F404282

General Info

Members Datasets Scaffolds Average Seq Length
317 157 312 409

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0071145|Ga0453684_0071145_1565_2779
Length 404
Sequence MFDTGNTGFMLVATSLVMLMTPGLAFFYGGLVGRRNVLSIMIQSFVSMGWTTLLWWLVGYSLVFSGGQGGVIGNLDHAFLRGITPSDALSINNNIPLLVFIAYQMMFAIITPALITGAFANRVKFNAYMIFLTLWLLFVYFPVAHMVWGGGLFASWGVLDFAGGTAVHTTAGFAALASVLFVGRRKVMDRGPHSIPLVALGTALLWFGWYGFNAGSELKVDQITALAFLNTDVAASIAGLTWLFIAWVTEKKPKFVGLLTGAVAGLVAITPAAGYVSLGGAVMIGLLAGSVCYLAVTWKNHLKLDDALDVWGVHGIGGVLGCICTGIFATKVWNPGGADGLLNGGTTFFLVEMLSVVITAVYAFGFSYGALWLINKVTPVTVTKEDEENGLDESLHGETAYEMI

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
96 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
97 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
100 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
111 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
112 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
155 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 3.15
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100010949 3300005334 Bacteria 5937
2 Ga0070660_100000828 3300005339 Bacteria 20565
3 Ga0070687_100035490 3300005343 Bacteria 2477
4 Ga0070669_100205304 3300005353 Bacteria 1552
5 Ga0070671_100012821 3300005355 Bacteria 6759
6 Ga0070703_10005754 3300005406 Bacteria 3472
7 Ga0070714_100000196 3300005435 Bacteria 49140
8 Ga0070705_100039503 3300005440 Bacteria 2678
9 Ga0070705_100107604 3300005440 Bacteria 1774
10 Ga0070694_100085259 3300005444 Bacteria 2205
11 Ga0070694_100094712 3300005444 Bacteria 2101
12 Ga0070708_100000063 3300005445 Bacteria 69658
13 Ga0070708_100001521 3300005445 Bacteria 17704
14 Ga0070708_100008218 3300005445 Bacteria 8375
15 Ga0070708_100067976 3300005445 Bacteria 3202
16 Ga0070708_100082149 3300005445 Bacteria 2918
17 Ga0070708_100092359 3300005445 Bacteria 2757
18 Ga0070708_100105228 3300005445 Bacteria 2588
19 Ga0070706_100001314 3300005467 Bacteria 26414
20 Ga0070706_100006509 3300005467 Bacteria 11026
21 Ga0070706_100008086 3300005467 Bacteria 9807
22 Ga0070706_100054050 3300005467 Bacteria 3707
23 Ga0070706_100062937 3300005467 Bacteria 3428
24 Ga0070706_100145415 3300005467 Bacteria 2214
25 Ga0070707_100001481 3300005468 Bacteria 22944
26 Ga0070707_100007759 3300005468 Bacteria 9971
27 Ga0070707_100017529 3300005468 Bacteria 6735
28 Ga0070707_100028028 3300005468 Bacteria 5357
29 Ga0070707_100263716 3300005468 Bacteria 1676
30 Ga0070707_100355072 3300005468 Bacteria 1424
31 Ga0070698_100005046 3300005471 Bacteria 14469
32 Ga0070698_100041012 3300005471 Bacteria 4755
33 Ga0070698_100044439 3300005471 Bacteria 4549
34 Ga0070698_100051441 3300005471 Bacteria 4196
35 Ga0070698_100078856 3300005471 Bacteria 3291
36 Ga0070698_100121996 3300005471 Bacteria 2565
37 Ga0070698_100136248 3300005471 Bacteria 2409
38 Ga0070698_100192455 3300005471 Bacteria 1977
39 Ga0070699_100007668 3300005518 Bacteria 9384
40 Ga0070697_100046821 3300005536 Bacteria 3506
41 Ga0070697_100058339 3300005536 Bacteria 3142
42 Ga0070697_100128634 3300005536 Bacteria 2123
43 Ga0070697_100148863 3300005536 Bacteria 1972
44 Ga0070686_100136292 3300005544 Bacteria 1704
45 Ga0070695_100008901 3300005545 Bacteria 5962
46 Ga0070695_100011609 3300005545 Bacteria 5271
47 Ga0070695_100049191 3300005545 Bacteria 2699
48 Ga0070695_100155537 3300005545 Bacteria 1599
49 Ga0070696_100000468 3300005546 Bacteria 25299
50 Ga0070704_100001768 3300005549 Bacteria 11835
51 Ga0070704_100003932 3300005549 Bacteria 8556
52 Ga0070704_100166919 3300005549 Bacteria 1746
53 Ga0068852_100199567 3300005616 Bacteria 1893
54 Ga0068863_100064530 3300005841 Unclassified 3463
55 Ga0068860_100007093 3300005843 Bacteria 11209
56 Ga0070715_10021700 3300006163 Bacteria 2494
57 Ga0097621_100015074 3300006237 Bacteria 5804
58 Ga0097621_100021726 3300006237 Unclassified 4971
59 Ga0097621_100061839 3300006237 Bacteria 3072
60 Ga0068871_100084951 3300006358 Bacteria 2627
61 Ga0068871_100093548 3300006358 Bacteria 2508
62 Ga0075428_100008398 3300006844 Bacteria 11449
63 Ga0075433_10091673 3300006852 Bacteria 2687
64 Ga0075433_10192006 3300006852 Bacteria 1817
65 Ga0075433_10253249 3300006852 Bacteria 1562
66 Ga0075434_100000439 3300006871 Bacteria 30907
67 Ga0075434_100002871 3300006871 Bacteria 15286
68 Ga0075434_100010214 3300006871 Bacteria 8792
69 Ga0075434_100012468 3300006871 Bacteria 8062
70 Ga0075434_100223773 3300006871 Bacteria 1901
71 Ga0075436_100000020 3300006914 Bacteria 124822
72 Ga0075436_100037177 3300006914 Bacteria 3361
73 Ga0075436_100176785 3300006914 Bacteria 1508
74 Ga0075435_100000165 3300007076 Bacteria 38337
