F404289

General Info

Members Datasets Scaffolds Average Seq Length
317 131 502 227

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0018249|Ga0495653_0018249_793_1599
Length 268
Sequence MEAGNECKLFRCVNATRQRLFLKIVFIDRPAETINAWCIPMCKRSFMLKTGSALLFVLLGGCASVESRSLPYDAWSLDFFAPDYMEVWIETADVVDINERVFRGAGSGIPATGYPRGLSKGVPAHFKGDAKGWFENPTGKGRFVRGAELPRLVYVRWQSMAEPQTYEAYIKIPESARNTMLQGEKTFCRADGKWITDYRDMLIVGLAPGGVAKVWLAGQCLLSTEVIRVQGTINPKGPYGGMSNGKHRPLSEESKAYVEKFGIPYGSW

Samples

Sample ID Description Type Environment
1 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
12 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
18 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
19 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
20 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
26 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
27 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
39 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
40 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
41 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
42 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
43 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
44 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
45 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
46 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
47 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
48 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
49 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
50 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
51 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
52 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
53 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
54 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
55 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
56 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
57 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
58 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
59 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
60 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
61 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
62 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
63 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
64 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
65 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
66 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
69 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
70 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
71 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
72 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
73 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
74 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
75 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
76 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
77 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
78 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
79 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
80 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
81 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
82 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
83 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
