F404282
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 157 | 312 | 409 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0071145|Ga0453684_0071145_1565_2779 |
| Length | 404 |
| Sequence | MFDTGNTGFMLVATSLVMLMTPGLAFFYGGLVGRRNVLSIMIQSFVSMGWTTLLWWLVGYSLVFSGGQGGVIGNLDHAFLRGITPSDALSINNNIPLLVFIAYQMMFAIITPALITGAFANRVKFNAYMIFLTLWLLFVYFPVAHMVWGGGLFASWGVLDFAGGTAVHTTAGFAALASVLFVGRRKVMDRGPHSIPLVALGTALLWFGWYGFNAGSELKVDQITALAFLNTDVAASIAGLTWLFIAWVTEKKPKFVGLLTGAVAGLVAITPAAGYVSLGGAVMIGLLAGSVCYLAVTWKNHLKLDDALDVWGVHGIGGVLGCICTGIFATKVWNPGGADGLLNGGTTFFLVEMLSVVITAVYAFGFSYGALWLINKVTPVTVTKEDEENGLDESLHGETAYEMI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 2 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 21 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 22 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 23 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 26 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 27 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 28 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 29 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 30 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 31 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 32 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 72 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 75 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 76 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 77 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 78 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 81 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 83 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 84 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 85 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 86 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 87 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 88 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 89 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 90 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 91 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 92 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 94 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 95 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 96 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 97 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 98 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 99 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 100 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 101 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 102 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 103 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 104 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 106 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 107 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 109 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 110 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 111 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 112 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 113 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 114 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 115 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 116 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 117 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 146 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 147 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 148 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 149 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 3.15 |
| Rhizosphere | 95.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068869_100010949 | 3300005334 | Bacteria | 5937 |
| 2 | Ga0070660_100000828 | 3300005339 | Bacteria | 20565 |
| 3 | Ga0070687_100035490 | 3300005343 | Bacteria | 2477 |
| 4 | Ga0070669_100205304 | 3300005353 | Bacteria | 1552 |
| 5 | Ga0070671_100012821 | 3300005355 | Bacteria | 6759 |
| 6 | Ga0070703_10005754 | 3300005406 | Bacteria | 3472 |
| 7 | Ga0070714_100000196 | 3300005435 | Bacteria | 49140 |
| 8 | Ga0070705_100039503 | 3300005440 | Bacteria | 2678 |
| 9 | Ga0070705_100107604 | 3300005440 | Bacteria | 1774 |
| 10 | Ga0070694_100085259 | 3300005444 | Bacteria | 2205 |
| 11 | Ga0070694_100094712 | 3300005444 | Bacteria | 2101 |
| 12 | Ga0070708_100000063 | 3300005445 | Bacteria | 69658 |
| 13 | Ga0070708_100001521 | 3300005445 | Bacteria | 17704 |
| 14 | Ga0070708_100008218 | 3300005445 | Bacteria | 8375 |
| 15 | Ga0070708_100067976 | 3300005445 | Bacteria | 3202 |
| 16 | Ga0070708_100082149 | 3300005445 | Bacteria | 2918 |
| 17 | Ga0070708_100092359 | 3300005445 | Bacteria | 2757 |
| 18 | Ga0070708_100105228 | 3300005445 | Bacteria | 2588 |
| 19 | Ga0070706_100001314 | 3300005467 | Bacteria | 26414 |
| 20 | Ga0070706_100006509 | 3300005467 | Bacteria | 11026 |
| 21 | Ga0070706_100008086 | 3300005467 | Bacteria | 9807 |
| 22 | Ga0070706_100054050 | 3300005467 | Bacteria | 3707 |
| 23 | Ga0070706_100062937 | 3300005467 | Bacteria | 3428 |
| 24 | Ga0070706_100145415 | 3300005467 | Bacteria | 2214 |
| 25 | Ga0070707_100001481 | 3300005468 | Bacteria | 22944 |
| 26 | Ga0070707_100007759 | 3300005468 | Bacteria | 9971 |
| 27 | Ga0070707_100017529 | 3300005468 | Bacteria | 6735 |
| 28 | Ga0070707_100028028 | 3300005468 | Bacteria | 5357 |
| 29 | Ga0070707_100263716 | 3300005468 | Bacteria | 1676 |
| 30 | Ga0070707_100355072 | 3300005468 | Bacteria | 1424 |
| 31 | Ga0070698_100005046 | 3300005471 | Bacteria | 14469 |
| 32 | Ga0070698_100041012 | 3300005471 | Bacteria | 4755 |
| 33 | Ga0070698_100044439 | 3300005471 | Bacteria | 4549 |
| 34 | Ga0070698_100051441 | 3300005471 | Bacteria | 4196 |
| 35 | Ga0070698_100078856 | 3300005471 | Bacteria | 3291 |
| 36 | Ga0070698_100121996 | 3300005471 | Bacteria | 2565 |