75 Ga0075435_100013081 3300007076 Bacteria 6163
76 Ga0075435_100016803 3300007076 Bacteria 5522
77 Ga0099795_10000175 3300007788 Bacteria 10606
78 Ga0114129_10001385 3300009147 Bacteria 32641
79 Ga0114129_10083452 3300009147 Bacteria 4438
80 Ga0105243_10096344 3300009148 Bacteria 2447
81 Ga0105248_10002765 3300009177 Bacteria 19495
82 Ga0105248_10354700 3300009177 Bacteria 1651
83 Ga0099796_10003228 3300010159 Bacteria 3743
84 Ga0105239_10041887 3300010375 Bacteria 5018
85 Ga0105239_10093691 3300010375 Bacteria 3317
86 Ga0105246_10043803 3300011119 Bacteria 3038
87 Ga0157374_10038459 3300013296 Unclassified 4398
88 Ga0157374_10044521 3300013296 Bacteria 4103
89 Ga0157374_10086803 3300013296 Bacteria 2977
90 Ga0157378_10010501 3300013297 Bacteria 8091
91 Ga0157378_10049832 3300013297 Bacteria 3726
92 Ga0157378_10178615 3300013297 Bacteria 1995
93 Ga0157378_10288787 3300013297 Unclassified 1583
94 Ga0163162_10031134 3300013306 Bacteria 5290
95 Ga0163162_10053474 3300013306 Bacteria 4059
96 Ga0163162_10374932 3300013306 Bacteria 1556
97 Ga0157375_10008724 3300013308 Bacteria 8881
98 Ga0157375_10031615 3300013308 Bacteria 5007
99 Ga0157376_10023132 3300014969 Bacteria 4859
100 Ga0207697_10000440 3300025315 Bacteria 23431
101 Ga0207653_10010720 3300025885 Bacteria 2859
102 Ga0207688_10035997 3300025901 Bacteria 2742
103 Ga0207685_10018582 3300025905 Bacteria 2272
104 Ga0207645_10047862 3300025907 Bacteria 2730
105 Ga0207684_10000741 3300025910 Bacteria 38273
106 Ga0207684_10004841 3300025910 Bacteria 12598
107 Ga0207684_10022208 3300025910 Bacteria 5420
108 Ga0207684_10034179 3300025910 Bacteria 4321
109 Ga0207684_10159462 3300025910 Bacteria 1942
110 Ga0207684_10198277 3300025910 Bacteria 1732
111 Ga0207663_10111059 3300025916 Bacteria 1860
112 Ga0207662_10134600 3300025918 Bacteria 1561
113 Ga0207657_10006612 3300025919 Bacteria 11998
114 Ga0207646_10005316 3300025922 Bacteria 13573
115 Ga0207646_10006501 3300025922 Bacteria 12067
116 Ga0207646_10028331 3300025922 Bacteria 5100
117 Ga0207646_10038899 3300025922 Bacteria 4281
118 Ga0207646_10040915 3300025922 Bacteria 4167
119 Ga0207646_10069558 3300025922 Bacteria 3144
120 Ga0207646_10145238 3300025922 Bacteria 2138
121 Ga0207646_10167987 3300025922 Bacteria 1981
122 Ga0207681_10040061 3300025923 Bacteria 3115
123 Ga0207681_10043848 3300025923 Bacteria 2995
124 Ga0207650_10023180 3300025925 Unclassified 4402
125 Ga0207650_10043366 3300025925 Unclassified 3302
126 Ga0207659_10042244 3300025926 Bacteria 3196
127 Ga0207664_10000075 3300025929 Bacteria 102649
128 Ga0207709_10192621 3300025935 Bacteria 1449
129 Ga0207670_10050629 3300025936 Unclassified 2785
130 Ga0207669_10112727 3300025937 Unclassified 1826
131 Ga0207704_10089244 3300025938 Bacteria 2020
132 Ga0207665_10148022 3300025939 Bacteria 1679
133 Ga0207691_10001256 3300025940 Bacteria 25380
134 Ga0207711_10013775 3300025941 Bacteria 6713
135 Ga0207711_10256674 3300025941 Bacteria 1606
136 Ga0207689_10022868 3300025942 Bacteria 5251
137 Ga0207679_10070513 3300025945 Bacteria 2633
138 Ga0207651_10044547 3300025960 Bacteria 2970
139 Ga0207658_10022183 3300025986 Bacteria 4418
140 Ga0207648_10041752 3300026089 Bacteria 4028
141 Ga0207676_10145854 3300026095 Unclassified 2033
142 Ga0209179_1000008 3300027512 Bacteria 92811
143 Ga0265356_1006300 3300028017 Bacteria 1390
144 Ga0268266_10061196 3300028379 Unclassified 3246
145 Ga0268264_10000964 3300028381 Bacteria 29492
146 Ga0265319_1008111 3300028563 Bacteria 4636
147 Ga0265318_10001168 3300028577 Bacteria 16266
148 Ga0265318_10054903 3300028577 Bacteria 1492
149 Ga0265323_10016330 3300028653 Bacteria 2900
150 Ga0265322_10029942 3300028654 Bacteria 1555
151 Ga0265338_10014497 3300028800 Bacteria 8770
152 Ga0265338_10060756 3300028800 Bacteria 3317
153 Ga0265338_10103533 3300028800 Bacteria 2312
154 Ga0265760_10000023 3300031090 Bacteria 67653
155 Ga0265330_10000013 3300031235 Bacteria 177129
156 Ga0265330_10004200 3300031235 Bacteria 7346
157 Ga0265330_10009208 3300031235 Archaea 4702
158 Ga0265330_10036229 3300031235 Bacteria 2199
159 Ga0265332_10000019 3300031238 Bacteria 222130
160 Ga0265332_10006076 3300031238 Bacteria 5514
161 Ga0265328_10016135 3300031239 Unclassified 2910
162 Ga0265328_10032477 3300031239 Bacteria 1937
163 Ga0265320_10003888 3300031240 Bacteria 9881
164 Ga0265320_10043849 3300031240 Bacteria 2208
165 Ga0265320_10059189 3300031240 Bacteria 1832
166 Ga0265325_10022354 3300031241 Unclassified 3465
167 Ga0265325_10030333 3300031241 Bacteria 2900
168 Ga0265329_10000158 3300031242 Bacteria 33656
169 Ga0265329_10008198 3300031242 Bacteria 3979
170 Ga0265329_10010160 3300031242 Bacteria 3472