89 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
95 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
100 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
101 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
102 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
103 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
106 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
107 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
108 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
114 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
118 2511231007 Pseudomonas sp. GM18 Isolate Nodule
119 2511231008 Pseudomonas sp. GM21 Isolate Nodule
120 2511231014 Pseudomonas sp. GM48 Isolate Nodule
121 2511231019 Pseudomonas sp. GM67 Isolate Nodule
122 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
123 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
124 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
125 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
126 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
127 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
128 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
129 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
130 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
131 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.8
Metatranscriptomes 0
Isolates 8.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.47
Nodule 2.52
Rhizoplane 0.32
Rhizosphere 86.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495653_0018249 3300046463 Bacteria 5701
2 rootH1_10280451 3300003323 Bacteria 2961
3 Ga0055536_1004918 3300003781 Bacteria 6660
4 Ga0055530_10001291 3300003791 Bacteria 18944
5 Ga0055540_1000938 3300003792 Bacteria 18944
6 Ga0055531_10000423 3300003794 Bacteria 40041
7 Ga0065714_10068155 3300005288 Bacteria 4926
8 Ga0065714_10218721 3300005288 Bacteria 836
9 Ga0065712_10001716 3300005290 Bacteria 5546
10 Ga0065715_10092492 3300005293 Bacteria 5095
11 Ga0070669_100000281 3300005353 Bacteria 40520
12 Ga0075432_10002958 3300006058 Bacteria 5720
13 Ga0075436_100391973 3300006914 Bacteria 1005
14 Ga0105251_10050020 3300009011 Bacteria 1998
15 Ga0105244_10008693 3300009036 Bacteria 6318
16 Ga0105250_10009001 3300009092 Bacteria 4219
17 Ga0105250_10009273 3300009092 Bacteria 4149
18 Ga0105246_10001213 3300011119 Bacteria 15101
19 Ga0157336_1001034 3300012477 Bacteria 1378
20 Ga0157347_1001141 3300012502 Bacteria 2010
21 Ga0157373_10279101 3300013100 Bacteria 1184
22 Ga0157371_10001712 3300013102 Bacteria 22329
23 Ga0157370_10241268 3300013104 Bacteria 1672
24 Ga0163162_10049008 3300013306 Bacteria 4233
25 Ga0163162_10071264 3300013306 Bacteria 3528
26 Ga0157375_10028564 3300013308 Bacteria 5231
27 Ga0182008_10034924 3300014497 Bacteria 2520
28 Ga0182008_10086148 3300014497 Bacteria 1547
29 Ga0182008_10102195 3300014497 Bacteria 1417
30 Ga0182008_10185612 3300014497 Bacteria 1054
31 Ga0182006_1023126 3300015261 Bacteria 2576
32 Ga0182006_1036825 3300015261 Bacteria 1943
33 Ga0182006_1091489 3300015261 Bacteria 1094
34 Ga0182006_1098297 3300015261 Bacteria 1042
35 Ga0182006_1115590 3300015261 Bacteria 938
36 Ga0182007_10026635 3300015262 Bacteria 2001
37 Ga0182007_10046440 3300015262 Bacteria 1438
38 Ga0182007_10063665 3300015262 Bacteria 1209
39 Ga0182005_1004657 3300015265 Bacteria 4386