| 37 | Ga0070698_100136248 | 3300005471 | Bacteria | 2409 |
| 38 | Ga0070698_100192455 | 3300005471 | Bacteria | 1977 |
| 39 | Ga0070699_100007668 | 3300005518 | Bacteria | 9384 |
| 40 | Ga0070697_100046821 | 3300005536 | Bacteria | 3506 |
| 41 | Ga0070697_100058339 | 3300005536 | Bacteria | 3142 |
| 42 | Ga0070697_100128634 | 3300005536 | Bacteria | 2123 |
| 43 | Ga0070697_100148863 | 3300005536 | Bacteria | 1972 |
| 44 | Ga0070686_100136292 | 3300005544 | Bacteria | 1704 |
| 45 | Ga0070695_100008901 | 3300005545 | Bacteria | 5962 |
| 46 | Ga0070695_100011609 | 3300005545 | Bacteria | 5271 |
| 47 | Ga0070695_100049191 | 3300005545 | Bacteria | 2699 |
| 48 | Ga0070695_100155537 | 3300005545 | Bacteria | 1599 |
| 49 | Ga0070696_100000468 | 3300005546 | Bacteria | 25299 |
| 50 | Ga0070704_100001768 | 3300005549 | Bacteria | 11835 |
| 51 | Ga0070704_100003932 | 3300005549 | Bacteria | 8556 |
| 52 | Ga0070704_100166919 | 3300005549 | Bacteria | 1746 |
| 53 | Ga0068852_100199567 | 3300005616 | Bacteria | 1893 |
| 54 | Ga0068863_100064530 | 3300005841 | Unclassified | 3463 |
| 55 | Ga0068860_100007093 | 3300005843 | Bacteria | 11209 |
| 56 | Ga0070715_10021700 | 3300006163 | Bacteria | 2494 |
| 57 | Ga0097621_100015074 | 3300006237 | Bacteria | 5804 |
| 58 | Ga0097621_100021726 | 3300006237 | Unclassified | 4971 |
| 59 | Ga0097621_100061839 | 3300006237 | Bacteria | 3072 |
| 60 | Ga0068871_100084951 | 3300006358 | Bacteria | 2627 |
| 61 | Ga0068871_100093548 | 3300006358 | Bacteria | 2508 |
| 62 | Ga0075428_100008398 | 3300006844 | Bacteria | 11449 |
| 63 | Ga0075433_10091673 | 3300006852 | Bacteria | 2687 |
| 64 | Ga0075433_10192006 | 3300006852 | Bacteria | 1817 |
| 65 | Ga0075433_10253249 | 3300006852 | Bacteria | 1562 |
| 66 | Ga0075434_100000439 | 3300006871 | Bacteria | 30907 |
| 67 | Ga0075434_100002871 | 3300006871 | Bacteria | 15286 |
| 68 | Ga0075434_100010214 | 3300006871 | Bacteria | 8792 |
| 69 | Ga0075434_100012468 | 3300006871 | Bacteria | 8062 |
| 70 | Ga0075434_100223773 | 3300006871 | Bacteria | 1901 |
| 71 | Ga0075436_100000020 | 3300006914 | Bacteria | 124822 |
| 72 | Ga0075436_100037177 | 3300006914 | Bacteria | 3361 |
| 73 | Ga0075436_100176785 | 3300006914 | Bacteria | 1508 |
| 74 | Ga0075435_100000165 | 3300007076 | Bacteria | 38337 |
| 75 | Ga0075435_100013081 | 3300007076 | Bacteria | 6163 |
| 76 | Ga0075435_100016803 | 3300007076 | Bacteria | 5522 |
| 77 | Ga0099795_10000175 | 3300007788 | Bacteria | 10606 |
| 78 | Ga0114129_10001385 | 3300009147 | Bacteria | 32641 |
| 79 | Ga0114129_10083452 | 3300009147 | Bacteria | 4438 |
| 80 | Ga0105243_10096344 | 3300009148 | Bacteria | 2447 |
| 81 | Ga0105248_10002765 | 3300009177 | Bacteria | 19495 |
| 82 | Ga0105248_10354700 | 3300009177 | Bacteria | 1651 |
| 83 | Ga0099796_10003228 | 3300010159 | Bacteria | 3743 |
| 84 | Ga0105239_10041887 | 3300010375 | Bacteria | 5018 |
| 85 | Ga0105239_10093691 | 3300010375 | Bacteria | 3317 |
| 86 | Ga0105246_10043803 | 3300011119 | Bacteria | 3038 |
| 87 | Ga0157374_10038459 | 3300013296 | Unclassified | 4398 |
| 88 | Ga0157374_10044521 | 3300013296 | Bacteria | 4103 |
| 89 | Ga0157374_10086803 | 3300013296 | Bacteria | 2977 |
| 90 | Ga0157378_10010501 | 3300013297 | Bacteria | 8091 |
| 91 | Ga0157378_10049832 | 3300013297 | Bacteria | 3726 |
| 92 | Ga0157378_10178615 | 3300013297 | Bacteria | 1995 |
| 93 | Ga0157378_10288787 | 3300013297 | Unclassified | 1583 |
| 94 | Ga0163162_10031134 | 3300013306 | Bacteria | 5290 |
| 95 | Ga0163162_10053474 | 3300013306 | Bacteria | 4059 |
| 96 | Ga0163162_10374932 | 3300013306 | Bacteria | 1556 |
| 97 | Ga0157375_10008724 | 3300013308 | Bacteria | 8881 |
| 98 | Ga0157375_10031615 | 3300013308 | Bacteria | 5007 |
| 99 | Ga0157376_10023132 | 3300014969 | Bacteria | 4859 |
| 100 | Ga0207697_10000440 | 3300025315 | Bacteria | 23431 |
| 101 | Ga0207653_10010720 | 3300025885 | Bacteria | 2859 |
| 102 | Ga0207688_10035997 | 3300025901 | Bacteria | 2742 |
| 103 | Ga0207685_10018582 | 3300025905 | Bacteria | 2272 |
| 104 | Ga0207645_10047862 | 3300025907 | Bacteria | 2730 |
| 105 | Ga0207684_10000741 | 3300025910 | Bacteria | 38273 |
| 106 | Ga0207684_10004841 | 3300025910 | Bacteria | 12598 |
| 107 | Ga0207684_10022208 | 3300025910 | Bacteria | 5420 |
| 108 | Ga0207684_10034179 | 3300025910 | Bacteria | 4321 |
| 109 | Ga0207684_10159462 | 3300025910 | Bacteria | 1942 |
| 110 | Ga0207684_10198277 | 3300025910 | Bacteria | 1732 |
| 111 | Ga0207663_10111059 | 3300025916 | Bacteria | 1860 |
| 112 | Ga0207662_10134600 | 3300025918 | Bacteria | 1561 |
| 113 | Ga0207657_10006612 | 3300025919 | Bacteria | 11998 |
| 114 | Ga0207646_10005316 | 3300025922 | Bacteria | 13573 |
| 115 | Ga0207646_10006501 | 3300025922 | Bacteria | 12067 |
| 116 | Ga0207646_10028331 | 3300025922 | Bacteria | 5100 |
| 117 | Ga0207646_10038899 | 3300025922 | Bacteria | 4281 |
| 118 | Ga0207646_10040915 | 3300025922 | Bacteria | 4167 |
| 119 | Ga0207646_10069558 | 3300025922 | Bacteria | 3144 |
| 120 | Ga0207646_10145238 | 3300025922 | Bacteria | 2138 |
| 121 | Ga0207646_10167987 | 3300025922 | Bacteria | 1981 |
| 122 | Ga0207681_10040061 | 3300025923 | Bacteria | 3115 |
| 123 | Ga0207681_10043848 | 3300025923 | Bacteria | 2995 |
| 124 | Ga0207650_10023180 | 3300025925 | Unclassified | 4402 |
| 125 | Ga0207650_10043366 | 3300025925 | Unclassified | 3302 |
| 126 | Ga0207659_10042244 | 3300025926 | Bacteria | 3196 |
| 127 | Ga0207664_10000075 | 3300025929 | Bacteria | 102649 |
| 128 | Ga0207709_10192621 | 3300025935 | Bacteria | 1449 |
| 129 | Ga0207670_10050629 | 3300025936 | Unclassified | 2785 |
| 130 | Ga0207669_10112727 | 3300025937 | Unclassified | 1826 |
| 131 | Ga0207704_10089244 | 3300025938 | Bacteria | 2020 |
| 132 | Ga0207665_10148022 | 3300025939 | Bacteria | 1679 |
| 133 | Ga0207691_10001256 | 3300025940 | Bacteria | 25380 |
| 134 | Ga0207711_10013775 | 3300025941 | Bacteria | 6713 |
| 135 | Ga0207711_10256674 | 3300025941 | Bacteria | 1606 |