171 Ga0265329_10022439 3300031242 Unclassified 2112
172 Ga0265340_10000054 3300031247 Bacteria 53196
173 Ga0265339_10002925 3300031249 Bacteria 12079
174 Ga0265339_10030898 3300031249 Bacteria 3030
175 Ga0265339_10069315 3300031249 Bacteria 1883
176 Ga0265339_10084110 3300031249 Bacteria 1677
177 Ga0265339_10091879 3300031249 Bacteria 1590
178 Ga0265331_10008601 3300031250 Bacteria 5794
179 Ga0265331_10015833 3300031250 Bacteria 3971
180 Ga0265327_10001154 3300031251 Bacteria 35969
181 Ga0265327_10001197 3300031251 Bacteria 35118
182 Ga0265327_10069177 3300031251 Bacteria 1773
183 Ga0265316_10000111 3300031344 Bacteria 87754
184 Ga0265316_10001132 3300031344 Bacteria 28928
185 Ga0265316_10002105 3300031344 Bacteria 20934
186 Ga0265316_10051931 3300031344 Bacteria 3218
187 Ga0265316_10072565 3300031344 Bacteria 2651
188 Ga0265316_10124314 3300031344 Bacteria 1947
189 Ga0265313_10000079 3300031595 Bacteria 95515
190 Ga0265314_10000004 3300031711 Bacteria 939480
191 Ga0265314_10008584 3300031711 Bacteria 8737
192 Ga0265314_10010051 3300031711 Bacteria 7932
193 Ga0265314_10016437 3300031711 Bacteria 5843
194 Ga0265314_10023798 3300031711 Bacteria 4659
195 Ga0265314_10031118 3300031711 Bacteria 3944
196 Ga0265314_10050550 3300031711 Bacteria 2902
197 Ga0265342_10000017 3300031712 Bacteria 180644
198 Ga0265342_10000826 3300031712 Bacteria 31085
199 Ga0265342_10003379 3300031712 Bacteria 13156
200 Ga0265342_10020894 3300031712 Bacteria 4188
201 Ga0265342_10039411 3300031712 Bacteria 2871
202 Ga0265342_10049134 3300031712 Bacteria 2526
203 Ga0265342_10052824 3300031712 Bacteria 2420
204 Ga0316576_10118090 3300031727 Bacteria 1991
205 Ga0316578_10000346 3300031728 Bacteria 14661
206 Ga0316577_10000243 3300031733 Bacteria 19056
207 Ga0316577_10045884 3300031733 Bacteria 2442
208 Ga0316583_10000916 3300032133 Bacteria 9490
209 Ga0373936_0000014 3300035113 Bacteria 202828
210 Ga0373957_0003515 3300035120 Bacteria 4645
211 Ga0316574_0023684 3300035398 Bacteria 3668
212 Ga0373935_0014856 3300035692 Bacteria 4702
213 Ga0373933_0137825 3300035724 Bacteria 1538
214 Ga0373947_0077439 3300035725 Bacteria 2051
215 Ga0373937_0025722 3300036401 Bacteria 5315
216 Ga0373937_0194259 3300036401 Bacteria 1907
217 Ga0373937_0238812 3300036401 Bacteria 1712
218 Ga0373937_0277151 3300036401 Bacteria 1583
219 Ga0316582_0005765 3300036647 Bacteria 6425
220 Ga0316582_0017309 3300036647 Bacteria 4168
221 Ga0316582_0076246 3300036647 Bacteria 2180
222 Ga0316582_0120585 3300036647 Bacteria 1754
223 Ga0316584_0003817 3300036712 Bacteria 9873
224 Ga0316584_0077329 3300036712 Bacteria 2493
225 Ga0373925_0283014 3300037068 Bacteria 1336
226 Ga0373925_0312106 3300037068 Bacteria 1271
227 Ga0316581_0004997 3300037588 Bacteria 3420
228 Ga0436364_1219943 3300037853 Bacteria 1659
229 Ga0400490_31137 3300038726 Bacteria 6129
230 Ga0400489_28134 3300039093 Unclassified 1474
231 Ga0451839_1427272 3300041496 Bacteria 1685
232 Ga0451577_0013161 3300042876 Bacteria 7753
233 Ga0451577_0032893 3300042876 Bacteria 4674
234 Ga0451577_0339917 3300042876 Bacteria 1361
235 Ga0453683_0008029 3300044673 Bacteria 7108
236 Ga0453683_0036876 3300044673 Bacteria 3076
237 Ga0453683_0050330 3300044673 Bacteria 2610
238 Ga0453684_0000312 3300044712 Bacteria 206476
239 Ga0453684_0025926 3300044712 Bacteria 8490
240 Ga0453684_0071145 3300044712 Bacteria 4400
241 Ga0453684_0268687 3300044712 Bacteria 1950
242 Ga0453684_0278632 3300044712 Bacteria 1908
243 Ga0451576_0004821 3300045051 Bacteria 17270
244 Ga0451576_0021540 3300045051 Bacteria 7006
245 Ga0451576_0349752 3300045051 Bacteria 1547
246 Ga0451576_0463179 3300045051 Bacteria 1331
247 Ga0495592_0080678 3300046454 Bacteria 2353
248 Ga0495603_0112794 3300046455 Bacteria 1585
249 Ga0495629_0033748 3300046459 Bacteria 3619
250 Ga0495651_0054755 3300046462 Bacteria 3066
251 Ga0495639_0084669 3300046475 Bacteria 1481
252 Ga0495594_0010987 3300046499 Bacteria 4701
253 Ga0495594_0019052 3300046499 Bacteria 3644
254 Ga0495594_0103700 3300046499 Bacteria 1601
255 Ga0495608_0008045 3300046511 Bacteria 7410
256 Ga0495608_0186347 3300046511 Bacteria 1311
257 Ga0495618_0000201 3300046514 Bacteria 42727
258 Ga0495628_0226556 3300046516 Bacteria 1402
259 Ga0495630_0000002 3300046517 Bacteria 1277125
260 Ga0495630_0104889 3300046517 Bacteria 2140
261 Ga0495652_0037149 3300046529 Bacteria 4228
262 Ga0495652_0069824 3300046529 Bacteria 2939
263 Ga0495640_0160163 3300046533 Bacteria 1443
264 Ga0495586_0108662 3300046535 Bacteria 1543
265 Ga0495586_0128046 3300046535 Bacteria 1421
266 Ga0495587_0002486 3300046536 Bacteria 12300
267 Ga0495645_0041550 3300046543 Bacteria 3353