40 Ga0182005_1007199 3300015265 Bacteria 3352
41 Ga0182005_1011847 3300015265 Bacteria 2474
42 Ga0182005_1015329 3300015265 Bacteria 2138
43 Ga0182005_1031669 3300015265 Bacteria 1441
44 Ga0182005_1044343 3300015265 Bacteria 1209
45 Ga0182005_1044345 3300015265 Bacteria 1209
46 Ga0163161_10474818 3300017792 Bacteria 1014
47 Ga0163161_10618637 3300017792 Bacteria 895
48 Ga0209676_1000015 3300025292 Bacteria 784458
49 Ga0209050_1000030 3300025298 Bacteria 463381
50 Ga0209051_1000012 3300025303 Bacteria 595474
51 Ga0209257_1000143 3300025304 Bacteria 199975
52 Ga0207696_1004220 3300025711 Bacteria 6249
53 Ga0207655_1006574 3300025728 Bacteria 7670
54 Ga0207655_1008636 3300025728 Bacteria 6437
55 Ga0207713_1007100 3300025735 Bacteria 6701
56 Ga0207713_1008164 3300025735 Bacteria 6061
57 Ga0207713_1034373 3300025735 Bacteria 2203
58 Ga0207681_10000209 3300025923 Bacteria 46652
59 Ga0207664_10524281 3300025929 Bacteria 1062
60 Ga0207428_10014476 3300027907 Bacteria 6850
61 Ga0237819_01509 3300038705 Bacteria 5929
62 Ga0439438_004335 3300041405 Bacteria 5474
63 Ga0439438_021050 3300041405 Bacteria 1823
64 Ga0439447_004485 3300041407 Bacteria 4790
65 Ga0439466_0003323 3300041411 Bacteria 6251
66 Ga0439432_005584 3300042006 Bacteria 4522
67 Ga0439451_001784 3300042009 Bacteria 4297
68 Ga0439452_003751 3300042010 Bacteria 5235
69 Ga0439452_031126 3300042010 Bacteria 1311
70 Ga0439456_026215 3300042013 Bacteria 1239
71 Ga0439463_017995 3300042016 Bacteria 1757
72 Ga0450905_001421 3300042142 Bacteria 3055
73 Ga0450907_000730 3300042146 Bacteria 8384
74 Ga0439460_0003797 3300042461 Bacteria 3654
75 Ga0495617_006909 3300046452 Bacteria 3962
76 Ga0495617_007357 3300046452 Bacteria 3822
77 Ga0495617_039046 3300046452 Bacteria 1587
78 Ga0495627_016821 3300046453 Bacteria 2497
79 Ga0495627_029873 3300046453 Bacteria 1730
80 Ga0495627_082270 3300046453 Bacteria 932
81 Ga0495603_0186460 3300046455 Bacteria 1200
82 Ga0495590_0002276 3300046457 Bacteria 8013
83 Ga0495590_0005184 3300046457 Bacteria 5184
84 Ga0495590_0013065 3300046457 Bacteria 3062
85 Ga0495591_002169 3300046458 Bacteria 11238
86 Ga0495591_003786 3300046458 Bacteria 7644
87 Ga0495638_0169185 3300046460 Bacteria 1255
88 Ga0495653_0017653 3300046463 Bacteria 5802
89 Ga0495650_0002090 3300046471 Bacteria 17198
90 Ga0495650_0007203 3300046471 Bacteria 6739
91 Ga0495650_0035914 3300046471 Bacteria 2176
92 Ga0495605_0006504 3300046474 Bacteria 6710
93 Ga0495605_0007533 3300046474 Bacteria 6171
94 Ga0495605_0008305 3300046474 Bacteria 5871
95 Ga0495605_0013115 3300046474 Bacteria 4578
96 Ga0495584_0016081 3300046491 Bacteria 3817
97 Ga0495584_0022827 3300046491 Bacteria 3174
98 Ga0495584_0029094 3300046491 Bacteria 2800
99 Ga0495585_0000047 3300046492 Bacteria 120650
100 Ga0495585_0020004 3300046492 Bacteria 3850
101 Ga0495585_0164092 3300046492 Bacteria 1151
102 Ga0495607_0000014 3300046501 Bacteria 186627
103 Ga0495607_0019303 3300046501 Bacteria 4333
104 Ga0495607_0079381 3300046501 Bacteria 1808
105 Ga0495583_0239493 3300046506 Bacteria 729
106 Ga0495606_0003472 3300046507 Bacteria 16708
107 Ga0495606_0003943 3300046507 Bacteria 15251
108 Ga0495606_0027151 3300046507 Bacteria 4065
109 Ga0495606_0031112 3300046507 Bacteria 3716
110 Ga0495610_0001084 3300046512 Bacteria 24882
111 Ga0495610_0009280 3300046512 Bacteria 6236
112 Ga0495610_0032778 3300046512 Bacteria 2694