| 136 | Ga0207689_10022868 | 3300025942 | Bacteria | 5251 |
| 137 | Ga0207679_10070513 | 3300025945 | Bacteria | 2633 |
| 138 | Ga0207651_10044547 | 3300025960 | Bacteria | 2970 |
| 139 | Ga0207658_10022183 | 3300025986 | Bacteria | 4418 |
| 140 | Ga0207648_10041752 | 3300026089 | Bacteria | 4028 |
| 141 | Ga0207676_10145854 | 3300026095 | Unclassified | 2033 |
| 142 | Ga0209179_1000008 | 3300027512 | Bacteria | 92811 |
| 143 | Ga0265356_1006300 | 3300028017 | Bacteria | 1390 |
| 144 | Ga0268266_10061196 | 3300028379 | Unclassified | 3246 |
| 145 | Ga0268264_10000964 | 3300028381 | Bacteria | 29492 |
| 146 | Ga0265319_1008111 | 3300028563 | Bacteria | 4636 |
| 147 | Ga0265318_10001168 | 3300028577 | Bacteria | 16266 |
| 148 | Ga0265318_10054903 | 3300028577 | Bacteria | 1492 |
| 149 | Ga0265323_10016330 | 3300028653 | Bacteria | 2900 |
| 150 | Ga0265322_10029942 | 3300028654 | Bacteria | 1555 |
| 151 | Ga0265338_10014497 | 3300028800 | Bacteria | 8770 |
| 152 | Ga0265338_10060756 | 3300028800 | Bacteria | 3317 |
| 153 | Ga0265338_10103533 | 3300028800 | Bacteria | 2312 |
| 154 | Ga0265760_10000023 | 3300031090 | Bacteria | 67653 |
| 155 | Ga0265330_10000013 | 3300031235 | Bacteria | 177129 |
| 156 | Ga0265330_10004200 | 3300031235 | Bacteria | 7346 |
| 157 | Ga0265330_10009208 | 3300031235 | Archaea | 4702 |
| 158 | Ga0265330_10036229 | 3300031235 | Bacteria | 2199 |
| 159 | Ga0265332_10000019 | 3300031238 | Bacteria | 222130 |
| 160 | Ga0265332_10006076 | 3300031238 | Bacteria | 5514 |
| 161 | Ga0265328_10016135 | 3300031239 | Unclassified | 2910 |
| 162 | Ga0265328_10032477 | 3300031239 | Bacteria | 1937 |
| 163 | Ga0265320_10003888 | 3300031240 | Bacteria | 9881 |
| 164 | Ga0265320_10043849 | 3300031240 | Bacteria | 2208 |
| 165 | Ga0265320_10059189 | 3300031240 | Bacteria | 1832 |
| 166 | Ga0265325_10022354 | 3300031241 | Unclassified | 3465 |
| 167 | Ga0265325_10030333 | 3300031241 | Bacteria | 2900 |
| 168 | Ga0265329_10000158 | 3300031242 | Bacteria | 33656 |
| 169 | Ga0265329_10008198 | 3300031242 | Bacteria | 3979 |
| 170 | Ga0265329_10010160 | 3300031242 | Bacteria | 3472 |
| 171 | Ga0265329_10022439 | 3300031242 | Unclassified | 2112 |
| 172 | Ga0265340_10000054 | 3300031247 | Bacteria | 53196 |
| 173 | Ga0265339_10002925 | 3300031249 | Bacteria | 12079 |
| 174 | Ga0265339_10030898 | 3300031249 | Bacteria | 3030 |
| 175 | Ga0265339_10069315 | 3300031249 | Bacteria | 1883 |
| 176 | Ga0265339_10084110 | 3300031249 | Bacteria | 1677 |
| 177 | Ga0265339_10091879 | 3300031249 | Bacteria | 1590 |
| 178 | Ga0265331_10008601 | 3300031250 | Bacteria | 5794 |
| 179 | Ga0265331_10015833 | 3300031250 | Bacteria | 3971 |
| 180 | Ga0265327_10001154 | 3300031251 | Bacteria | 35969 |
| 181 | Ga0265327_10001197 | 3300031251 | Bacteria | 35118 |
| 182 | Ga0265327_10069177 | 3300031251 | Bacteria | 1773 |
| 183 | Ga0265316_10000111 | 3300031344 | Bacteria | 87754 |
| 184 | Ga0265316_10001132 | 3300031344 | Bacteria | 28928 |
| 185 | Ga0265316_10002105 | 3300031344 | Bacteria | 20934 |
| 186 | Ga0265316_10051931 | 3300031344 | Bacteria | 3218 |
| 187 | Ga0265316_10072565 | 3300031344 | Bacteria | 2651 |
| 188 | Ga0265316_10124314 | 3300031344 | Bacteria | 1947 |
| 189 | Ga0265313_10000079 | 3300031595 | Bacteria | 95515 |
| 190 | Ga0265314_10000004 | 3300031711 | Bacteria | 939480 |
| 191 | Ga0265314_10008584 | 3300031711 | Bacteria | 8737 |
| 192 | Ga0265314_10010051 | 3300031711 | Bacteria | 7932 |
| 193 | Ga0265314_10016437 | 3300031711 | Bacteria | 5843 |
| 194 | Ga0265314_10023798 | 3300031711 | Bacteria | 4659 |
| 195 | Ga0265314_10031118 | 3300031711 | Bacteria | 3944 |
| 196 | Ga0265314_10050550 | 3300031711 | Bacteria | 2902 |
| 197 | Ga0265342_10000017 | 3300031712 | Bacteria | 180644 |
| 198 | Ga0265342_10000826 | 3300031712 | Bacteria | 31085 |
| 199 | Ga0265342_10003379 | 3300031712 | Bacteria | 13156 |
| 200 | Ga0265342_10020894 | 3300031712 | Bacteria | 4188 |
| 201 | Ga0265342_10039411 | 3300031712 | Bacteria | 2871 |
| 202 | Ga0265342_10049134 | 3300031712 | Bacteria | 2526 |
| 203 | Ga0265342_10052824 | 3300031712 | Bacteria | 2420 |
| 204 | Ga0316576_10118090 | 3300031727 | Bacteria | 1991 |
| 205 | Ga0316578_10000346 | 3300031728 | Bacteria | 14661 |
| 206 | Ga0316577_10000243 | 3300031733 | Bacteria | 19056 |
| 207 | Ga0316577_10045884 | 3300031733 | Bacteria | 2442 |
| 208 | Ga0316583_10000916 | 3300032133 | Bacteria | 9490 |
| 209 | Ga0373936_0000014 | 3300035113 | Bacteria | 202828 |
| 210 | Ga0373957_0003515 | 3300035120 | Bacteria | 4645 |
| 211 | Ga0316574_0023684 | 3300035398 | Bacteria | 3668 |
| 212 | Ga0373935_0014856 | 3300035692 | Bacteria | 4702 |
| 213 | Ga0373933_0137825 | 3300035724 | Bacteria | 1538 |
| 214 | Ga0373947_0077439 | 3300035725 | Bacteria | 2051 |
| 215 | Ga0373937_0025722 | 3300036401 | Bacteria | 5315 |
| 216 | Ga0373937_0194259 | 3300036401 | Bacteria | 1907 |
| 217 | Ga0373937_0238812 | 3300036401 | Bacteria | 1712 |
| 218 | Ga0373937_0277151 | 3300036401 | Bacteria | 1583 |
| 219 | Ga0316582_0005765 | 3300036647 | Bacteria | 6425 |
| 220 | Ga0316582_0017309 | 3300036647 | Bacteria | 4168 |
| 221 | Ga0316582_0076246 | 3300036647 | Bacteria | 2180 |
| 222 | Ga0316582_0120585 | 3300036647 | Bacteria | 1754 |
| 223 | Ga0316584_0003817 | 3300036712 | Bacteria | 9873 |
| 224 | Ga0316584_0077329 | 3300036712 | Bacteria | 2493 |
| 225 | Ga0373925_0283014 | 3300037068 | Bacteria | 1336 |
| 226 | Ga0373925_0312106 | 3300037068 | Bacteria | 1271 |
| 227 | Ga0316581_0004997 | 3300037588 | Bacteria | 3420 |
| 228 | Ga0436364_1219943 | 3300037853 | Bacteria | 1659 |
| 229 | Ga0400490_31137 | 3300038726 | Bacteria | 6129 |
| 230 | Ga0400489_28134 | 3300039093 | Unclassified | 1474 |
| 231 | Ga0451839_1427272 | 3300041496 | Bacteria | 1685 |
| 232 | Ga0451577_0013161 | 3300042876 | Bacteria | 7753 |
| 233 | Ga0451577_0032893 | 3300042876 | Bacteria | 4674 |