268 Ga0495645_0044100 3300046543 Bacteria 3253
269 Ga0495645_0126302 3300046543 Bacteria 1797
270 Ga0495667_0085965 3300046559 Bacteria 2040
271 Ga0495635_0067946 3300046663 Bacteria 2444
272 Ga0495635_0174386 3300046663 Bacteria 1462
273 Ga0495657_0037976 3300046675 Bacteria 3315
274 Ga0495646_0039878 3300046680 Bacteria 2894
275 Ga0495624_0195783 3300046690 Bacteria 1228
276 Ga0495676_0038011 3300047321 Bacteria 4001
277 Ga0495680_0013137 3300047322 Bacteria 7237
278 Ga0495675_0078444 3300047444 Bacteria 2080
279 Ga0495684_0009101 3300047471 Bacteria 7671
280 Ga0495684_0030471 3300047471 Bacteria 4142
281 Ga0495684_0035259 3300047471 Bacteria 3837
282 Ga0496102_0009922 3300048905 Bacteria 8191
283 Ga0496103_0189184 3300048906 Bacteria 1323
284 Ga0496106_0006924 3300048909 Bacteria 8387
285 Ga0496109_0277935 3300048912 Bacteria 1578
286 Ga0496111_0171378 3300048914 Bacteria 1613
287 Ga0496112_0000007 3300048915 Bacteria 338850
288 Ga0496112_0159282 3300048915 Bacteria 2224
289 Ga0496112_0254335 3300048915 Bacteria 1707
290 Ga0496114_0000004 3300048917 Bacteria 591126
291 Ga0496115_0047037 3300048918 Bacteria 3449
292 nmdc:mga05p37_104_c1 3300050507 Bacteria 76602
293 nmdc:mga05p37_144204_c1 3300050507 Bacteria 2917
294 nmdc:mga05p37_82144_c1 3300050507 Bacteria 3970
295 nmdc:mga0n895_1373_c1 3300050512 Bacteria 18105
296 nmdc:mga0n895_4475_c1 3300050512 Bacteria 11483
297 nmdc:mga0rr50_139_c1 3300050513 Bacteria 40055
298 nmdc:mga0rr50_217263_c1 3300050513 Bacteria 1577
299 nmdc:mga0rr50_22907_c1 3300050513 Bacteria 4296
300 nmdc:mga0rr50_653_c1 3300050513 Bacteria 18639
301 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
302 nmdc:mga08x19_66307_c1 3300050514 Bacteria 2346
303 nmdc:mga0a205_19116_c1 3300050515 Bacteria 6458
304 nmdc:mga0a205_259310_c1 3300050515 Bacteria 1616
305 nmdc:mga0a205_2781_c1 3300050515 Bacteria 15465
306 nmdc:mga0a205_335481_c1 3300050515 Bacteria 1381
307 nmdc:mga0a205_95197_c1 3300050515 Bacteria 2876
308 Ga0495612_0001407 3300053078 Bacteria 9900
309 Ga0495655_0003363 3300053083 Bacteria 2635
310 Ga0495619_0019039 3300053085 Bacteria 4361
311 Ga0495619_0165554 3300053085 Bacteria 1528
312 Ga0500616_0000497 3300053153 Bacteria 50378

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031712 Ga0265342_10049134 Ga0265342_100491341 355
2 3300042876 Ga0451577_0339917 Ga0451577_0339917_11_1105 356
3 3300037068 Ga0373925_0283014 Ga0373925_0283014_24_1145 362
4 3300046511 Ga0495608_0186347 Ga0495608_0186347_156_1289 366
5 3300046535 Ga0495586_0128046 Ga0495586_0128046_285_1409 366
6 3300031728 Ga0316578_10000346 Ga0316578_100003464 368
7 3300031733 Ga0316577_10000243 Ga0316577_1000024315 368
8 3300035398 Ga0316574_0023684 Ga0316574_0023684_646_1854 368
9 3300046499 Ga0495594_0103700 Ga0495594_0103700_26_1204 368
10 3300036647 Ga0316582_0017309 Ga0316582_0017309_2472_3677 371
11 3300036712 Ga0316584_0003817 Ga0316584_0003817_3167_4372 371
12 3300037588 Ga0316581_0004997 Ga0316581_0004997_1902_3107 371
13 3300037068 Ga0373925_0312106 Ga0373925_0312106_59_1258 379
14 3300031240 Ga0265320_10043849 Ga0265320_100438492 383
15 3300031249 Ga0265339_10091879 Ga0265339_100918791 383
16 3300045051 Ga0451576_0349752 Ga0451576_0349752_295_1470 383
17 3300046663 Ga0495635_0174386 Ga0495635_0174386_26_1237 383
18 3300009147 Ga0114129_10083452 Ga0114129_100834524 386
19 3300028577 Ga0265318_10001168 Ga0265318_100011683 386
20 3300031240 Ga0265320_10003888 Ga0265320_100038884 386
21 3300031242 Ga0265329_10022439 Ga0265329_100224392 386
22 3300031249 Ga0265339_10002925 Ga0265339_1000292510 386
23 3300031250 Ga0265331_10015833 Ga0265331_100158332 386
24 3300031712 Ga0265342_10003379 Ga0265342_1000337914 386
25 3300045051 Ga0451576_0463179 Ga0451576_0463179_15_1199 386
26 3300005471 Ga0070698_100136248 Ga0070698_1001362482 387
27 3300009147 Ga0114129_10001385 Ga0114129_1000138523 387
28 3300046454 Ga0495592_0080678 Ga0495592_0080678_187_1374 387
29 3300046511 Ga0495608_0008045 Ga0495608_0008045_5454_6641 387
30 3300046516 Ga0495628_0226556 Ga0495628_0226556_14_1201 387
31 3300046536 Ga0495587_0002486 Ga0495587_0002486_9977_11164 387
32 3300046559 Ga0495667_0085965 Ga0495667_0085965_84_1271 387
33 3300046675 Ga0495657_0037976 Ga0495657_0037976_362_1549 387
34 3300053085 Ga0495619_0165554 Ga0495619_0165554_77_1264 387
35 3300046690 Ga0495624_0195783 Ga0495624_0195783_28_1218 388
36 3300005546 Ga0070696_100000468 Ga0070696_1000004685 390
37 3300031733 Ga0316577_10045884 Ga0316577_100458841 391
38 3300036647 Ga0316582_0005765 Ga0316582_0005765_2319_3521 391
39 3300036712 Ga0316584_0077329 Ga0316584_0077329_577_1779 391
40 3300036647 Ga0316582_0120585 Ga0316582_0120585_98_1303 393