113 Ga0495616_0000787 3300046513 Bacteria 23180
114 Ga0495616_0012080 3300046513 Bacteria 4916
115 Ga0495620_0000647 3300046515 Bacteria 21679
116 Ga0495620_0006897 3300046515 Bacteria 6205
117 Ga0495620_0007241 3300046515 Bacteria 6042
118 Ga0495630_0010226 3300046517 Bacteria 6770
119 Ga0495631_0006179 3300046518 Bacteria 6206
120 Ga0495632_0137071 3300046519 Bacteria 1137
121 Ga0495637_0012714 3300046520 Bacteria 4017
122 Ga0495637_0030150 3300046520 Bacteria 2407
123 Ga0495637_0095380 3300046520 Bacteria 1168
124 Ga0495643_0010343 3300046522 Bacteria 5744
125 Ga0495643_0059474 3300046522 Bacteria 2031
126 Ga0495643_0069215 3300046522 Bacteria 1855
127 Ga0495648_0015903 3300046524 Bacteria 5439
128 Ga0495648_0071876 3300046524 Bacteria 2004
129 Ga0495666_0010929 3300046526 Bacteria 4527
130 Ga0495642_0114003 3300046528 Bacteria 1157
131 Ga0495654_0000457 3300046530 Bacteria 34381
132 Ga0495654_0003768 3300046530 Bacteria 9183
133 Ga0495654_0007208 3300046530 Bacteria 6236
134 Ga0495654_0046221 3300046530 Bacteria 2145
135 Ga0495587_0006179 3300046536 Bacteria 7818
136 Ga0495587_0037501 3300046536 Bacteria 2909
137 Ga0495587_0212409 3300046536 Bacteria 1092
138 Ga0495609_0005739 3300046538 Bacteria 6459
139 Ga0495597_0006133 3300046542 Bacteria 6253
140 Ga0495597_0010648 3300046542 Bacteria 4484
141 Ga0495597_0062235 3300046542 Bacteria 1624
142 Ga0495597_0149875 3300046542 Bacteria 957
143 Ga0495622_0009761 3300046557 Bacteria 4437
144 Ga0495611_0003224 3300046648 Bacteria 7216
145 Ga0495611_0038684 3300046648 Bacteria 2122
146 Ga0495625_0011420 3300046660 Bacteria 7243
147 Ga0495625_0025270 3300046660 Bacteria 4506
148 Ga0495625_0043694 3300046660 Bacteria 3249
149 Ga0495625_0213215 3300046660 Bacteria 1268
150 Ga0495635_0008047 3300046663 Bacteria 7367
151 Ga0495635_0262344 3300046663 Bacteria 1163
152 Ga0495659_0142433 3300046664 Bacteria 958
153 Ga0495646_0007739 3300046680 Bacteria 6828
154 Ga0495646_0056668 3300046680 Bacteria 2349
155 Ga0495669_0004278 3300046684 Bacteria 5889
156 Ga0495669_0023833 3300046684 Bacteria 2666
157 Ga0495613_0005751 3300046689 Bacteria 9287
158 Ga0495671_0007916 3300046692 Bacteria 6011
159 Ga0495671_0033742 3300046692 Bacteria 2605
160 Ga0495671_0085283 3300046692 Bacteria 1547
161 Ga0495649_0000033 3300046694 Bacteria 136854
162 Ga0495649_0036515 3300046694 Bacteria 2699
163 Ga0495649_0057942 3300046694 Bacteria 2088
164 Ga0495649_0117258 3300046694 Bacteria 1409
165 Ga0495589_0007489 3300046794 Bacteria 5721
166 Ga0495589_0066194 3300046794 Bacteria 1770
167 Ga0495600_0004447 3300046809 Bacteria 8387
168 Ga0495600_0014643 3300046809 Bacteria 4944
169 Ga0495660_0005967 3300046810 Bacteria 7252
170 Ga0495660_0010964 3300046810 Bacteria 5266
171 Ga0495660_0052414 3300046810 Bacteria 2216
172 Ga0495660_0130489 3300046810 Bacteria 1261
173 Ga0495660_0137293 3300046810 Bacteria 1220
174 Ga0495660_0271769 3300046810 Bacteria 778
175 Ga0495581_0042792 3300047315 Bacteria 2621
176 Ga0495604_0163176 3300047317 Bacteria 1573
177 Ga0495636_0001556 3300047318 Bacteria 8729
178 Ga0495672_0000331 3300047320 Bacteria 62021
179 Ga0495672_0005623 3300047320 Bacteria 9894
180 Ga0495672_0009705 3300047320 Bacteria 6941
181 Ga0495672_0012394 3300047320 Bacteria 5951
182 Ga0495672_0110879 3300047320 Bacteria 1473
183 Ga0495672_0166935 3300047320 Bacteria 1126
184 Ga0495680_0011139 3300047322 Bacteria 7984
