ga0068863_100002785 | |||
| 386 | Ga0068858_100001797 | |||
| 387 | Ga0068858_100018840 | |||
| 388 | Ga0068858_100025782 | |||
| 389 | Ga0068860_100004827 | |||
| 390 | Ga0068862_100015253 | |||
| 391 | Ga0068862_100042321 | |||
| 392 | Ga0075365_10009510 | |||
| 393 | Ga0075367_10016014 | |||
| 394 | Ga0075367_10032723 | |||
| 395 | Ga0075366_10006106 | |||
| 396 | Ga0075366_10023425 | |||
| 397 | Ga0097621_100011919 | |||
| 398 | Ga0075370_10006993 | |||
| 399 | Ga0068871_100070815 | |||
| 400 | Ga0075429_100003990 | |||
| 401 | Ga0068865_100036742 | |||
| 402 | Ga0097620_100016053 | |||
| 403 | Ga0099823_1000015 | |||
| 404 | Ga0079104_1000138 | |||
| 405 | Ga0105240_10009585 | |||
| 406 | Ga0105240_10017227 | |||
| 407 | Ga0105245_10035094 | |||
| 408 | Ga0105243_10027034 | |||
| 409 | Ga0105242_10002020 | |||
| 410 | Ga0105242_10057743 | |||
| 411 | Ga0105248_10005310 | |||
| 412 | Ga0105248_10016999 | |||
| 413 | Ga0105237_10000416 | |||
| 414 | Ga0105238_10015940 | |||
| 415 | Ga0105238_10025061 | |||
| 416 | Ga0105249_10005308 | |||
| 417 | Ga0105249_10016976 | |||
| 418 | Ga0105239_10004117 | |||
| 419 | Ga0157317_1000016 | |||
| 420 | Ga0157319_1000052 | |||
| 421 | Ga0157374_10018030 | |||
| 422 | Ga0157374_10100243 | |||
| 423 | Ga0157374_10181844 | |||
| 424 | Ga0163162_10053777 | |||
| 425 | Ga0157375_10008643 | |||
| 426 | Ga0157380_10021063 | |||
| 427 | Ga0157377_10000010 | |||
| 428 | Ga0157377_10003708 | |||
| 429 | Ga0157379_10005448 | |||
| 430 | Ga0183362_10004 | |||
| 431 | Ga0213872_10000266 | |||
| 432 | Ga0213872_10000942 | |||
| 433 | Ga0209258_102381 | |||
| 434 | Ga0209129_1000038 | |||
| 435 | Ga0209565_1009008 | |||
| 436 | Ga0209673_1006481 | |||
| 437 | Ga0209673_1007269 | |||
| 438 | Ga0209673_1015514 | |||
| 439 | Ga0209564_1000030 | |||
| 440 | Ga0209564_1000129 | |||
| 441 | Ga0209758_1000197 | |||
| 442 | Ga0209758_1000213 | |||
| 443 | Ga0209050_1000665 | |||
| 444 | Ga0209050_1000720 | |||
| 445 | Ga0209050_1004254 | |||
| 446 | Ga0209050_1004534 | |||
| 447 | Ga0209256_1000627 | |||
| 448 | Ga0209256_1002480 | |||
| 449 | Ga0209256_1003003 | |||
| 450 | Ga0209051_1000004 | |||
| 451 | Ga0209051_1000241 | |||
| 452 | Ga0209051_1006375 | |||
| 453 | Ga0209051_1012210 | |||
| 454 | Ga0209051_1015559 | |||
| 455 | Ga0209257_1000015 | |||
| 456 | Ga0209257_1000117 | |||
| 457 | Ga0209257_1002798 | |||
| 458 | Ga0209257_1003755 | |||
| 459 | Ga0209257_1007051 | |||
| 460 | Ga0207642_10004055 | |||
| 461 | Ga0207680_10001011 | |||
| 462 | Ga0207680_10011475 | |||
| 463 | Ga0207645_10015709 | |||
| 464 | Ga0207684_10026545 | |||
| 465 | Ga0207671_10010715 | |||
| 466 | Ga0207662_10004068 | |||
| 467 | Ga0207649_10003379 | |||
| 468 | Ga0207652_10013150 | |||
| 469 | Ga0207646_10076129 | |||
| 470 | Ga0207681_10011557 | |||
| 471 | Ga0207681_10057940 | |||
| 472 | Ga0207694_10051410 | |||
| 473 | Ga0207650_10018010 | |||
| 474 | Ga0207659_10004962 | |||
| 475 | Ga0207659_10013973 | |||
| 476 | Ga0207659_10057494 | |||
| 477 | Ga0207644_10000278 | |||
| 478 | Ga0207706_10005445 | |||
| 479 | Ga0207706_10097605 | |||
| 480 | Ga0207709_10041432 | |||
| 481 | Ga0207704_10006529 | |||
| 482 | Ga0207691_10013575 | |||
| 483 | Ga0207691_10028626 | |||
| 484 | Ga0207711_10010091 | |||
| 485 | Ga0207711_10010274 | |||