41 3300006852 Ga0075433_10253249 Ga0075433_102532491 394
42 3300031235 Ga0265330_10009208 Ga0265330_100092082 394
43 3300031242 Ga0265329_10008198 Ga0265329_100081982 394
44 3300031344 Ga0265316_10002105 Ga0265316_1000210512 394
45 3300031712 Ga0265342_10000826 Ga0265342_1000082615 394
46 3300032133 Ga0316583_10000916 Ga0316583_100009168 394
47 3300046543 Ga0495645_0044100 Ga0495645_0044100_123_1331 394
48 3300047322 Ga0495680_0013137 Ga0495680_0013137_2728_3936 394
49 3300031235 Ga0265330_10036229 Ga0265330_100362291 395
50 3300031344 Ga0265316_10072565 Ga0265316_100725652 395
51 3300031712 Ga0265342_10052824 Ga0265342_100528242 395
52 3300038726 Ga0400490_31137 Ga0400490_31137_1002_2216 395
53 3300031235 Ga0265330_10000013 Ga0265330_10000013125 396
54 3300031238 Ga0265332_10000019 Ga0265332_10000019109 396
55 3300031239 Ga0265328_10016135 Ga0265328_100161352 396
56 3300031241 Ga0265325_10030333 Ga0265325_100303333 396
57 3300031242 Ga0265329_10000158 Ga0265329_1000015812 396
58 3300031247 Ga0265340_10000054 Ga0265340_1000005449 396
59 3300031250 Ga0265331_10008601 Ga0265331_100086014 396
60 3300031251 Ga0265327_10069177 Ga0265327_100691772 396
61 3300031344 Ga0265316_10000111 Ga0265316_1000011149 396
62 3300031344 Ga0265316_10001132 Ga0265316_100011323 396
63 3300031711 Ga0265314_10000004 Ga0265314_10000004422 396
64 3300031712 Ga0265342_10000017 Ga0265342_1000001728 396
65 3300031727 Ga0316576_10118090 Ga0316576_101180902 396
66 3300035113 Ga0373936_0000014 Ga0373936_0000014_77950_79167 396
67 3300036647 Ga0316582_0076246 Ga0316582_0076246_457_1671 396
68 3300037853 Ga0436364_1219943 Ga0436364_1219943_235_1464 396
69 3300044712 Ga0453684_0071145 Ga0453684_0071145_1565_2779 396
70 3300046499 Ga0495594_0010987 Ga0495594_0010987_3083_4297 396
71 3300005339 Ga0070660_100000828 Ga0070660_10000082815 397
72 3300005440 Ga0070705_100107604 Ga0070705_1001076041 397
73 3300005445 Ga0070708_100000063 Ga0070708_10000006332 397
74 3300005468 Ga0070707_100355072 Ga0070707_1003550721 397
75 3300005471 Ga0070698_100041012 Ga0070698_1000410123 397
76 3300025916 Ga0207663_10111059 Ga0207663_101110592 397
77 3300025919 Ga0207657_10006612 Ga0207657_100066127 397
78 3300025922 Ga0207646_10145238 Ga0207646_101452381 397
79 3300025922 Ga0207646_10167987 Ga0207646_101679871 397
80 3300028017 Ga0265356_1006300 Ga0265356_10063001 397
81 3300028654 Ga0265322_10029942 Ga0265322_100299421 397
82 3300028800 Ga0265338_10014497 Ga0265338_100144975 397
83 3300028800 Ga0265338_10060756 Ga0265338_100607562 397
84 3300031090 Ga0265760_10000023 Ga0265760_1000002343 397
85 3300031241 Ga0265325_10022354 Ga0265325_100223541 397
86 3300031249 Ga0265339_10030898 Ga0265339_100308982 397
87 3300031249 Ga0265339_10084110 Ga0265339_100841101 397
88 3300031344 Ga0265316_10051931 Ga0265316_100519314 397
89 3300031344 Ga0265316_10124314 Ga0265316_101243142 397
90 3300031711 Ga0265314_10016437 Ga0265314_100164374 397
91 3300031711 Ga0265314_10050550 Ga0265314_100505502 397
92 3300036401 Ga0373937_0238812 Ga0373937_0238812_333_1550 397
93 3300039093 Ga0400489_28134 Ga0400489_28134_185_1429 397
94 3300005435 Ga0070714_100000196 Ga0070714_10000019629 398
95 3300005444 Ga0070694_100085259 Ga0070694_1000852593 398
96 3300005445 Ga0070708_100105228 Ga0070708_1001052282 398
97 3300005467 Ga0070706_100001314 Ga0070706_10000131422 398
98 3300005468 Ga0070707_100017529 Ga0070707_1000175297 398
99 3300005471 Ga0070698_100044439 Ga0070698_1000444396 398
100 3300005471 Ga0070698_100051441 Ga0070698_1000514411 398
101 3300005536 Ga0070697_100128634 Ga0070697_1001286341 398
102 3300005545 Ga0070695_100008901 Ga0070695_1000089012 398
103 3300005545 Ga0070695_100155537 Ga0070695_1001555371 398
104 3300005549 Ga0070704_100166919 Ga0070704_1001669192 398
105 3300006163 Ga0070715_10021700 Ga0070715_100217002 398
106 3300006237 Ga0097621_100061839 Ga0097621_1000618391 398
107 3300006358 Ga0068871_100084951 Ga0068871_1000849512 398
108 3300006844 Ga0075428_100008398 Ga0075428_1000083986 398
109 3300006852 Ga0075433_10091673 Ga0075433_100916733 398
110 3300006852 Ga0075433_10192006 Ga0075433_101920062 398
111 3300006871 Ga0075434_100000439 Ga0075434_10000043918 398
112 3300006871 Ga0075434_100010214 Ga0075434_1000102146 398
113 3300006871 Ga0075434_100012468 Ga0075434_1000124686 398
114 3300006871 Ga0075434_100223773 Ga0075434_1002237732 398
115 3300007076 Ga0075435_100013081 Ga0075435_1000130812 398
116 3300025905 Ga0207685_10018582 Ga0207685_100185822 398
117 3300025910 Ga0207684_10000741 Ga0207684_1000074133 398
118 3300025910 Ga0207684_10022208 Ga0207684_100222084 398