185 Ga0495680_0013747 3300047322 Bacteria 7044
186 Ga0495680_0015969 3300047322 Bacteria 6460
187 Ga0495683_0006839 3300047323 Bacteria 6198
188 Ga0495675_0004187 3300047444 Bacteria 8730
189 Ga0495679_016713 3300047446 Bacteria 2648
190 Ga0495673_0003273 3300047469 Bacteria 10784
191 Ga0495673_0003675 3300047469 Bacteria 9998
192 Ga0495673_0064754 3300047469 Bacteria 1553
193 Ga0495681_0004028 3300047470 Bacteria 10112
194 Ga0495681_0019844 3300047470 Bacteria 3658
195 Ga0495681_0025468 3300047470 Bacteria 3094
196 Ga0495681_0162562 3300047470 Bacteria 929
197 Ga0495593_0005462 3300047673 Bacteria 7506
198 Ga0495626_0001468 3300048091 Bacteria 18623
199 Ga0496106_0055096 3300048909 Bacteria 3005
200 Ga0496116_0003590 3300048919 Bacteria 15259
201 Ga0496116_0027017 3300048919 Bacteria 4183
202 Ga0496117_0010027 3300048920 Bacteria 8705
203 Ga0496117_0069990 3300048920 Bacteria 2359
204 Ga0496117_0072310 3300048920 Bacteria 2306
205 Ga0496117_0074045 3300048920 Bacteria 2269
206 Ga0496118_0011111 3300048921 Bacteria 8834
207 Ga0496118_0028808 3300048921 Bacteria 4668
208 Ga0496118_0084252 3300048921 Bacteria 2218
209 Ga0496119_0020688 3300048922 Bacteria 4786
210 Ga0496121_0016563 3300048924 Bacteria 7603
211 Ga0496121_0101281 3300048924 Bacteria 2221
212 Ga0496122_0024534 3300048925 Bacteria 5274
213 Ga0496122_0029561 3300048925 Bacteria 4619
214 Ga0496123_0009419 3300048926 Bacteria 8799
215 Ga0496125_0069949 3300048928 Bacteria 2750
216 Ga0495678_010092 3300049459 Bacteria 4610
217 Ga0495678_017070 3300049459 Bacteria 3299
218 Ga0495678_056115 3300049459 Bacteria 1500
219 Ga0495678_066663 3300049459 Bacteria 1332
220 Ga0495682_0004092 3300049460 Bacteria 6337
221 Ga0495682_0007504 3300049460 Bacteria 4332
222 Ga0495682_0011438 3300049460 Bacteria 3414
223 nmdc:mga00v17_149513_c1 3300050491 Bacteria 1500
224 nmdc:mga08x19_368780_c1 3300050514 Bacteria 1004
225 Ga0500572_001323 3300053111 Bacteria 6907
226 2511269917 2511231007 Bacteria 6306603
227 2511269918 2511231007 Bacteria 6306603
228 2511275601 2511231008 Bacteria 6624100
229 2511275602 2511231008 Bacteria 6624100
230 2511313763 2511231014 Bacteria 6462302
231 2511313764 2511231014 Bacteria 6462302
232 2511313765 2511231014 Bacteria 6462302
233 2511343192 2511231019 Bacteria 6520662
234 2624483597 2623620443 Bacteria 6427864
235 2808959894 2808606382 Bacteria 6841132
236 2808959976 2808606382 Bacteria 6841132
237 2904551840 2904550169 Bacteria 6221258
238 2904555870 2904550169 Bacteria 6221258
239 2904555915 2904550169 Bacteria 6221258
240 2904555916 2904550169 Bacteria 6221258
241 2904555917 2904550169 Bacteria 6221258
242 2919065327 2919063839 Bacteria 6302690
243 2931398293 2931396565 Bacteria 7251677
244 2931398294 2931396565 Bacteria 7251677
245 3007517355 3007511990 Bacteria 6481491
246 3007517356 3007511990 Bacteria 6481491
247 3007624547 3007619802 Bacteria 6411688
248 3007719612 3007718800 Bacteria 5971527
249 8056177244 8056172158 Bacteria 6133900
250 8056570652 8056569372 Bacteria 5997322
251 8056570653 8056569372 Bacteria 5997322
252 Ga0495653_0018249
253 rootH1_10280451
254 Ga0055536_1004918
255 Ga0055530_10001291
256 Ga0055540_1000938
257 Ga0055531_10000423
258 Ga0065714_10068155
259 Ga0065714_10218721
260 Ga0065712_10001716
261 Ga0065715_10092492
262 Ga0070669_100000281
263 Ga0075432_10002958
264 Ga0075436_100391973
265 Ga0105251_10050020