| 234 | Ga0451577_0339917 | 3300042876 | Bacteria | 1361 |
| 235 | Ga0453683_0008029 | 3300044673 | Bacteria | 7108 |
| 236 | Ga0453683_0036876 | 3300044673 | Bacteria | 3076 |
| 237 | Ga0453683_0050330 | 3300044673 | Bacteria | 2610 |
| 238 | Ga0453684_0000312 | 3300044712 | Bacteria | 206476 |
| 239 | Ga0453684_0025926 | 3300044712 | Bacteria | 8490 |
| 240 | Ga0453684_0071145 | 3300044712 | Bacteria | 4400 |
| 241 | Ga0453684_0268687 | 3300044712 | Bacteria | 1950 |
| 242 | Ga0453684_0278632 | 3300044712 | Bacteria | 1908 |
| 243 | Ga0451576_0004821 | 3300045051 | Bacteria | 17270 |
| 244 | Ga0451576_0021540 | 3300045051 | Bacteria | 7006 |
| 245 | Ga0451576_0349752 | 3300045051 | Bacteria | 1547 |
| 246 | Ga0451576_0463179 | 3300045051 | Bacteria | 1331 |
| 247 | Ga0495592_0080678 | 3300046454 | Bacteria | 2353 |
| 248 | Ga0495603_0112794 | 3300046455 | Bacteria | 1585 |
| 249 | Ga0495629_0033748 | 3300046459 | Bacteria | 3619 |
| 250 | Ga0495651_0054755 | 3300046462 | Bacteria | 3066 |
| 251 | Ga0495639_0084669 | 3300046475 | Bacteria | 1481 |
| 252 | Ga0495594_0010987 | 3300046499 | Bacteria | 4701 |
| 253 | Ga0495594_0019052 | 3300046499 | Bacteria | 3644 |
| 254 | Ga0495594_0103700 | 3300046499 | Bacteria | 1601 |
| 255 | Ga0495608_0008045 | 3300046511 | Bacteria | 7410 |
| 256 | Ga0495608_0186347 | 3300046511 | Bacteria | 1311 |
| 257 | Ga0495618_0000201 | 3300046514 | Bacteria | 42727 |
| 258 | Ga0495628_0226556 | 3300046516 | Bacteria | 1402 |
| 259 | Ga0495630_0000002 | 3300046517 | Bacteria | 1277125 |
| 260 | Ga0495630_0104889 | 3300046517 | Bacteria | 2140 |
| 261 | Ga0495652_0037149 | 3300046529 | Bacteria | 4228 |
| 262 | Ga0495652_0069824 | 3300046529 | Bacteria | 2939 |
| 263 | Ga0495640_0160163 | 3300046533 | Bacteria | 1443 |
| 264 | Ga0495586_0108662 | 3300046535 | Bacteria | 1543 |
| 265 | Ga0495586_0128046 | 3300046535 | Bacteria | 1421 |
| 266 | Ga0495587_0002486 | 3300046536 | Bacteria | 12300 |
| 267 | Ga0495645_0041550 | 3300046543 | Bacteria | 3353 |
| 268 | Ga0495645_0044100 | 3300046543 | Bacteria | 3253 |
| 269 | Ga0495645_0126302 | 3300046543 | Bacteria | 1797 |
| 270 | Ga0495667_0085965 | 3300046559 | Bacteria | 2040 |
| 271 | Ga0495635_0067946 | 3300046663 | Bacteria | 2444 |
| 272 | Ga0495635_0174386 | 3300046663 | Bacteria | 1462 |
| 273 | Ga0495657_0037976 | 3300046675 | Bacteria | 3315 |
| 274 | Ga0495646_0039878 | 3300046680 | Bacteria | 2894 |
| 275 | Ga0495624_0195783 | 3300046690 | Bacteria | 1228 |
| 276 | Ga0495676_0038011 | 3300047321 | Bacteria | 4001 |
| 277 | Ga0495680_0013137 | 3300047322 | Bacteria | 7237 |
| 278 | Ga0495675_0078444 | 3300047444 | Bacteria | 2080 |
| 279 | Ga0495684_0009101 | 3300047471 | Bacteria | 7671 |
| 280 | Ga0495684_0030471 | 3300047471 | Bacteria | 4142 |
| 281 | Ga0495684_0035259 | 3300047471 | Bacteria | 3837 |
| 282 | Ga0496102_0009922 | 3300048905 | Bacteria | 8191 |
| 283 | Ga0496103_0189184 | 3300048906 | Bacteria | 1323 |
| 284 | Ga0496106_0006924 | 3300048909 | Bacteria | 8387 |
| 285 | Ga0496109_0277935 | 3300048912 | Bacteria | 1578 |
| 286 | Ga0496111_0171378 | 3300048914 | Bacteria | 1613 |
| 287 | Ga0496112_0000007 | 3300048915 | Bacteria | 338850 |
| 288 | Ga0496112_0159282 | 3300048915 | Bacteria | 2224 |
| 289 | Ga0496112_0254335 | 3300048915 | Bacteria | 1707 |
| 290 | Ga0496114_0000004 | 3300048917 | Bacteria | 591126 |
| 291 | Ga0496115_0047037 | 3300048918 | Bacteria | 3449 |
| 292 | nmdc:mga05p37_104_c1 | 3300050507 | Bacteria | 76602 |
| 293 | nmdc:mga05p37_144204_c1 | 3300050507 | Bacteria | 2917 |
| 294 | nmdc:mga05p37_82144_c1 | 3300050507 | Bacteria | 3970 |
| 295 | nmdc:mga0n895_1373_c1 | 3300050512 | Bacteria | 18105 |
| 296 | nmdc:mga0n895_4475_c1 | 3300050512 | Bacteria | 11483 |
| 297 | nmdc:mga0rr50_139_c1 | 3300050513 | Bacteria | 40055 |
| 298 | nmdc:mga0rr50_217263_c1 | 3300050513 | Bacteria | 1577 |
| 299 | nmdc:mga0rr50_22907_c1 | 3300050513 | Bacteria | 4296 |
| 300 | nmdc:mga0rr50_653_c1 | 3300050513 | Bacteria | 18639 |
| 301 | nmdc:mga08x19_3_c1 | 3300050514 | Bacteria | 654433 |
| 302 | nmdc:mga08x19_66307_c1 | 3300050514 | Bacteria | 2346 |
| 303 | nmdc:mga0a205_19116_c1 | 3300050515 | Bacteria | 6458 |
| 304 | nmdc:mga0a205_259310_c1 | 3300050515 | Bacteria | 1616 |
| 305 | nmdc:mga0a205_2781_c1 | 3300050515 | Bacteria | 15465 |
| 306 | nmdc:mga0a205_335481_c1 | 3300050515 | Bacteria | 1381 |
| 307 | nmdc:mga0a205_95197_c1 | 3300050515 | Bacteria | 2876 |
| 308 | Ga0495612_0001407 | 3300053078 | Bacteria | 9900 |
| 309 | Ga0495655_0003363 | 3300053083 | Bacteria | 2635 |
| 310 | Ga0495619_0019039 | 3300053085 | Bacteria | 4361 |
| 311 | Ga0495619_0165554 | 3300053085 | Bacteria | 1528 |
| 312 | Ga0500616_0000497 | 3300053153 | Bacteria | 50378 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031712 | Ga0265342_10049134 | Ga0265342_100491341 | 355 |
| 2 | 3300042876 | Ga0451577_0339917 | Ga0451577_0339917_11_1105 | 356 |
| 3 | 3300037068 | Ga0373925_0283014 | Ga0373925_0283014_24_1145 | 362 |
| 4 | 3300046511 | Ga0495608_0186347 | Ga0495608_0186347_156_1289 | 366 |
| 5 | 3300046535 | Ga0495586_0128046 | Ga0495586_0128046_285_1409 | 366 |
| 6 | 3300031728 | Ga0316578_10000346 | Ga0316578_100003464 | 368 |
| 7 | 3300031733 | Ga0316577_10000243 | Ga0316577_1000024315 | 368 |
| 8 | 3300035398 | Ga0316574_0023684 | Ga0316574_0023684_646_1854 | 368 |
| 9 | 3300046499 | Ga0495594_0103700 | Ga0495594_0103700_26_1204 | 368 |
| 10 | 3300036647 | Ga0316582_0017309 | Ga0316582_0017309_2472_3677 | 371 |
| 11 | 3300036712 | Ga0316584_0003817 | Ga0316584_0003817_3167_4372 | 371 |
| 12 | 3300037588 | Ga0316581_0004997 | Ga0316581_0004997_1902_3107 | 371 |
| 13 | 3300037068 | Ga0373925_0312106 | Ga0373925_0312106_59_1258 | 379 |
| 14 | 3300031240 | Ga0265320_10043849 | Ga0265320_100438492 | 383 |
| 15 | 3300031249 | Ga0265339_10091879 | Ga0265339_100918791 | 383 |
| 16 | 3300045051 | Ga0451576_0349752 | Ga0451576_0349752_295_1470 | 383 |