119 3300025910 Ga0207684_10034179 Ga0207684_100341791 398
120 3300025910 Ga0207684_10198277 Ga0207684_101982771 398
121 3300025922 Ga0207646_10005316 Ga0207646_1000531614 398
122 3300025922 Ga0207646_10028331 Ga0207646_100283313 398
123 3300025922 Ga0207646_10069558 Ga0207646_100695582 398
124 3300025929 Ga0207664_10000075 Ga0207664_1000007575 398
125 3300031239 Ga0265328_10032477 Ga0265328_100324771 398
126 3300031251 Ga0265327_10001154 Ga0265327_1000115419 398
127 3300031251 Ga0265327_10001197 Ga0265327_1000119737 398
128 3300031595 Ga0265313_10000079 Ga0265313_1000007936 398
129 3300031711 Ga0265314_10008584 Ga0265314_100085844 398
130 3300031712 Ga0265342_10039411 Ga0265342_100394112 398
131 3300035120 Ga0373957_0003515 Ga0373957_0003515_661_1881 398
132 3300035724 Ga0373933_0137825 Ga0373933_0137825_170_1390 398
133 3300035725 Ga0373947_0077439 Ga0373947_0077439_391_1614 398
134 3300036401 Ga0373937_0025722 Ga0373937_0025722_995_2215 398
135 3300036401 Ga0373937_0194259 Ga0373937_0194259_643_1866 398
136 3300036401 Ga0373937_0277151 Ga0373937_0277151_307_1527 398
137 3300044673 Ga0453683_0008029 Ga0453683_0008029_1157_2377 398
138 3300044712 Ga0453684_0025926 Ga0453684_0025926_4436_5656 398
139 3300045051 Ga0451576_0004821 Ga0451576_0004821_3545_4765 398
140 3300046455 Ga0495603_0112794 Ga0495603_0112794_271_1491 398
141 3300046475 Ga0495639_0084669 Ga0495639_0084669_90_1313 398
142 3300046499 Ga0495594_0019052 Ga0495594_0019052_1021_2241 398
143 3300046514 Ga0495618_0000201 Ga0495618_0000201_37887_39107 398
144 3300046663 Ga0495635_0067946 Ga0495635_0067946_878_2098 398
145 3300047321 Ga0495676_0038011 Ga0495676_0038011_1834_3054 398
146 3300050507 nmdc:mga05p37_104_c1 nmdc:mga05p37_104_c1_44518_45741 398
147 3300050507 nmdc:mga05p37_82144_c1 nmdc:mga05p37_82144_c1_2299_3519 398
148 3300050512 nmdc:mga0n895_4475_c1 nmdc:mga0n895_4475_c1_238_1458 398
149 3300050513 nmdc:mga0rr50_653_c1 nmdc:mga0rr50_653_c1_15899_17119 398
150 3300050514 nmdc:mga08x19_66307_c1 nmdc:mga08x19_66307_c1_341_1561 398
151 3300050515 nmdc:mga0a205_2781_c1 nmdc:mga0a205_2781_c1_13649_14869 398
152 3300050515 nmdc:mga0a205_335481_c1 nmdc:mga0a205_335481_c1_89_1309 398
153 3300050515 nmdc:mga0a205_95197_c1 nmdc:mga0a205_95197_c1_1386_2606 398
154 3300005343 Ga0070687_100035490 Ga0070687_1000354903 399
155 3300005406 Ga0070703_10005754 Ga0070703_100057543 399
156 3300005440 Ga0070705_100039503 Ga0070705_1000395033 399
157 3300005444 Ga0070694_100094712 Ga0070694_1000947121 399
158 3300005445 Ga0070708_100001521 Ga0070708_10000152117 399
159 3300005445 Ga0070708_100008218 Ga0070708_1000082184 399
160 3300005445 Ga0070708_100082149 Ga0070708_1000821493 399
161 3300005445 Ga0070708_100092359 Ga0070708_1000923595 399
162 3300005467 Ga0070706_100006509 Ga0070706_1000065097 399
163 3300005467 Ga0070706_100008086 Ga0070706_10000808613 399
164 3300005467 Ga0070706_100062937 Ga0070706_1000629371 399
165 3300005468 Ga0070707_100028028 Ga0070707_1000280285 399
166 3300005468 Ga0070707_100263716 Ga0070707_1002637162 399
167 3300005471 Ga0070698_100078856 Ga0070698_1000788562 399
168 3300005518 Ga0070699_100007668 Ga0070699_1000076688 399
169 3300005536 Ga0070697_100046821 Ga0070697_1000468214 399
170 3300005536 Ga0070697_100148863 Ga0070697_1001488632 399
171 3300005544 Ga0070686_100136292 Ga0070686_1001362921 399
172 3300005545 Ga0070695_100011609 Ga0070695_1000116093 399
173 3300005549 Ga0070704_100003932 Ga0070704_1000039324 399
174 3300010375 Ga0105239_10093691 Ga0105239_100936915 399
175 3300011119 Ga0105246_10043803 Ga0105246_100438032 399
176 3300013297 Ga0157378_10010501 Ga0157378_1001050110 399
177 3300025885 Ga0207653_10010720 Ga0207653_100107203 399
178 3300025910 Ga0207684_10004841 Ga0207684_100048418 399
179 3300025910 Ga0207684_10159462 Ga0207684_101594622 399
180 3300025922 Ga0207646_10038899 Ga0207646_100388994 399
181 3300025922 Ga0207646_10040915 Ga0207646_100409154 399
182 3300025935 Ga0207709_10192621 Ga0207709_101926211 399
183 3300028563 Ga0265319_1008111 Ga0265319_10081114 399
184 3300028577 Ga0265318_10054903 Ga0265318_100549031 399
185 3300028653 Ga0265323_10016330 Ga0265323_100163303 399
186 3300031240 Ga0265320_10059189 Ga0265320_100591892 399
187 3300031242 Ga0265329_10010160 Ga0265329_100101602 399
188 3300031249 Ga0265339_10069315 Ga0265339_100693152 399
189 3300031711 Ga0265314_10031118 Ga0265314_100311182 399
190 3300031712 Ga0265342_10020894 Ga0265342_100208945 399
191 3300044673 Ga0453683_0036876 Ga0453683_0036876_877_2100 399
192 3300044673 Ga0453683_0050330 Ga0453683_0050330_649_1872 399
193 3300048905 Ga0496102_0009922 Ga0496102_0009922_6529_7752 399