266 Ga0105244_10008693
267 Ga0105250_10009001
268 Ga0105250_10009273
269 Ga0105246_10001213
270 Ga0157336_1001034
271 Ga0157347_1001141
272 Ga0157373_10279101
273 Ga0157371_10001712
274 Ga0157370_10241268
275 Ga0163162_10049008
276 Ga0163162_10071264
277 Ga0157375_10028564
278 Ga0182008_10034924
279 Ga0182008_10086148
280 Ga0182008_10102195
281 Ga0182008_10185612
282 Ga0182006_1023126
283 Ga0182006_1036825
284 Ga0182006_1091489
285 Ga0182006_1098297
286 Ga0182006_1115590
287 Ga0182007_10026635
288 Ga0182007_10046440
289 Ga0182007_10063665
290 Ga0182005_1004657
291 Ga0182005_1007199
292 Ga0182005_1011847
293 Ga0182005_1015329
294 Ga0182005_1031669
295 Ga0182005_1044343
296 Ga0182005_1044345
297 Ga0163161_10474818
298 Ga0163161_10618637
299 Ga0209676_1000015
300 Ga0209050_1000030
301 Ga0209051_1000012
302 Ga0209257_1000143
303 Ga0207696_1004220
304 Ga0207655_1006574
305 Ga0207655_1008636
306 Ga0207713_1007100
307 Ga0207713_1008164
308 Ga0207713_1034373
309 Ga0207681_10000209
310 Ga0207664_10524281
311 Ga0207428_10014476
312 Ga0237819_01509
313 Ga0439438_004335
314 Ga0439438_021050
315 Ga0439447_004485
316 Ga0439466_0003323
317 Ga0439432_005584
318 Ga0439451_001784
319 Ga0439452_003751
320 Ga0439452_031126
321 Ga0439456_026215
322 Ga0439463_017995
323 Ga0450905_001421
324 Ga0450907_000730
325 Ga0439460_0003797
326 Ga0495617_006909
327 Ga0495617_007357
328 Ga0495617_039046
329 Ga0495627_016821
330 Ga0495627_029873
331 Ga0495627_082270
332 Ga0495603_0186460
333 Ga0495590_0002276
334 Ga0495590_0005184
335 Ga0495590_0013065
336 Ga0495591_002169
337 Ga0495591_003786
338 Ga0495638_0169185
339 Ga0495653_0017653
340 Ga0495650_0002090
341 Ga0495650_0007203
342 Ga0495650_0035914
343 Ga0495605_0006504
344 Ga0495605_0007533
345 Ga0495605_0008305
346 Ga0495605_0013115
347 Ga0495584_0016081
348 Ga0495584_0022827
349 Ga0495584_0029094
350 Ga0495585_0000047
351 Ga0495585_0020004
352 Ga0495585_0164092
353 Ga0495607_0000014
354 Ga0495607_0019303
355 Ga0495607_0079381
356 Ga0495583_0239493
357 Ga0495606_0003472
358 Ga0495606_0003943
359 Ga0495606_0027151
360 Ga0495606_0031112
361 Ga0495610_0001084
362 Ga0495610_0009280
363 Ga0495610_0032778
364 Ga0495616_0000787
365 Ga0495616_0012080
366 Ga0495620_0000647
367 Ga0495620_0006897
368 Ga0495620_0007241
369 Ga0495630_0010226
370 Ga0495631_0006179
371 Ga0495632_0137071
372 Ga0495637_0012714
373 Ga0495637_0030150
374 Ga0495637_0095380
375 Ga0495643_0010343
376 Ga0495643_0059474
377 Ga0495643_0069215
378 Ga0495648_0015903
379 Ga0495648_0071876
380 Ga0495666_0010929
381 Ga0495642_0114003
382 Ga0495654_0000457
383 Ga0495654_0003768
384 Ga0495654_0007208
385 Ga0495654_0046221
386 Ga0495587_0006179
387 Ga0495587_0037501
388 Ga0495587_0212409
389 Ga0495609_0005739
390 Ga0495597_0006133
391 Ga0495597_0010648
392 Ga0495597_0062235
393 Ga0495597_0149875
394 Ga0495622_0009761
395 Ga0495611_0003224
396 Ga0495611_0038684
397 Ga0495625_0011420
398 Ga0495625_0025270
399 Ga0495625_0043694
400 Ga0495625_0213215
401 Ga0495635_0008047
402 Ga0495635_0262344
403 Ga0495659_0142433
404 Ga0495646_0007739
405 Ga0495646_0056668
406 Ga0495669_0004278
407 Ga0495669_0023833
408 Ga0495613_0005751
409 Ga0495671_0007916
410 Ga0495671_0033742
411 Ga0495671_0085283
412 Ga0495649_0000033
413 Ga0495649_0036515
414 Ga0495649_0057942
415 Ga0495649_0117258
416 Ga0495589_0007489
417 Ga0495589_0066194
418 Ga0495600_0004447