| 486 | Ga0207711_10019160 | |||
| 487 | Ga0207689_10003774 | |||
| 488 | Ga0207689_10019919 | |||
| 489 | Ga0207679_10000629 | |||
| 490 | Ga0207667_10012502 | |||
| 491 | Ga0207651_10000886 | |||
| 492 | Ga0207712_10005871 | |||
| 493 | Ga0207640_10014888 | |||
| 494 | Ga0207658_10000458 | |||
| 495 | Ga0207658_10001308 | |||
| 496 | Ga0207658_10009817 | |||
| 497 | Ga0207677_10006515 | |||
| 498 | Ga0207677_10054826 | |||
| 499 | Ga0207703_10002931 | |||
| 500 | Ga0207703_10006896 | |||
| 501 | Ga0207678_10001133 | |||
| 502 | Ga0207641_10016799 | |||
| 503 | Ga0207641_10028442 | |||
| 504 | Ga0207648_10000002 | |||
| 505 | Ga0207648_10008460 | |||
| 506 | Ga0207676_10000221 | |||
| 507 | Ga0207676_10013111 | |||
| 508 | Ga0207676_10046860 | |||
| 509 | Ga0207675_100001459 | |||
| 510 | Ga0207675_100028750 | |||
| 511 | Ga0207675_100054087 | |||
| 512 | Ga0207675_100068034 | |||
| 513 | Ga0207683_10099714 | |||
| 514 | Ga0209281_1000023 | |||
| 515 | Ga0209389_1000831 | |||
| 516 | Ga0209968_1001303 | |||
| 517 | Ga0209966_1000293 | |||
| 518 | Ga0209974_10003338 | |||
| 519 | Ga0268265_10012573 | |||
| 520 | Ga0268264_10000963 | |||
| 521 | Ga0268264_10030770 | |||
| 522 | Ga0307515_10000013 | |||
| 523 | Ga0307515_10000239 | |||
| 524 | Ga0307515_10000567 | |||
| 525 | Ga0307515_10007744 | |||
| 526 | Ga0307515_10017686 | |||
| 527 | Ga0307515_10019632 | |||
| 528 | Ga0307515_10024901 | |||
| 529 | Ga0307515_10030252 | |||
| 530 | Ga0307515_10036002 | |||
| 531 | Ga0307513_10005283 | |||
| 532 | Ga0307513_10051534 | |||
| 533 | Ga0307509_10000135 | |||
| 534 | Ga0307509_10024044 | |||
| 535 | Ga0307509_10079640 | |||
| 536 | Ga0307408_100013788 | |||
| 537 | Ga0307508_10000133 | |||
| 538 | Ga0307508_10000616 | |||
| 539 | Ga0307508_10002482 | |||
| 540 | Ga0307514_10001199 | |||
| 541 | Ga0307516_10000677 | |||
| 542 | Ga0307516_10004964 | |||
| 543 | Ga0307516_10006913 | |||
| 544 | Ga0307409_100001800 | |||
| 545 | Ga0307411_10023052 | |||
| 546 | Ga0307510_10004514 | |||
| 547 | Ga0307510_10016068 | |||
| 548 | Ga0373931_0016749 | |||
| 549 | Ga0395899_0043642 | |||
| 550 | Ga0395900_0046497 | |||
| 551 | Ga0395900_0060214 | |||
| 552 | Ga0395905_0001764 | |||
| 553 | Ga0395905_0012470 | |||
| 554 | Ga0395901_0033366 | |||
| 555 | Ga0395901_0038945 | |||
| 556 | Ga0395901_0051852 | |||
| 557 | Ga0436361_0147437 | |||
| 558 | Ga0436361_0518335 | |||
| 559 | Ga0436361_0916410 | |||
| 560 | Ga0436361_1131420 | |||
| 561 | Ga0439462_0002198 | |||
| 562 | Ga0450919_000069 | |||
| 563 | Ga0450892_000365 | |||
| 564 | Ga0439459_0000443 | |||
| 565 | Ga0450916_000897 | |||
| 566 | Ga0450918_000772 | |||
| 567 | Ga0466969_0000023 | |||
| 568 | Ga0453683_0007442 | |||
| 569 | Ga0466966_0003120 | |||
| 570 | Ga0466961_0005290 | |||
| 571 | Ga0466961_0044527 | |||
| 572 | Ga0466959_0000270 | |||
| 573 | Ga0451576_0016862 | |||
| 574 | Ga0451576_0020010 | |||
| 575 | Ga0451576_0125957 | |||
| 576 | Ga0466958_0048434 | |||
| 577 | Ga0466967_0039904 | |||
| 578 | Ga0466967_0066206 | |||
| 579 | Ga0495592_0002137 | |||
| 580 | Ga0495583_0000022 | |||
| 581 | Ga0495606_0001282 | |||
| 582 | Ga0495625_0035346 | |||
| 583 | Ga0495669_0034036 | |||
| 584 | Ga0495649_0000099 | |||
| 585 | Ga0495676_0039312 | |||
| 586 | Ga0495686_0000992 | |||
| 587 | Ga0495593_0046830 | |||