194 3300048906 Ga0496103_0189184 Ga0496103_0189184_46_1269 399
195 3300048909 Ga0496106_0006924 Ga0496106_0006924_6912_8135 399
196 3300048915 Ga0496112_0000007 Ga0496112_0000007_172979_174202 399
197 3300050515 nmdc:mga0a205_259310_c1 nmdc:mga0a205_259310_c1_285_1523 399
198 3300053078 Ga0495612_0001407 Ga0495612_0001407_1102_2325 399
199 3300042876 Ga0451577_0032893 Ga0451577_0032893_397_1623 400
200 3300044712 Ga0453684_0278632 Ga0453684_0278632_464_1690 400
201 3300045051 Ga0451576_0021540 Ga0451576_0021540_3986_5212 400
202 3300050507 nmdc:mga05p37_144204_c1 nmdc:mga05p37_144204_c1_718_1953 400
203 3300050515 nmdc:mga0a205_19116_c1 nmdc:mga0a205_19116_c1_1044_2279 400
204 3300005445 Ga0070708_100067976 Ga0070708_1000679762 403
205 3300005467 Ga0070706_100054050 Ga0070706_1000540501 403
206 3300005468 Ga0070707_100007759 Ga0070707_10000775914 403
207 3300005471 Ga0070698_100121996 Ga0070698_1001219962 403
208 3300025315 Ga0207697_10000440 Ga0207697_100004405 403
209 3300025901 Ga0207688_10035997 Ga0207688_100359972 403
210 3300025907 Ga0207645_10047862 Ga0207645_100478623 403
211 3300025923 Ga0207681_10043848 Ga0207681_100438482 403
212 3300025925 Ga0207650_10043366 Ga0207650_100433661 403
213 3300025926 Ga0207659_10042244 Ga0207659_100422442 403
214 3300025936 Ga0207670_10050629 Ga0207670_100506292 403
215 3300025940 Ga0207691_10001256 Ga0207691_1000125614 403
216 3300025945 Ga0207679_10070513 Ga0207679_100705132 403
217 3300025960 Ga0207651_10044547 Ga0207651_100445472 403
218 3300025986 Ga0207658_10022183 Ga0207658_100221832 403
219 3300026089 Ga0207648_10041752 Ga0207648_100417522 403
220 3300026095 Ga0207676_10145854 Ga0207676_101458541 403
221 3300028379 Ga0268266_10061196 Ga0268266_100611963 403
222 3300028577 Ga0265318_10001168 Ga0265318_100011684 403
223 3300028800 Ga0265338_10103533 Ga0265338_101035332 403
224 3300031235 Ga0265330_10004200 Ga0265330_100042007 403
225 3300031238 Ga0265332_10006076 Ga0265332_100060764 403
226 3300031240 Ga0265320_10003888 Ga0265320_100038885 403
227 3300031249 Ga0265339_10002925 Ga0265339_100029259 403
228 3300031250 Ga0265331_10015833 Ga0265331_100158333 403
229 3300031711 Ga0265314_10010051 Ga0265314_100100512 403
230 3300031712 Ga0265342_10003379 Ga0265342_1000337913 403
231 3300044712 Ga0453684_0268687 Ga0453684_0268687_396_1634 403
232 3300005353 Ga0070669_100205304 Ga0070669_1002053041 404
233 3300005355 Ga0070671_100012821 Ga0070671_1000128217 404
234 3300005467 Ga0070706_100145415 Ga0070706_1001454151 404
235 3300005471 Ga0070698_100192455 Ga0070698_1001924551 404
236 3300005536 Ga0070697_100058339 Ga0070697_1000583392 404
237 3300005545 Ga0070695_100049191 Ga0070695_1000491913 404
238 3300005616 Ga0068852_100199567 Ga0068852_1001995671 404
239 3300005841 Ga0068863_100064530 Ga0068863_1000645302 404
240 3300006237 Ga0097621_100015074 Ga0097621_1000150745 404
241 3300006237 Ga0097621_100021726 Ga0097621_1000217263 404
242 3300006358 Ga0068871_100093548 Ga0068871_1000935482 404
243 3300006871 Ga0075434_100002871 Ga0075434_1000028715 404
244 3300006914 Ga0075436_100037177 Ga0075436_1000371773 404
245 3300006914 Ga0075436_100176785 Ga0075436_1001767851 404
246 3300007076 Ga0075435_100016803 Ga0075435_1000168036 404
247 3300007788 Ga0099795_10000175 Ga0099795_100001751 404
248 3300009177 Ga0105248_10354700 Ga0105248_103547002 404
249 3300010159 Ga0099796_10003228 Ga0099796_100032281 404
250 3300013296 Ga0157374_10038459 Ga0157374_100384594 404
251 3300013297 Ga0157378_10178615 Ga0157378_101786151 404
252 3300013306 Ga0163162_10031134 Ga0163162_100311342 404
253 3300013306 Ga0163162_10374932 Ga0163162_103749321 404
254 3300013308 Ga0157375_10008724 Ga0157375_100087246 404
255 3300025923 Ga0207681_10040061 Ga0207681_100400613 404
256 3300025925 Ga0207650_10023180 Ga0207650_100231802 404
257 3300025941 Ga0207711_10256674 Ga0207711_102566741 404
258 3300027512 Ga0209179_1000008 Ga0209179_100000864 404
259 3300042876 Ga0451577_0013161 Ga0451577_0013161_2726_3964 404
260 3300044712 Ga0453684_0000312 Ga0453684_0000312_30711_31949 404
261 3300046459 Ga0495629_0033748 Ga0495629_0033748_1800_3047 404
262 3300046462 Ga0495651_0054755 Ga0495651_0054755_1184_2458 404
263 3300046517 Ga0495630_0104889 Ga0495630_0104889_333_1607 404
264 3300046529 Ga0495652_0037149 Ga0495652_0037149_313_1587 404
265 3300046533 Ga0495640_0160163 Ga0495640_0160163_105_1379 404
266 3300046535 Ga0495586_0108662 Ga0495586_0108662_72_1313 404
267 3300046543 Ga0495645_0041550 Ga0495645_0041550_372_1619 404
268 3300047471 Ga0495684_0035259 Ga0495684_0035259_135_1376 404
269 3300048912 Ga0496109_0277935 Ga0496109_0277935_288_1565 404