| 17 | 3300046663 | Ga0495635_0174386 | Ga0495635_0174386_26_1237 | 383 |
| 18 | 3300009147 | Ga0114129_10083452 | Ga0114129_100834524 | 386 |
| 19 | 3300028577 | Ga0265318_10001168 | Ga0265318_100011683 | 386 |
| 20 | 3300031240 | Ga0265320_10003888 | Ga0265320_100038884 | 386 |
| 21 | 3300031242 | Ga0265329_10022439 | Ga0265329_100224392 | 386 |
| 22 | 3300031249 | Ga0265339_10002925 | Ga0265339_1000292510 | 386 |
| 23 | 3300031250 | Ga0265331_10015833 | Ga0265331_100158332 | 386 |
| 24 | 3300031712 | Ga0265342_10003379 | Ga0265342_1000337914 | 386 |
| 25 | 3300045051 | Ga0451576_0463179 | Ga0451576_0463179_15_1199 | 386 |
| 26 | 3300005471 | Ga0070698_100136248 | Ga0070698_1001362482 | 387 |
| 27 | 3300009147 | Ga0114129_10001385 | Ga0114129_1000138523 | 387 |
| 28 | 3300046454 | Ga0495592_0080678 | Ga0495592_0080678_187_1374 | 387 |
| 29 | 3300046511 | Ga0495608_0008045 | Ga0495608_0008045_5454_6641 | 387 |
| 30 | 3300046516 | Ga0495628_0226556 | Ga0495628_0226556_14_1201 | 387 |
| 31 | 3300046536 | Ga0495587_0002486 | Ga0495587_0002486_9977_11164 | 387 |
| 32 | 3300046559 | Ga0495667_0085965 | Ga0495667_0085965_84_1271 | 387 |
| 33 | 3300046675 | Ga0495657_0037976 | Ga0495657_0037976_362_1549 | 387 |
| 34 | 3300053085 | Ga0495619_0165554 | Ga0495619_0165554_77_1264 | 387 |
| 35 | 3300046690 | Ga0495624_0195783 | Ga0495624_0195783_28_1218 | 388 |
| 36 | 3300005546 | Ga0070696_100000468 | Ga0070696_1000004685 | 390 |
| 37 | 3300031733 | Ga0316577_10045884 | Ga0316577_100458841 | 391 |
| 38 | 3300036647 | Ga0316582_0005765 | Ga0316582_0005765_2319_3521 | 391 |
| 39 | 3300036712 | Ga0316584_0077329 | Ga0316584_0077329_577_1779 | 391 |
| 40 | 3300036647 | Ga0316582_0120585 | Ga0316582_0120585_98_1303 | 393 |
| 41 | 3300006852 | Ga0075433_10253249 | Ga0075433_102532491 | 394 |
| 42 | 3300031235 | Ga0265330_10009208 | Ga0265330_100092082 | 394 |
| 43 | 3300031242 | Ga0265329_10008198 | Ga0265329_100081982 | 394 |
| 44 | 3300031344 | Ga0265316_10002105 | Ga0265316_1000210512 | 394 |
| 45 | 3300031712 | Ga0265342_10000826 | Ga0265342_1000082615 | 394 |
| 46 | 3300032133 | Ga0316583_10000916 | Ga0316583_100009168 | 394 |
| 47 | 3300046543 | Ga0495645_0044100 | Ga0495645_0044100_123_1331 | 394 |
| 48 | 3300047322 | Ga0495680_0013137 | Ga0495680_0013137_2728_3936 | 394 |
| 49 | 3300031235 | Ga0265330_10036229 | Ga0265330_100362291 | 395 |
| 50 | 3300031344 | Ga0265316_10072565 | Ga0265316_100725652 | 395 |
| 51 | 3300031712 | Ga0265342_10052824 | Ga0265342_100528242 | 395 |
| 52 | 3300038726 | Ga0400490_31137 | Ga0400490_31137_1002_2216 | 395 |
| 53 | 3300031235 | Ga0265330_10000013 | Ga0265330_10000013125 | 396 |
| 54 | 3300031238 | Ga0265332_10000019 | Ga0265332_10000019109 | 396 |
| 55 | 3300031239 | Ga0265328_10016135 | Ga0265328_100161352 | 396 |
| 56 | 3300031241 | Ga0265325_10030333 | Ga0265325_100303333 | 396 |
| 57 | 3300031242 | Ga0265329_10000158 | Ga0265329_1000015812 | 396 |
| 58 | 3300031247 | Ga0265340_10000054 | Ga0265340_1000005449 | 396 |
| 59 | 3300031250 | Ga0265331_10008601 | Ga0265331_100086014 | 396 |
| 60 | 3300031251 | Ga0265327_10069177 | Ga0265327_100691772 | 396 |
| 61 | 3300031344 | Ga0265316_10000111 | Ga0265316_1000011149 | 396 |
| 62 | 3300031344 | Ga0265316_10001132 | Ga0265316_100011323 | 396 |
| 63 | 3300031711 | Ga0265314_10000004 | Ga0265314_10000004422 | 396 |
| 64 | 3300031712 | Ga0265342_10000017 | Ga0265342_1000001728 | 396 |
| 65 | 3300031727 | Ga0316576_10118090 | Ga0316576_101180902 | 396 |
| 66 | 3300035113 | Ga0373936_0000014 | Ga0373936_0000014_77950_79167 | 396 |
| 67 | 3300036647 | Ga0316582_0076246 | Ga0316582_0076246_457_1671 | 396 |
| 68 | 3300037853 | Ga0436364_1219943 | Ga0436364_1219943_235_1464 | 396 |
| 69 | 3300044712 | Ga0453684_0071145 | Ga0453684_0071145_1565_2779 | 396 |
| 70 | 3300046499 | Ga0495594_0010987 | Ga0495594_0010987_3083_4297 | 396 |
| 71 | 3300005339 | Ga0070660_100000828 | Ga0070660_10000082815 | 397 |
| 72 | 3300005440 | Ga0070705_100107604 | Ga0070705_1001076041 | 397 |
| 73 | 3300005445 | Ga0070708_100000063 | Ga0070708_10000006332 | 397 |
| 74 | 3300005468 | Ga0070707_100355072 | Ga0070707_1003550721 | 397 |
| 75 | 3300005471 | Ga0070698_100041012 | Ga0070698_1000410123 | 397 |
| 76 | 3300025916 | Ga0207663_10111059 | Ga0207663_101110592 | 397 |
| 77 | 3300025919 | Ga0207657_10006612 | Ga0207657_100066127 | 397 |
| 78 | 3300025922 | Ga0207646_10145238 | Ga0207646_101452381 | 397 |
| 79 | 3300025922 | Ga0207646_10167987 | Ga0207646_101679871 | 397 |
| 80 | 3300028017 | Ga0265356_1006300 | Ga0265356_10063001 | 397 |
| 81 | 3300028654 | Ga0265322_10029942 | Ga0265322_100299421 | 397 |
| 82 | 3300028800 | Ga0265338_10014497 | Ga0265338_100144975 | 397 |
| 83 | 3300028800 | Ga0265338_10060756 | Ga0265338_100607562 | 397 |
| 84 | 3300031090 | Ga0265760_10000023 | Ga0265760_1000002343 | 397 |
| 85 | 3300031241 | Ga0265325_10022354 | Ga0265325_100223541 | 397 |
| 86 | 3300031249 | Ga0265339_10030898 | Ga0265339_100308982 | 397 |
| 87 | 3300031249 | Ga0265339_10084110 | Ga0265339_100841101 | 397 |
| 88 | 3300031344 | Ga0265316_10051931 | Ga0265316_100519314 | 397 |
| 89 | 3300031344 | Ga0265316_10124314 | Ga0265316_101243142 | 397 |
| 90 | 3300031711 | Ga0265314_10016437 | Ga0265314_100164374 | 397 |
| 91 | 3300031711 | Ga0265314_10050550 | Ga0265314_100505502 | 397 |
| 92 | 3300036401 | Ga0373937_0238812 | Ga0373937_0238812_333_1550 | 397 |
| 93 | 3300039093 | Ga0400489_28134 | Ga0400489_28134_185_1429 | 397 |
| 94 | 3300005435 | Ga0070714_100000196 | Ga0070714_10000019629 | 398 |
| 95 | 3300005444 | Ga0070694_100085259 | Ga0070694_1000852593 | 398 |
| 96 | 3300005445 | Ga0070708_100105228 | Ga0070708_1001052282 | 398 |
| 97 | 3300005467 | Ga0070706_100001314 | Ga0070706_10000131422 | 398 |
| 98 | 3300005468 | Ga0070707_100017529 | Ga0070707_1000175297 | 398 |
| 99 | 3300005471 | Ga0070698_100044439 | Ga0070698_1000444396 | 398 |