419 Ga0495600_0014643
420 Ga0495660_0005967
421 Ga0495660_0010964
422 Ga0495660_0052414
423 Ga0495660_0130489
424 Ga0495660_0137293
425 Ga0495660_0271769
426 Ga0495581_0042792
427 Ga0495604_0163176
428 Ga0495636_0001556
429 Ga0495672_0000331
430 Ga0495672_0005623
431 Ga0495672_0009705
432 Ga0495672_0012394
433 Ga0495672_0110879
434 Ga0495672_0166935
435 Ga0495680_0011139
436 Ga0495680_0013747
437 Ga0495680_0015969
438 Ga0495683_0006839
439 Ga0495675_0004187
440 Ga0495679_016713
441 Ga0495673_0003273
442 Ga0495673_0003675
443 Ga0495673_0064754
444 Ga0495681_0004028
445 Ga0495681_0019844
446 Ga0495681_0025468
447 Ga0495681_0162562
448 Ga0495593_0005462
449 Ga0495626_0001468
450 Ga0496106_0055096
451 Ga0496116_0003590
452 Ga0496116_0027017
453 Ga0496117_0010027
454 Ga0496117_0069990
455 Ga0496117_0072310
456 Ga0496117_0074045
457 Ga0496118_0011111
458 Ga0496118_0028808
459 Ga0496118_0084252
460 Ga0496119_0020688
461 Ga0496121_0016563
462 Ga0496121_0101281
463 Ga0496122_0024534
464 Ga0496122_0029561
465 Ga0496123_0009419
466 Ga0496125_0069949
467 Ga0495678_010092
468 Ga0495678_017070
469 Ga0495678_056115
470 Ga0495678_066663
471 Ga0495682_0004092
472 Ga0495682_0007504
473 Ga0495682_0011438
474 nmdc:mga00v17_149513_c1
475 nmdc:mga08x19_368780_c1
476 Ga0500572_001323
477 2511269917
478 2511269918
479 2511275601
480 2511275602
481 2511313763
482 2511313764
483 2511313765
484 2511343192
485 2624483597
486 2808959894
487 2808959976
488 2904551840
489 2904555870
490 2904555915
491 2904555916
492 2904555917
493 2919065327
494 2931398293
495 2931398294
496 3007517355
497 3007517356
498 3007624547
499 3007719612
500 8056177244
501 8056570652
502 8056570653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11153

DUF2931

Protein of unknown function (DUF2931)

63

266

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ro0-assembly1.cif.gz_G crystal structure of genetically detoxified pertussis toxin gdpt. 0.5098 93 125
6rpt-assembly3.cif.gz_C structure of tick complement inhibitor cirpt1 complexed with macroglobubulin domain 4 of human complement c5 0.467 46 124
6hxt-assembly2.cif.gz_C crystal structure of the head domain of human ccdc61 0.383 98 189
4mym-assembly1.cif.gz_A-2 crystal structure of a glyoxalase/ bleomycin resistance protein/ dioxygenase from nocardioides 0.3678 157 179
8g7x-assembly2.cif.gz_B human fatty acid synthase dehydratase domain 0.3635 46 123
ID Description Score Start End Superfamily
af_Q54QB8_226_384_3.30.420.110 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;MutS, connector domain 0.6606 105 132 3.30.420.110
af_A0A0R0L9U5_1_180_3.30.420.110 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;MutS, connector domain 0.6179 98 125 3.30.420.110
af_Q54P75_35_215_3.30.420.110 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;MutS, connector domain 0.6005 105 135 3.30.420.110
af_Q23405_33_196_3.30.420.110 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;MutS, connector domain 0.5563 103 134 3.30.420.110
5jtwD04 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5353 46 127 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7W7JN32-F1-model_v4 deleted 0.9677 35 222
AF-A0A1H9S752-F1-model_v4 DUF2931 family protein 0.9605 35 222
AF-A0A1E4W882-F1-model_v4 deleted 0.9572 102 222
AF-A0A5E9GGU4-F1-model_v4 deleted 0.9569 46 222
AF-A0A3M5KBD2-F1-model_v4 deleted 0.9541 56 222

Map