270 3300048915 Ga0496112_0159282 Ga0496112_0159282_442_1719 404
271 3300048915 Ga0496112_0254335 Ga0496112_0254335_298_1569 404
272 3300048918 Ga0496115_0047037 Ga0496115_0047037_1692_2966 404
273 3300050512 nmdc:mga0n895_1373_c1 nmdc:mga0n895_1373_c1_12952_14196 404
274 3300050513 nmdc:mga0rr50_217263_c1 nmdc:mga0rr50_217263_c1_106_1347 404
275 3300050513 nmdc:mga0rr50_22907_c1 nmdc:mga0rr50_22907_c1_2382_3626 404
276 3300013296 Ga0157374_10086803 Ga0157374_100868032 405
277 3300013297 Ga0157378_10288787 Ga0157378_102887872 405
278 3300013306 Ga0163162_10053474 Ga0163162_100534743 405
279 3300013308 Ga0157375_10031615 Ga0157375_100316153 405
280 3300014969 Ga0157376_10023132 Ga0157376_100231323 405
281 3300025937 Ga0207669_10112727 Ga0207669_101127272 405
282 3300041496 Ga0451839_1427272 Ga0451839_1427272_146_1390 405
283 3300048914 Ga0496111_0171378 Ga0496111_0171378_223_1509 405
284 3300005334 Ga0068869_100010949 Ga0068869_1000109493 407
285 3300005468 Ga0070707_100001481 Ga0070707_1000014815 407
286 3300005471 Ga0070698_100005046 Ga0070698_10000504610 407
287 3300005549 Ga0070704_100001768 Ga0070704_1000017683 407
288 3300005843 Ga0068860_100007093 Ga0068860_1000070938 407
289 3300006914 Ga0075436_100000020 Ga0075436_10000002068 407
290 3300007076 Ga0075435_100000165 Ga0075435_10000016512 407
291 3300009148 Ga0105243_10096344 Ga0105243_100963442 407
292 3300009177 Ga0105248_10002765 Ga0105248_1000276510 407
293 3300010375 Ga0105239_10041887 Ga0105239_100418873 407
294 3300013296 Ga0157374_10044521 Ga0157374_100445213 407
295 3300013297 Ga0157378_10049832 Ga0157378_100498322 407
296 3300025918 Ga0207662_10134600 Ga0207662_101346001 407
297 3300025922 Ga0207646_10006501 Ga0207646_100065015 407
298 3300025938 Ga0207704_10089244 Ga0207704_100892442 407
299 3300025939 Ga0207665_10148022 Ga0207665_101480222 407
300 3300025941 Ga0207711_10013775 Ga0207711_100137755 407
301 3300025942 Ga0207689_10022868 Ga0207689_100228683 407
302 3300028381 Ga0268264_10000964 Ga0268264_100009643 407
303 3300031711 Ga0265314_10023798 Ga0265314_100237983 407
304 3300035692 Ga0373935_0014856 Ga0373935_0014856_2729_3976 407
305 3300046517 Ga0495630_0000002 Ga0495630_0000002_656206_657522 407
306 3300046529 Ga0495652_0069824 Ga0495652_0069824_969_2216 407
307 3300046543 Ga0495645_0126302 Ga0495645_0126302_525_1772 407
308 3300046680 Ga0495646_0039878 Ga0495646_0039878_462_1709 407
309 3300047444 Ga0495675_0078444 Ga0495675_0078444_138_1385 407
310 3300047471 Ga0495684_0009101 Ga0495684_0009101_885_2132 407
311 3300047471 Ga0495684_0030471 Ga0495684_0030471_461_1708 407
312 3300048917 Ga0496114_0000004 Ga0496114_0000004_233074_234321 407
313 3300050513 nmdc:mga0rr50_139_c1 nmdc:mga0rr50_139_c1_25041_26288 407
314 3300050514 nmdc:mga08x19_3_c1 nmdc:mga08x19_3_c1_492755_494002 407
315 3300053083 Ga0495655_0003363 Ga0495655_0003363_1203_2450 407
316 3300053085 Ga0495619_0019039 Ga0495619_0019039_2785_4032 407
317 3300053153 Ga0500616_0000497 Ga0500616_0000497_40228_41475 407

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00909

Ammonium_transp

Ammonium Transporter Family

8

401

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b2f-assembly1.cif.gz_A ammonium transporter amt-1 from a.fulgidus (native) 0.9393 6 404
2b2f-assembly1.cif.gz_A ammonium transporter amt-1 from a.fulgidus (native) 0.937 6 404
2npe-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.9279 3 385
6b21-assembly1.cif.gz_A crystal structure of amtb from e. coli bound to topfluor cardiolipin 0.9263 5 384
2npe-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.9254 3 385
ID Description Score Start End Superfamily
af_Q9BLG4_16_459_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9614 6 406 1.10.3430.10
af_Q4DC59_3_424_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9485 3 406 1.10.3430.10
af_Q2FWL9_1_414_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9482 6 405 1.10.3430.10
af_Q9BLG4_16_459_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9451 6 406 1.10.3430.10
af_Q4DC59_3_424_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9394 3 406 1.10.3430.10
ID Description Score Start End GO Terms
AF-A0A2V8P3E6-F1-model_v4 Ammonium transporter 0.994 15 249 GO:0005886
GO:0008519
AF-A0A1F9Q6D9-F1-model_v4 Ammonium transporter 0.9752 109 404 GO:0005886
GO:0008519
AF-A0A2V8P3E6-F1-model_v4 Ammonium transporter 0.9733 15 249 GO:0005886
GO:0008519
AF-A0A7V3WH94-F1-model_v4 Ammonium transporter 0.973 2 244 GO:0005886
GO:0008519
AF-A0A3M1BJR3-F1-model_v4 Ammonium transporter 0.9719 2 236 GO:0005886
GO:0008519

Feature Viewer

pLDDT pTM Quality
91.85 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map