| 100 | 3300005471 | Ga0070698_100051441 | Ga0070698_1000514411 | 398 |
| 101 | 3300005536 | Ga0070697_100128634 | Ga0070697_1001286341 | 398 |
| 102 | 3300005545 | Ga0070695_100008901 | Ga0070695_1000089012 | 398 |
| 103 | 3300005545 | Ga0070695_100155537 | Ga0070695_1001555371 | 398 |
| 104 | 3300005549 | Ga0070704_100166919 | Ga0070704_1001669192 | 398 |
| 105 | 3300006163 | Ga0070715_10021700 | Ga0070715_100217002 | 398 |
| 106 | 3300006237 | Ga0097621_100061839 | Ga0097621_1000618391 | 398 |
| 107 | 3300006358 | Ga0068871_100084951 | Ga0068871_1000849512 | 398 |
| 108 | 3300006844 | Ga0075428_100008398 | Ga0075428_1000083986 | 398 |
| 109 | 3300006852 | Ga0075433_10091673 | Ga0075433_100916733 | 398 |
| 110 | 3300006852 | Ga0075433_10192006 | Ga0075433_101920062 | 398 |
| 111 | 3300006871 | Ga0075434_100000439 | Ga0075434_10000043918 | 398 |
| 112 | 3300006871 | Ga0075434_100010214 | Ga0075434_1000102146 | 398 |
| 113 | 3300006871 | Ga0075434_100012468 | Ga0075434_1000124686 | 398 |
| 114 | 3300006871 | Ga0075434_100223773 | Ga0075434_1002237732 | 398 |
| 115 | 3300007076 | Ga0075435_100013081 | Ga0075435_1000130812 | 398 |
| 116 | 3300025905 | Ga0207685_10018582 | Ga0207685_100185822 | 398 |
| 117 | 3300025910 | Ga0207684_10000741 | Ga0207684_1000074133 | 398 |
| 118 | 3300025910 | Ga0207684_10022208 | Ga0207684_100222084 | 398 |
| 119 | 3300025910 | Ga0207684_10034179 | Ga0207684_100341791 | 398 |
| 120 | 3300025910 | Ga0207684_10198277 | Ga0207684_101982771 | 398 |
| 121 | 3300025922 | Ga0207646_10005316 | Ga0207646_1000531614 | 398 |
| 122 | 3300025922 | Ga0207646_10028331 | Ga0207646_100283313 | 398 |
| 123 | 3300025922 | Ga0207646_10069558 | Ga0207646_100695582 | 398 |
| 124 | 3300025929 | Ga0207664_10000075 | Ga0207664_1000007575 | 398 |
| 125 | 3300031239 | Ga0265328_10032477 | Ga0265328_100324771 | 398 |
| 126 | 3300031251 | Ga0265327_10001154 | Ga0265327_1000115419 | 398 |
| 127 | 3300031251 | Ga0265327_10001197 | Ga0265327_1000119737 | 398 |
| 128 | 3300031595 | Ga0265313_10000079 | Ga0265313_1000007936 | 398 |
| 129 | 3300031711 | Ga0265314_10008584 | Ga0265314_100085844 | 398 |
| 130 | 3300031712 | Ga0265342_10039411 | Ga0265342_100394112 | 398 |
| 131 | 3300035120 | Ga0373957_0003515 | Ga0373957_0003515_661_1881 | 398 |
| 132 | 3300035724 | Ga0373933_0137825 | Ga0373933_0137825_170_1390 | 398 |
| 133 | 3300035725 | Ga0373947_0077439 | Ga0373947_0077439_391_1614 | 398 |
| 134 | 3300036401 | Ga0373937_0025722 | Ga0373937_0025722_995_2215 | 398 |
| 135 | 3300036401 | Ga0373937_0194259 | Ga0373937_0194259_643_1866 | 398 |
| 136 | 3300036401 | Ga0373937_0277151 | Ga0373937_0277151_307_1527 | 398 |
| 137 | 3300044673 | Ga0453683_0008029 | Ga0453683_0008029_1157_2377 | 398 |
| 138 | 3300044712 | Ga0453684_0025926 | Ga0453684_0025926_4436_5656 | 398 |
| 139 | 3300045051 | Ga0451576_0004821 | Ga0451576_0004821_3545_4765 | 398 |
| 140 | 3300046455 | Ga0495603_0112794 | Ga0495603_0112794_271_1491 | 398 |
| 141 | 3300046475 | Ga0495639_0084669 | Ga0495639_0084669_90_1313 | 398 |
| 142 | 3300046499 | Ga0495594_0019052 | Ga0495594_0019052_1021_2241 | 398 |
| 143 | 3300046514 | Ga0495618_0000201 | Ga0495618_0000201_37887_39107 | 398 |
| 144 | 3300046663 | Ga0495635_0067946 | Ga0495635_0067946_878_2098 | 398 |
| 145 | 3300047321 | Ga0495676_0038011 | Ga0495676_0038011_1834_3054 | 398 |
| 146 | 3300050507 | nmdc:mga05p37_104_c1 | nmdc:mga05p37_104_c1_44518_45741 | 398 |
| 147 | 3300050507 | nmdc:mga05p37_82144_c1 | nmdc:mga05p37_82144_c1_2299_3519 | 398 |
| 148 | 3300050512 | nmdc:mga0n895_4475_c1 | nmdc:mga0n895_4475_c1_238_1458 | 398 |
| 149 | 3300050513 | nmdc:mga0rr50_653_c1 | nmdc:mga0rr50_653_c1_15899_17119 | 398 |
| 150 | 3300050514 | nmdc:mga08x19_66307_c1 | nmdc:mga08x19_66307_c1_341_1561 | 398 |
| 151 | 3300050515 | nmdc:mga0a205_2781_c1 | nmdc:mga0a205_2781_c1_13649_14869 | 398 |
| 152 | 3300050515 | nmdc:mga0a205_335481_c1 | nmdc:mga0a205_335481_c1_89_1309 | 398 |
| 153 | 3300050515 | nmdc:mga0a205_95197_c1 | nmdc:mga0a205_95197_c1_1386_2606 | 398 |
| 154 | 3300005343 | Ga0070687_100035490 | Ga0070687_1000354903 | 399 |
| 155 | 3300005406 | Ga0070703_10005754 | Ga0070703_100057543 | 399 |
| 156 | 3300005440 | Ga0070705_100039503 | Ga0070705_1000395033 | 399 |
| 157 | 3300005444 | Ga0070694_100094712 | Ga0070694_1000947121 | 399 |
| 158 | 3300005445 | Ga0070708_100001521 | Ga0070708_10000152117 | 399 |
| 159 | 3300005445 | Ga0070708_100008218 | Ga0070708_1000082184 | 399 |
| 160 | 3300005445 | Ga0070708_100082149 | Ga0070708_1000821493 | 399 |
| 161 | 3300005445 | Ga0070708_100092359 | Ga0070708_1000923595 | 399 |
| 162 | 3300005467 | Ga0070706_100006509 | Ga0070706_1000065097 | 399 |
| 163 | 3300005467 | Ga0070706_100008086 | Ga0070706_10000808613 | 399 |
| 164 | 3300005467 | Ga0070706_100062937 | Ga0070706_1000629371 | 399 |
| 165 | 3300005468 | Ga0070707_100028028 | Ga0070707_1000280285 | 399 |
| 166 | 3300005468 | Ga0070707_100263716 | Ga0070707_1002637162 | 399 |
| 167 | 3300005471 | Ga0070698_100078856 | Ga0070698_1000788562 | 399 |
| 168 | 3300005518 | Ga0070699_100007668 | Ga0070699_1000076688 | 399 |
| 169 | 3300005536 | Ga0070697_100046821 | Ga0070697_1000468214 | 399 |
| 170 | 3300005536 | Ga0070697_100148863 | Ga0070697_1001488632 | 399 |
| 171 | 3300005544 | Ga0070686_100136292 | Ga0070686_1001362921 | 399 |
| 172 | 3300005545 | Ga0070695_100011609 | Ga0070695_1000116093 | 399 |
| 173 | 3300005549 | Ga0070704_100003932 | Ga0070704_1000039324 | 399 |
| 174 | 3300010375 | Ga0105239_10093691 | Ga0105239_100936915 | 399 |
| 175 | 3300011119 | Ga0105246_10043803 | Ga0105246_100438032 | 399 |
| 176 | 3300013297 | Ga0157378_10010501 | Ga0157378_1001050110 | 399 |
| 177 | 3300025885 | Ga0207653_10010720 | Ga0207653_100107203 | 399 |
| 178 | 3300025910 | Ga0207684_10004841 | Ga0207684_100048418 | 399 |
| 179 | 3300025910 | Ga0207684_10159462 | Ga0207684_101594622 | 399 |
| 180 | 3300025922 | Ga0207646_10038899 | Ga0207646_100388994 | 399 |