| 588 | Ga0496102_0045029 | |||
| 589 | Ga0496104_0021304 | |||
| 590 | Ga0496106_0010243 | |||
| 591 | Ga0496108_0037893 | |||
| 592 | Ga0496108_0088089 | |||
| 593 | Ga0496113_0029266 | |||
| 594 | Ga0496113_0057403 | |||
| 595 | Ga0496114_0001249 | |||
| 596 | Ga0496115_0084686 | |||
| 597 | Ga0496124_0000089 | |||
| 598 | Ga0496125_0068898 | |||
| 599 | Ga0501198_000003 | |||
| 600 | Ga0501222_000001 | |||
| 601 | Ga0501222_002412 | |||
| 602 | nmdc:mga0k408_18090_c1 | |||
| 603 | nmdc:mga0k408_18507_c1 | |||
| 604 | nmdc:mga0k408_2194_c1 | |||
| 605 | nmdc:mga0k408_33948_c1 | |||
| 606 | nmdc:mga07m45_2131_c1 | |||
| 607 | nmdc:mga07m45_6432_c2 | |||
| 608 | nmdc:mga07m45_7479_c1 | |||
| 609 | nmdc:mga09592_13623_c1 | |||
| 610 | Ga0500578_0000393 | |||
| 611 | Ga0500593_001995 | |||
| 612 | Ga0500652_001236 | |||
| 613 | Ga0500559_0000388 | |||
| 614 | Ga0500568_0024399 | |||
| 615 | Ga0500619_000167 | |||
| 616 | Ga0500622_0004817 | |||
| 617 | Ga0500645_009060 | |||
| 618 | Ga0590071_001162 | |||
| 619 | Ga0466962_0032184 | |||
| 620 | 2587729030 | |||
| 621 | 2587733597 | |||
| 622 | 2587757980 | |||
| 623 | 2588293996 | |||
| 624 | 2643744592 | |||
| 625 | 2643967101 | |||
| 626 | 2644139931 | |||
| 627 | 2644255653 | |||
| 628 | 2644271171 | |||
| 629 | 2644305434 | |||
| 630 | 2644339499 | |||
| 631 | 2739054117 | |||
| 632 | 2831864888 | |||
| 633 | 2886850758 | |||
| 634 | 2928120026 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8eei-assembly1.cif.gz_B | unbound c. ammoniagenes monoamine oxidase (mao) | 0.9365 | 426 | 456 |
| 8eek-assembly2.cif.gz_B | c. ammoniagenes monoamine oxidase (mao) bound to tyramine | 0.9364 | 426 | 456 |
| 6n04-assembly1.cif.gz_A | the x-ray crystal structure of absh3, an fad dependent reductase from the abyssomicin biosynthesis pathway in streptomyces | 0.934 | 425 | 455 |
| 8eek-assembly1.cif.gz_A | c. ammoniagenes monoamine oxidase (mao) bound to tyramine | 0.934 | 426 | 456 |
| 8eef-assembly1.cif.gz_A | c. ammoniagenes monoamine oxidase (mao) bound to octopamine | 0.9334 | 426 | 456 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O05882_87_159_3.30.70.1450 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain | 0.9395 | 600 | 668 | 3.30.70.1450 |
| af_E0AHD3_2_449_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9339 | 424 | 456 | 3.50.50.60 |
| af_P60869_303_372_3.30.70.1450 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain | 0.9336 | 599 | 668 | 3.30.70.1450 |
| af_P9WFZ3_136_217_3.30.70.1450 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain | 0.9299 | 596 | 669 | 3.30.70.1450 |
| af_A0A1D6MVG0_125_298_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.9152 | 225 | 396 | 1.20.1530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529PZQ1-F1-model_v4 | Potassium transporter | 0.9343 | 426 | 537 |
GO:0005886
GO:0006813 GO:0015297 |
| AF-A0A7Y0S198-F1-model_v4 | Glutathione-regulated potassium-efflux system protein KefB | 0.9257 | 455 | 538 |
GO:0005886
GO:0006813 GO:0015297 |
| AF-A0A524PVD3-F1-model_v4 | deleted | 0.9219 | 15 | 401 |
|
| AF-A0A843DLB2-F1-model_v4 | Cation:proton antiporter | 0.9195 | 11 | 363 |
GO:0015297
GO:0016020 GO:1902600 |
| AF-A0A529PZQ1-F1-model_v4 | Potassium transporter | 0.9111 | 426 | 537 |
GO:0005886
GO:0006813 GO:0015297 |