| 181 | 3300025922 | Ga0207646_10040915 | Ga0207646_100409154 | 399 |
| 182 | 3300025935 | Ga0207709_10192621 | Ga0207709_101926211 | 399 |
| 183 | 3300028563 | Ga0265319_1008111 | Ga0265319_10081114 | 399 |
| 184 | 3300028577 | Ga0265318_10054903 | Ga0265318_100549031 | 399 |
| 185 | 3300028653 | Ga0265323_10016330 | Ga0265323_100163303 | 399 |
| 186 | 3300031240 | Ga0265320_10059189 | Ga0265320_100591892 | 399 |
| 187 | 3300031242 | Ga0265329_10010160 | Ga0265329_100101602 | 399 |
| 188 | 3300031249 | Ga0265339_10069315 | Ga0265339_100693152 | 399 |
| 189 | 3300031711 | Ga0265314_10031118 | Ga0265314_100311182 | 399 |
| 190 | 3300031712 | Ga0265342_10020894 | Ga0265342_100208945 | 399 |
| 191 | 3300044673 | Ga0453683_0036876 | Ga0453683_0036876_877_2100 | 399 |
| 192 | 3300044673 | Ga0453683_0050330 | Ga0453683_0050330_649_1872 | 399 |
| 193 | 3300048905 | Ga0496102_0009922 | Ga0496102_0009922_6529_7752 | 399 |
| 194 | 3300048906 | Ga0496103_0189184 | Ga0496103_0189184_46_1269 | 399 |
| 195 | 3300048909 | Ga0496106_0006924 | Ga0496106_0006924_6912_8135 | 399 |
| 196 | 3300048915 | Ga0496112_0000007 | Ga0496112_0000007_172979_174202 | 399 |
| 197 | 3300050515 | nmdc:mga0a205_259310_c1 | nmdc:mga0a205_259310_c1_285_1523 | 399 |
| 198 | 3300053078 | Ga0495612_0001407 | Ga0495612_0001407_1102_2325 | 399 |
| 199 | 3300042876 | Ga0451577_0032893 | Ga0451577_0032893_397_1623 | 400 |
| 200 | 3300044712 | Ga0453684_0278632 | Ga0453684_0278632_464_1690 | 400 |
| 201 | 3300045051 | Ga0451576_0021540 | Ga0451576_0021540_3986_5212 | 400 |
| 202 | 3300050507 | nmdc:mga05p37_144204_c1 | nmdc:mga05p37_144204_c1_718_1953 | 400 |
| 203 | 3300050515 | nmdc:mga0a205_19116_c1 | nmdc:mga0a205_19116_c1_1044_2279 | 400 |
| 204 | 3300005445 | Ga0070708_100067976 | Ga0070708_1000679762 | 403 |
| 205 | 3300005467 | Ga0070706_100054050 | Ga0070706_1000540501 | 403 |
| 206 | 3300005468 | Ga0070707_100007759 | Ga0070707_10000775914 | 403 |
| 207 | 3300005471 | Ga0070698_100121996 | Ga0070698_1001219962 | 403 |
| 208 | 3300025315 | Ga0207697_10000440 | Ga0207697_100004405 | 403 |
| 209 | 3300025901 | Ga0207688_10035997 | Ga0207688_100359972 | 403 |
| 210 | 3300025907 | Ga0207645_10047862 | Ga0207645_100478623 | 403 |
| 211 | 3300025923 | Ga0207681_10043848 | Ga0207681_100438482 | 403 |
| 212 | 3300025925 | Ga0207650_10043366 | Ga0207650_100433661 | 403 |
| 213 | 3300025926 | Ga0207659_10042244 | Ga0207659_100422442 | 403 |
| 214 | 3300025936 | Ga0207670_10050629 | Ga0207670_100506292 | 403 |
| 215 | 3300025940 | Ga0207691_10001256 | Ga0207691_1000125614 | 403 |
| 216 | 3300025945 | Ga0207679_10070513 | Ga0207679_100705132 | 403 |
| 217 | 3300025960 | Ga0207651_10044547 | Ga0207651_100445472 | 403 |
| 218 | 3300025986 | Ga0207658_10022183 | Ga0207658_100221832 | 403 |
| 219 | 3300026089 | Ga0207648_10041752 | Ga0207648_100417522 | 403 |
| 220 | 3300026095 | Ga0207676_10145854 | Ga0207676_101458541 | 403 |
| 221 | 3300028379 | Ga0268266_10061196 | Ga0268266_100611963 | 403 |
| 222 | 3300028577 | Ga0265318_10001168 | Ga0265318_100011684 | 403 |
| 223 | 3300028800 | Ga0265338_10103533 | Ga0265338_101035332 | 403 |
| 224 | 3300031235 | Ga0265330_10004200 | Ga0265330_100042007 | 403 |
| 225 | 3300031238 | Ga0265332_10006076 | Ga0265332_100060764 | 403 |
| 226 | 3300031240 | Ga0265320_10003888 | Ga0265320_100038885 | 403 |
| 227 | 3300031249 | Ga0265339_10002925 | Ga0265339_100029259 | 403 |
| 228 | 3300031250 | Ga0265331_10015833 | Ga0265331_100158333 | 403 |
| 229 | 3300031711 | Ga0265314_10010051 | Ga0265314_100100512 | 403 |
| 230 | 3300031712 | Ga0265342_10003379 | Ga0265342_1000337913 | 403 |
| 231 | 3300044712 | Ga0453684_0268687 | Ga0453684_0268687_396_1634 | 403 |
| 232 | 3300005353 | Ga0070669_100205304 | Ga0070669_1002053041 | 404 |
| 233 | 3300005355 | Ga0070671_100012821 | Ga0070671_1000128217 | 404 |
| 234 | 3300005467 | Ga0070706_100145415 | Ga0070706_1001454151 | 404 |
| 235 | 3300005471 | Ga0070698_100192455 | Ga0070698_1001924551 | 404 |
| 236 | 3300005536 | Ga0070697_100058339 | Ga0070697_1000583392 | 404 |
| 237 | 3300005545 | Ga0070695_100049191 | Ga0070695_1000491913 | 404 |
| 238 | 3300005616 | Ga0068852_100199567 | Ga0068852_1001995671 | 404 |
| 239 | 3300005841 | Ga0068863_100064530 | Ga0068863_1000645302 | 404 |
| 240 | 3300006237 | Ga0097621_100015074 | Ga0097621_1000150745 | 404 |
| 241 | 3300006237 | Ga0097621_100021726 | Ga0097621_1000217263 | 404 |
| 242 | 3300006358 | Ga0068871_100093548 | Ga0068871_1000935482 | 404 |
| 243 | 3300006871 | Ga0075434_100002871 | Ga0075434_1000028715 | 404 |
| 244 | 3300006914 | Ga0075436_100037177 | Ga0075436_1000371773 | 404 |
| 245 | 3300006914 | Ga0075436_100176785 | Ga0075436_1001767851 | 404 |
| 246 | 3300007076 | Ga0075435_100016803 | Ga0075435_1000168036 | 404 |
| 247 | 3300007788 | Ga0099795_10000175 | Ga0099795_100001751 | 404 |
| 248 | 3300009177 | Ga0105248_10354700 | Ga0105248_103547002 | 404 |
| 249 | 3300010159 | Ga0099796_10003228 | Ga0099796_100032281 | 404 |
| 250 | 3300013296 | Ga0157374_10038459 | Ga0157374_100384594 | 404 |
| 251 | 3300013297 | Ga0157378_10178615 | Ga0157378_101786151 | 404 |
| 252 | 3300013306 | Ga0163162_10031134 | Ga0163162_100311342 | 404 |
| 253 | 3300013306 | Ga0163162_10374932 | Ga0163162_103749321 | 404 |
| 254 | 3300013308 | Ga0157375_10008724 | Ga0157375_100087246 | 404 |
| 255 | 3300025923 | Ga0207681_10040061 | Ga0207681_100400613 | 404 |
| 256 | 3300025925 | Ga0207650_10023180 | Ga0207650_100231802 | 404 |
| 257 | 3300025941 | Ga0207711_10256674 | Ga0207711_102566741 | 404 |
| 258 | 3300027512 | Ga0209179_1000008 | Ga0209179_100000864 | 404 |
| 259 | 3300042876 | Ga0451577_0013161 | Ga0451577_0013161_2726_3964 | 404 |
| 260 | 3300044712 | Ga0453684_0000312 | Ga0453684_0000312_30711_31949 | 404 |
| 261 | 3300046459 | Ga0495629_0033748 | Ga0495629_0033748_1800_3047 | 404 |
| 262 | 3300046462 | Ga0495651_0054755 | Ga0495651_0054755_1184_2458 | 404 |
| 263 | 3300046517 | Ga0495630_0104889 | Ga0495630_0104889_333_1607 | 404 |
| 264 | 3300046529 | Ga0495652_0037149 | Ga0495652_0037149_313_1587 | 404 |
| 265 | 3300046533 | Ga0495640_0160163 | Ga0495640_0160163_105_1379 | 404 |
| 266 | 3300046535 | Ga0495586_0108662 | Ga0495586_0108662_72_1313 | 404 |
| 267 | 3300046543 | Ga0495645_0041550 | Ga0495645_0041550_372_1619 | 404 |
| 268 | 3300047471 | Ga0495684_0035259 | Ga0495684_0035259_135_1376 | 404 |
| 269 | 3300048912 | Ga0496109_0277935 | Ga0496109_0277935_288_1565 | 404 |
| 270 | 3300048915 | Ga0496112_0159282 | Ga0496112_0159282_442_1719 | 404 |
| 271 | 3300048915 | Ga0496112_0254335 | Ga0496112_0254335_298_1569 | 404 |
| 272 | 3300048918 | Ga0496115_0047037 | Ga0496115_0047037_1692_2966 | 404 |
| 273 | 3300050512 | nmdc:mga0n895_1373_c1 | nmdc:mga0n895_1373_c1_12952_14196 | 404 |
| 274 | 3300050513 | nmdc:mga0rr50_217263_c1 | nmdc:mga0rr50_217263_c1_106_1347 | 404 |
| 275 | 3300050513 | nmdc:mga0rr50_22907_c1 | nmdc:mga0rr50_22907_c1_2382_3626 | 404 |
| 276 | 3300013296 | Ga0157374_10086803 | Ga0157374_100868032 | 405 |
| 277 | 3300013297 | Ga0157378_10288787 | Ga0157378_102887872 | 405 |
| 278 | 3300013306 | Ga0163162_10053474 | Ga0163162_100534743 | 405 |
| 279 | 3300013308 | Ga0157375_10031615 | Ga0157375_100316153 | 405 |
| 280 | 3300014969 | Ga0157376_10023132 | Ga0157376_100231323 | 405 |
| 281 | 3300025937 | Ga0207669_10112727 | Ga0207669_101127272 | 405 |
| 282 | 3300041496 | Ga0451839_1427272 | Ga0451839_1427272_146_1390 | 405 |
| 283 | 3300048914 | Ga0496111_0171378 | Ga0496111_0171378_223_1509 | 405 |
| 284 | 3300005334 | Ga0068869_100010949 | Ga0068869_1000109493 | 407 |
| 285 | 3300005468 | Ga0070707_100001481 | Ga0070707_1000014815 | 407 |
| 286 | 3300005471 | Ga0070698_100005046 | Ga0070698_10000504610 | 407 |
| 287 | 3300005549 | Ga0070704_100001768 | Ga0070704_1000017683 | 407 |
| 288 | 3300005843 | Ga0068860_100007093 | Ga0068860_1000070938 | 407 |
| 289 | 3300006914 | Ga0075436_100000020 | Ga0075436_10000002068 | 407 |
| 290 | 3300007076 | Ga0075435_100000165 | Ga0075435_10000016512 | 407 |
| 291 | 3300009148 | Ga0105243_10096344 | Ga0105243_100963442 | 407 |
| 292 | 3300009177 | Ga0105248_10002765 | Ga0105248_1000276510 | 407 |
| 293 | 3300010375 | Ga0105239_10041887 | Ga0105239_100418873 | 407 |
| 294 | 3300013296 | Ga0157374_10044521 | Ga0157374_100445213 | 407 |
| 295 | 3300013297 | Ga0157378_10049832 | Ga0157378_100498322 | 407 |
| 296 | 3300025918 | Ga0207662_10134600 | Ga0207662_101346001 | 407 |
| 297 | 3300025922 | Ga0207646_10006501 | Ga0207646_100065015 | 407 |
| 298 | 3300025938 | Ga0207704_10089244 | Ga0207704_100892442 | 407 |
| 299 | 3300025939 | Ga0207665_10148022 | Ga0207665_101480222 | 407 |
| 300 | 3300025941 | Ga0207711_10013775 | Ga0207711_100137755 | 407 |
| 301 | 3300025942 | Ga0207689_10022868 | Ga0207689_100228683 | 407 |
| 302 | 3300028381 | Ga0268264_10000964 | Ga0268264_100009643 | 407 |
| 303 | 3300031711 | Ga0265314_10023798 | Ga0265314_100237983 | 407 |
| 304 | 3300035692 | Ga0373935_0014856 | Ga0373935_0014856_2729_3976 | 407 |
| 305 | 3300046517 | Ga0495630_0000002 | Ga0495630_0000002_656206_657522 | 407 |
| 306 | 3300046529 | Ga0495652_0069824 | Ga0495652_0069824_969_2216 | 407 |
| 307 | 3300046543 | Ga0495645_0126302 | Ga0495645_0126302_525_1772 | 407 |
| 308 | 3300046680 | Ga0495646_0039878 | Ga0495646_0039878_462_1709 | 407 |
| 309 | 3300047444 | Ga0495675_0078444 | Ga0495675_0078444_138_1385 | 407 |
| 310 | 3300047471 | Ga0495684_0009101 | Ga0495684_0009101_885_2132 | 407 |
| 311 | 3300047471 | Ga0495684_0030471 | Ga0495684_0030471_461_1708 | 407 |
| 312 | 3300048917 | Ga0496114_0000004 | Ga0496114_0000004_233074_234321 | 407 |
| 313 | 3300050513 | nmdc:mga0rr50_139_c1 | nmdc:mga0rr50_139_c1_25041_26288 | 407 |
| 314 | 3300050514 | nmdc:mga08x19_3_c1 | nmdc:mga08x19_3_c1_492755_494002 | 407 |
| 315 | 3300053083 | Ga0495655_0003363 | Ga0495655_0003363_1203_2450 | 407 |
| 316 | 3300053085 | Ga0495619_0019039 | Ga0495619_0019039_2785_4032 | 407 |
| 317 | 3300053153 | Ga0500616_0000497 | Ga0500616_0000497_40228_41475 | 407 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2b2f-assembly1.cif.gz_A | ammonium transporter amt-1 from a.fulgidus (native) | 0.9393 | 6 | 404 |
| 2b2f-assembly1.cif.gz_A | ammonium transporter amt-1 from a.fulgidus (native) | 0.937 | 6 | 404 |
| 2npe-assembly1.cif.gz_A | an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance | 0.9279 | 3 | 385 |
| 6b21-assembly1.cif.gz_A | crystal structure of amtb from e. coli bound to topfluor cardiolipin | 0.9263 | 5 | 384 |
| 2npe-assembly1.cif.gz_A | an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance | 0.9254 | 3 | 385 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9BLG4_16_459_1.10.3430.10 | Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains | 0.9614 | 6 | 406 | 1.10.3430.10 |
| af_Q4DC59_3_424_1.10.3430.10 | Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains | 0.9485 | 3 | 406 | 1.10.3430.10 |
| af_Q2FWL9_1_414_1.10.3430.10 | Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains | 0.9482 | 6 | 405 | 1.10.3430.10 |
| af_Q9BLG4_16_459_1.10.3430.10 | Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains | 0.9451 | 6 | 406 | 1.10.3430.10 |
| af_Q4DC59_3_424_1.10.3430.10 | Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains | 0.9394 | 3 | 406 | 1.10.3430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8P3E6-F1-model_v4 | Ammonium transporter | 0.994 | 15 | 249 |
GO:0005886
GO:0008519 |
| AF-A0A1F9Q6D9-F1-model_v4 | Ammonium transporter | 0.9752 | 109 | 404 |
GO:0005886
GO:0008519 |
| AF-A0A2V8P3E6-F1-model_v4 | Ammonium transporter | 0.9733 | 15 | 249 |
GO:0005886
GO:0008519 |
| AF-A0A7V3WH94-F1-model_v4 | Ammonium transporter | 0.973 | 2 | 244 |
GO:0005886
GO:0008519 |
| AF-A0A3M1BJR3-F1-model_v4 | Ammonium transporter | 0.9719 | 2 | 236 |
GO:0005886
GO:0008519 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar