F404374

General Info

Members Datasets Scaffolds Average Seq Length
317 239 634 257

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2751185821|2753463786
Length 315
Sequence PTPSGDRTALFEFLQRLGDNALILGHRLSEWCGHAPALEEDIALANTALDLIGQTQLWLGLAGEVEGKGRSADDLAYLRDATEFRNVLLVERPNGDFGKTLLRQLLFDAWHLLLLQALRSSADKRIADIAEKASKEVAYHLDRSRDLVVRLGDGTAESHRRMQEALDELWPYTGELFIGDPADAELAAAGIAPTPERLKAAWDEVVGATLAAATLKKPADGYMHQGGKRGVHTEHIGFILAEMXELAAAGIAPAPERLKAAWDEVVGATLAAATLKKPADGYMHQGGKRGVHTEHIGFILAEMQFLQRAYPGATW

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
59 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
66 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
67 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
71 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
131 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
177 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
181 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
182 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
183 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
184 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
185 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
186 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
187 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
188 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
189 2516143018 Ensifer sp. BR816 Isolate Nodule
190 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
191 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
192 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
193 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
194 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
195 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
196 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
197 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
198 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
199 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
200 2643221599 Rhizobium sp. Root708 Isolate Unclassified
201 2643221621 Achromobacter sp. Root83 Isolate Unclassified
202 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
203 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
204 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
205 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
206 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
207 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
208 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
209 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
210 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
211 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
212 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
213 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
214 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
215 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
216 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
217 2858950400 Achromobacter sp. K91 Isolate Unclassified
218 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
219 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
220 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
221 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
222 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
223 2941479691
224 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
225 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
226 2996887358 Rhizobium sp. R711 Isolate Nodule
227 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
228 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
229 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
230 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
231 8005258706 Rhizobium sp. R693 Isolate Nodule
232 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
233 8005321885 Rhizobium sp. R72 Isolate Nodule
234 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
235 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
236 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
237 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
238 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
239 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.65
Metatranscriptomes 0
Isolates 17.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.87
Nodule 9.15
Rhizoplane 2.21
Rhizosphere 49.21
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10029556 3300001979 Bacteria 1798
2 JGI24740J21852_10050565 3300001979 Bacteria 1195
3 JGI25155J39150_1000020 3300002704 Bacteria 152963
4 JGI25156J39149_1000021 3300002705 Bacteria 152968
5 JGI25162J39368_1000476 3300002737 Bacteria 30796
6 JGI25162J39368_1001403 3300002737 Bacteria 13139
7 JGI25154J39366_1000039 3300002738 Bacteria 152972
8 JGI25157J39369_1000019 3300002741 Bacteria 176591
9 JGI25151J46595_10001702 3300003187 Bacteria 14367
10 JGI25151J46595_10008247 3300003187 Bacteria 5025
11 JGI25165J46597_1000068 3300003214 Bacteria 196201
12 JGI25165J46597_1000537 3300003214 Bacteria 35164
13 rootH2_10183881 3300003320 Bacteria 2258
14 rootH1_10034734 3300003323 Bacteria 8289
15 Ga0055526_1000303 3300003771 Bacteria 41129
16 Ga0055526_1003505 3300003771 Bacteria 9921
17 Ga0055526_1003534 3300003771 Bacteria 9868
18 Ga0055526_1009070 3300003771 Bacteria 4853
19 Ga0055526_1027977 3300003771 Bacteria 1721
20 Ga0055537_1001681 3300003773 Bacteria 8205
21 Ga0055524_1000402 3300003775 Bacteria 36997
22 Ga0055524_1007404 3300003775 Bacteria 4667
23 Ga0055536_1000158 3300003781 Bacteria 58733
24 Ga0055534_1001061 3300003784 Bacteria 11910
25 Ga0055534_1002288 3300003784 Bacteria 6729
26 Ga0055528_1012178 3300003790 Bacteria 3357
27 Ga0055540_1011084 3300003792 Bacteria 2942
28 Ga0055540_1013851 3300003792 Bacteria 2440
29 Ga0070668_100004039 3300005347 Bacteria 10856
30 Ga0070669_100115447 3300005353 Bacteria 2042
31 Ga0070671_100052708 3300005355 Bacteria 3382
32 Ga0070674_100015723 3300005356 Bacteria 4731
33 Ga0070659_100197446 3300005366 Bacteria 1655
34 Ga0070667_100697888 3300005367 Bacteria 939
35 Ga0070708_100183818 3300005445 Bacteria 1954
36 Ga0070662_100052590 3300005457 Bacteria 2945
37 Ga0068867_100068824 3300005459 Bacteria 2642
38 Ga0070685_10081811 3300005466 Bacteria 1937
39 Ga0070706_100094354 3300005467 Bacteria 2776
40 Ga0070706_100498370 3300005467 Bacteria 1133
41 Ga0070699_100060494 3300005518 Bacteria 3282
42 Ga0070684_100130627 3300005535 Bacteria 2266
43 Ga0070697_100003615 3300005536 Bacteria 11874
44 Ga0070697_100102065 3300005536 Bacteria 2383
45 Ga0070672_100036184 3300005543 Bacteria 3759
46 Ga0068856_100168599 3300005614 Bacteria 2201
47 Ga0068861_100008169 3300005719 Bacteria 7202
48 Ga0068862_100003804 3300005844 Bacteria 12855
49 Ga0081539_10000161 3300005985 Bacteria 156560
50 Ga0081539_10043493 3300005985 Bacteria 2603
51 Ga0070717_10297326 3300006028 Unclassified 1435
52 Ga0075365_10000188 3300006038 Bacteria 20119
53 Ga0075363_100099552 3300006048 Bacteria 1608
54 Ga0075362_10211394 3300006177 Bacteria 946
55 Ga0075367_10000065 3300006178 Bacteria 26310
56 Ga0075369_10000260 3300006186 Bacteria 15573
57 Ga0075369_10068110 3300006186 Bacteria 1564
58 Ga0075428_100001020 3300006844 Bacteria 29707
59 Ga0075428_100001300 3300006844 Bacteria 26505
60 Ga0075428_100055322 3300006844 Bacteria 4347
61 Ga0075428_100079542 3300006844 Bacteria 3578
62 Ga0075428_100340080 3300006844 Bacteria 1612
63 Ga0075430_100054711 3300006846 Bacteria 3357
64 Ga0075431_100003294 3300006847 Bacteria 15634
65 Ga0075431_100026802 3300006847 Bacteria 5911
66 Ga0075431_100028431 3300006847 Bacteria 5746
67 Ga0075431_100042473 3300006847 Bacteria 4690
68 Ga0075431_100384633 3300006847 Unclassified 1407
69 Ga0075433_10008299 3300006852 Bacteria 8280
70 Ga0075434_100021659 3300006871 Bacteria 6250
71 Ga0075429_100007787 3300006880 Bacteria 9304
72 Ga0075429_100352965 3300006880 Bacteria 1287
73 Ga0075435_100218526 3300007076 Bacteria 1618
74 Ga0105250_10071593 3300009092 Bacteria 1400
75 Ga0105240_10896138 3300009093 Bacteria 955
76 Ga0111539_10000794 3300009094 Bacteria 41122
77 Ga0111539_10017029 3300009094 Bacteria 8996
78 Ga0111539_10239524 3300009094 Bacteria 2112
79 Ga0114129_10030299 3300009147 Bacteria 7658
80 Ga0105241_10034715 3300009174 Bacteria 3791
81 Ga0105248_10070539 3300009177 Bacteria 3924
82 Ga0105237_10015412 3300009545 Bacteria 7956
83 Ga0105238_10138129 3300009551 Bacteria 2415
84 Ga0123340_1051829 3300009763 Bacteria 1457
85 Ga0123341_1070096 3300009765 Bacteria 1541
86 Ga0105239_10072890 3300010375 Bacteria 3776
87 Ga0157378_10024511 3300013297 Bacteria 5310
88 Ga0157378_10806229 3300013297 Bacteria 965
89 Ga0157375_10649068 3300013308 Bacteria 1212
90 Ga0163163_10223043 3300014325 Bacteria 1934
91 Ga0163161_10097801 3300017792 Bacteria 2180
92 Ga0214544_1000029 3300021320 Bacteria 153924
93 Ga0214542_1000092 3300021321 Bacteria 117288
94 Ga0214543_1000045 3300021327 Bacteria 152699
95 Ga0213874_10038515 3300021377 Bacteria 1419
96 Ga0213871_10000788 3300021441 Bacteria 4716
97 Ga0209435_100025 3300025206 Bacteria 198776
98 Ga0209672_106674 3300025228 Bacteria 1852
99 Ga0209437_100023 3300025233 Bacteria 614195
100 Ga0209437_100067 3300025233 Bacteria 317685
101 Ga0209646_1000083 3300025246 Bacteria 198777
102 Ga0209026_1000078 3300025250 Bacteria 198777
103 Ga0209759_1000060 3300025256 Bacteria 198777
104 Ga0209759_1020250 3300025256 Bacteria 1549
105 Ga0209129_1004779 3300025258 Bacteria 5121
106 Ga0209233_1000088 3300025261 Bacteria 317980
107 Ga0209233_1000219 3300025261 Bacteria 104797
108 Ga0209565_1000104 3300025263 Bacteria 124432
109 Ga0209455_1002241 3300025272 Bacteria 7607
110 Ga0209673_1036273 3300025273 Bacteria 1465
111 Ga0209675_1000065 3300025291 Bacteria 174791
112 Ga0209675_1004119 3300025291 Bacteria 6607
113 Ga0209676_1000044 3300025292 Bacteria 416215
114 Ga0209025_1000147 3300025294 Bacteria 180008
115 Ga0209025_1021183 3300025294 Bacteria 3514
116 Ga0209025_1035598 3300025294 Bacteria 2246
117 Ga0209564_1000080 3300025295 Bacteria 263547
118 Ga0209564_1000253 3300025295 Bacteria 114335
119 Ga0209564_1000923 3300025295 Bacteria 38212
120 Ga0209758_1015455 3300025297 Bacteria 3948
121 Ga0209758_1032847 3300025297 Bacteria 2098
122 Ga0209256_1000543 3300025299 Bacteria 54373
123 Ga0207426_1001794 3300025302 Bacteria 16028
124 Ga0209051_1000909 3300025303 Bacteria 29436
125 Ga0209051_1001539 3300025303 Bacteria 19182
126 Ga0209051_1013339 3300025303 Bacteria 3918
127 Ga0207682_10070472 3300025893 Bacteria 1480
128 Ga0207645_10003256 3300025907 Bacteria 12402
129 Ga0207684_10164571 3300025910 Unclassified 1911
130 Ga0207654_10018301 3300025911 Bacteria 3674
131 Ga0207671_10079601 3300025914 Bacteria 2455
132 Ga0207660_10064013 3300025917 Bacteria 2653
133 Ga0207646_10016503 3300025922 Bacteria 6930
134 Ga0207681_10046901 3300025923 Bacteria 2907
135 Ga0207644_10102252 3300025931 Bacteria 2155
136 Ga0207690_10162532 3300025932 Bacteria 1666
137 Ga0207706_10001508 3300025933 Bacteria 23112
138 Ga0207704_10068501 3300025938 Bacteria 2237
139 Ga0207691_10002454 3300025940 Bacteria 18133
140 Ga0207639_10001641 3300026041 Bacteria 15068
141 Ga0207708_10056553 3300026075 Bacteria 2993
142 Ga0207708_10355321 3300026075 Bacteria 1203
143 Ga0207702_10018453 3300026078 Bacteria 5772
144 Ga0207702_10403034 3300026078 Bacteria 1319
145 Ga0207648_10003102 3300026089 Bacteria 17547
146 Ga0207675_100000205 3300026118 Bacteria 54926
147 Ga0207683_10110322 3300026121 Bacteria 2463
148 Ga0209982_1007004 3300027552 Bacteria 1647
149 Ga0210002_1001501 3300027617 Bacteria 3303
150 Ga0209983_1000057 3300027665 Bacteria 16946
151 Ga0209971_1003992 3300027682 Bacteria 3488
152 Ga0209966_1011181 3300027695 Bacteria 1632
153 Ga0209998_10000641 3300027717 Bacteria 9378
154 Ga0209974_10002031 3300027876 Bacteria 7395
155 Ga0207428_10009790 3300027907 Bacteria 8587
156 Ga0207428_10024731 3300027907 Bacteria 5040
157 Ga0307515_10007099 3300028794 Bacteria 22248
158 Ga0307515_10055819 3300028794 Bacteria 5759
159 Ga0268256_1001086 3300030500 Bacteria 17888
160 Ga0307513_10042369 3300031456 Bacteria 5013
161 Ga0307513_10104416 3300031456 Bacteria 2847
162 Ga0307509_10000189 3300031507 Bacteria 96946
163 Ga0307408_100088432 3300031548 Bacteria 2333
164 Ga0307410_10157125 3300031852 Bacteria 1700
165 Ga0373937_0592053 3300036401 Bacteria 1053
166 Ga0436364_0630663 3300037853 Bacteria 1105
167 Ga0436364_0820266 3300037853 Bacteria 1495
168 Ga0436365_0387253 3300039437 Bacteria 1277
169 Ga0436365_0746130 3300039437 Bacteria 3400
170 Ga0436365_1074806 3300039437 Bacteria 1009
171 Ga0436365_1199995 3300039437 Bacteria 1234
172 Ga0436360_1109844 3300039438 Bacteria 2176
173 Ga0436360_1309412 3300039438 Bacteria 8677
174 Ga0436361_0304034 3300039447 Bacteria 5566
175 Ga0436362_0267176 3300039453 Bacteria 3681
176 Ga0439442_045074 3300042002 Bacteria 929
177 Ga0439449_0017489 3300042007 Bacteria 2693
178 Ga0450914_003291 3300042118 Bacteria 1231
179 Ga0450896_006783 3300042133 Bacteria 1573
180 Ga0466972_0020808 3300044658 Bacteria 3276
181 Ga0466966_0122023 3300044684 Bacteria 1600
182 Ga0466970_0000741 3300044765 Bacteria 15890
183 Ga0466957_0002063 3300044842 Bacteria 10743
184 Ga0466958_0031809 3300045836 Bacteria 3136
185 Ga0495638_0042622 3300046460 Bacteria 2866
186 Ga0495650_0003612 3300046471 Bacteria 11145
187 Ga0495672_0021416 3300047320 Bacteria 4217
188 Ga0496105_0181334 3300048908 Bacteria 1724
189 Ga0496108_0478840 3300048911 Bacteria 1088
190 Ga0496109_0179539 3300048912 Bacteria 1988
191 Ga0496110_0315266 3300048913 Bacteria 1424
192 Ga0496111_0268394 3300048914 Bacteria 1266
193 Ga0496116_0015097 3300048919 Bacteria 6123
194 Ga0496117_0056329 3300048920 Bacteria 2739
195 Ga0496119_0002271 3300048922 Bacteria 21345
196 Ga0496119_0022631 3300048922 Bacteria 4490
197 Ga0496120_0019298 3300048923 Bacteria 4365
198 Ga0496120_0066204 3300048923 Bacteria 1999
199 Ga0496120_0104267 3300048923 Bacteria 1493
200 Ga0496121_0001430 3300048924 Bacteria 40317
201 Ga0496121_0232427 3300048924 Bacteria 1290
202 Ga0496122_0000484 3300048925 Bacteria 82756
203 Ga0496122_0044052 3300048925 Bacteria 3488
204 Ga0496122_0056012 3300048925 Bacteria 2944
205 Ga0496123_0000641 3300048926 Bacteria 58369
206 Ga0496124_0050942 3300048927 Bacteria 3524
207 Ga0496124_0070659 3300048927 Bacteria 2895
208 Ga0496124_0429446 3300048927 Bacteria 908
209 Ga0496125_0000011 3300048928 Bacteria 655895
210 Ga0496125_0053529 3300048928 Bacteria 3307
211 Ga0496125_0073124 3300048928 Bacteria 2667
212 Ga0496126_0162544 3300048929 Bacteria 1907
213 Ga0501032_0358313 3300049569 Bacteria 939
214 Ga0501033_0000942 3300049570 Bacteria 26447
215 Ga0501033_0007581 3300049570 Bacteria 8441
216 Ga0501033_0235885 3300049570 Bacteria 1298
217 Ga0501033_0255414 3300049570 Bacteria 1241
218 Ga0501034_0033987 3300049571 Bacteria 5170
219 Ga0501034_0055343 3300049571 Bacteria 3992
220 Ga0501034_0069214 3300049571 Bacteria 3540
221 Ga0501034_0158480 3300049571 Bacteria 2236
222 Ga0501034_0548817 3300049571 Bacteria 1065
223 Ga0501037_0014354 3300049573 Bacteria 5833
224 Ga0501037_0173239 3300049573 Bacteria 1533
225 Ga0501037_0380840 3300049573 Bacteria 970
226 Ga0501039_0121983 3300049575 Bacteria 2043
227 Ga0501046_0030231 3300049580 Bacteria 4398
228 Ga0501047_0001116 3300049581 Bacteria 26651
229 Ga0501067_0047668 3300049583 Bacteria 2377
230 Ga0501068_0005693 3300049584 Bacteria 6824
231 Ga0501069_0138590 3300049585 Bacteria 1395
232 Ga0501071_0022048 3300049587 Bacteria 4439
233 Ga0501075_0464976 3300049591 Bacteria 965
234 Ga0501035_0005194 3300049822 Bacteria 12317
235 Ga0501035_0394965 3300049822 Bacteria 1151
236 Ga0501044_0001409 3300049823 Bacteria 28201
237 Ga0501044_0029505 3300049823 Bacteria 5783
238 Ga0501044_0091922 3300049823 Bacteria 3060
239 nmdc:mga05p37_44564_c1 3300050507 Bacteria 5457
240 nmdc:mga09592_2703_c1 3300050508 Bacteria 14341
241 nmdc:mga06r32_110_c1 3300050510 Bacteria 58239
242 nmdc:mga06r32_111502_c1 3300050510 Bacteria 2692
243 nmdc:mga06r32_348916_c1 3300050510 Unclassified 1464
244 nmdc:mga06r32_36808_c1 3300050510 Bacteria 4627
245 nmdc:mga08y16_330805_c1 3300050511 Bacteria 1567
246 nmdc:mga08y16_332166_c1 3300050511 Bacteria 1563
247 nmdc:mga08y16_3896_c1 3300050511 Bacteria 15538
248 nmdc:mga0rr50_258855_c1 3300050513 Bacteria 1447
249 nmdc:mga0a205_2569_c1 3300050515 Bacteria 16006
250 nmdc:mga0sz30_158841_c1 3300050516 Bacteria 1001
251 Ga0500651_0056619 3300053093 Bacteria 2455
252 Ga0500617_067171 3300053124 Bacteria 1578
253 Ga0500618_001473 3300053125 Bacteria 10423
254 Ga0500568_0045499 3300053139 Bacteria 1746
255 Ga0500568_0064809 3300053139 Bacteria 1407
256 Ga0500588_0027121 3300053146 Bacteria 1610
257 Ga0500604_0082790 3300053151 Bacteria 1039
258 Ga0500622_0003800 3300053156 Bacteria 9830
259 Ga0500622_0015374 3300053156 Bacteria 4098
260 Ga0500622_0017572 3300053156 Bacteria 3807
261 Ga0500627_0077470 3300053158 Bacteria 1479
262 Ga0466962_0030014 3300061719 Bacteria 2603
263 2753463786 2751185821 Bacteria 6189929
264 2511185949 2510917028 Bacteria 6185411
265 2513595795 2513237088 Bacteria 6927906
266 2513870465 2513237138 Bacteria 7368160
267 2516207721 2516143018 Bacteria 6951533
268 2524451245 2524023207 Bacteria 6813453
269 2524463213 2524023209 Bacteria 6679728
270 2535519903 2534681796 Bacteria 7146037
271 2585204741 2582581294 Bacteria 6626667
272 2585268662 2582581306 Bacteria 6450535
273 2585334901 2582581316 Bacteria 7774528
274 2585401339 2582581867 Bacteria 7184437
275 2585821516 2585427590 Bacteria 6824633
276 2599903416 2599185292 Bacteria 6290804
277 2616552760 2615840698 Bacteria 7319877
278 2644003546 2643221599 Bacteria 6292121
279 2644122330 2643221621 Bacteria 6212786
280 2671114288 2667528174 Bacteria 6435400
281 2776267814 2775506902 Bacteria 6208009
282 2776281785 2775506904 Bacteria 5954060
283 2792583553 2791355082 Bacteria 5973319
284 2808990096 2808606387 Bacteria 5697198
285 2819608073 2818991448 Bacteria 6772224
286 2837654380 2837651117 Bacteria 3772164
287 2838030606 2838029111 Bacteria 6603031
288 2841863021 2841859092 Bacteria 5436171
289 2842303923 2842298080 Bacteria 6123127
290 2842477113 2842475841 Bacteria 6603183
291 2842485976 2842482326 Bacteria 7212537
292 2842503910 2842502639 Bacteria 6604161
293 2842519462 2842515876 Bacteria 5436280
294 2857542633 2857537821 Bacteria 5248181
295 2858955515 2858950400 Bacteria 6783797
296 2916004518 2916000859 Bacteria 6865702
297 2919412385 2919408235 Bacteria 6149349
298 2923560396 2923556063 Bacteria 6793593
299 2924179830 2924179722 Bacteria 6843264
300 2933016667 2933011516 Bacteria 5439334
301 2941482181
302 2970096066 2970095765 Bacteria 6936963
303 2989354522 2989349275 Bacteria 6349068
304 2996891267 2996887358 Bacteria 5795980
305 3003672004 3003665799 Bacteria 7279786
306 3005420579 3005416602 Bacteria 7064308
307 3005458433 3005452660 Bacteria 5889319
308 643601036 643348564 Bacteria 8839022
309 8005263816 8005258706 Bacteria 6184835
310 8005318000 8005314921 Bacteria 7072929
311 8005325794 8005321885 Bacteria 5795980
312 8005487703 8005484373 Bacteria 6297373
313 8005547627 8005542996 Bacteria 7077758
314 8005650350 8005645114 Bacteria 6950293
315 8005683799 8005682033 Bacteria 6726518
316 8049297933 8049293176 Bacteria 6128433
317 8055436156 8055431914 Bacteria 4551896
318 JGI24740J21852_10029556
319 JGI24740J21852_10050565
320 JGI25155J39150_1000020
321 JGI25156J39149_1000021
322 JGI25162J39368_1000476
323 JGI25162J39368_1001403
324 JGI25154J39366_1000039
325 JGI25157J39369_1000019
326 JGI25151J46595_10001702
327 JGI25151J46595_10008247
328 JGI25165J46597_1000068
329 JGI25165J46597_1000537
330 rootH2_10183881
331 rootH1_10034734
332 Ga0055526_1000303
333 Ga0055526_1003505
334 Ga0055526_1003534
335 Ga0055526_1009070
336 Ga0055526_1027977
337 Ga0055537_1001681
338 Ga0055524_1000402
339 Ga0055524_1007404
340 Ga0055536_1000158
341 Ga0055534_1001061
342 Ga0055534_1002288
343 Ga0055528_1012178
344 Ga0055540_1011084
345 Ga0055540_1013851
346 Ga0070668_100004039
347 Ga0070669_100115447
348 Ga0070671_100052708
349 Ga0070674_100015723
350 Ga0070659_100197446
351 Ga0070667_100697888
352 Ga0070708_100183818
353 Ga0070662_100052590
354 Ga0068867_100068824
355 Ga0070685_10081811
356 Ga0070706_100094354
357 Ga0070706_100498370
358 Ga0070699_100060494
359 Ga0070684_100130627
360 Ga0070697_100003615
361 Ga0070697_100102065
362 Ga0070672_100036184
363 Ga0068856_100168599
364 Ga0068861_100008169
365 Ga0068862_100003804
366 Ga0081539_10000161
367 Ga0081539_10043493
368 Ga0070717_10297326
369 Ga0075365_10000188
370 Ga0075363_100099552
371 Ga0075362_10211394
372 Ga0075367_10000065
373 Ga0075369_10000260
374 Ga0075369_10068110
375 Ga0075428_100001020
376 Ga0075428_100001300
377 Ga0075428_100055322
378 Ga0075428_100079542
379 Ga0075428_100340080
380 Ga0075430_100054711
381 Ga0075431_100003294
382 Ga0075431_100026802
383 Ga0075431_100028431
384 Ga0075431_100042473
385 Ga0075431_100384633
386 Ga0075433_10008299
387 Ga0075434_100021659
388 Ga0075429_100007787
389 Ga0075429_100352965
390 Ga0075435_100218526
391 Ga0105250_10071593
392 Ga0105240_10896138
393 Ga0111539_10000794
394 Ga0111539_10017029
395 Ga0111539_10239524
396 Ga0114129_10030299
397 Ga0105241_10034715
398 Ga0105248_10070539
399 Ga0105237_10015412
400 Ga0105238_10138129
401 Ga0123340_1051829
402 Ga0123341_1070096
403 Ga0105239_10072890
404 Ga0157378_10024511
405 Ga0157378_10806229
406 Ga0157375_10649068
407 Ga0163163_10223043
408 Ga0163161_10097801
409 Ga0214544_1000029
410 Ga0214542_1000092
411 Ga0214543_1000045
412 Ga0213874_10038515
413 Ga0213871_10000788
414 Ga0209435_100025
415 Ga0209672_106674
416 Ga0209437_100023
417 Ga0209437_100067
418 Ga0209646_1000083
419 Ga0209026_1000078
420 Ga0209759_1000060
421 Ga0209759_1020250
422 Ga0209129_1004779
423 Ga0209233_1000088
424 Ga0209233_1000219
425 Ga0209565_1000104
426 Ga0209455_1002241
427 Ga0209673_1036273
428 Ga0209675_1000065
429 Ga0209675_1004119
430 Ga0209676_1000044
431 Ga0209025_1000147
432 Ga0209025_1021183
433 Ga0209025_1035598
434 Ga0209564_1000080
435 Ga0209564_1000253
436 Ga0209564_1000923
437 Ga0209758_1015455
438 Ga0209758_1032847
439 Ga0209256_1000543
440 Ga0207426_1001794
441 Ga0209051_1000909
442 Ga0209051_1001539
443 Ga0209051_1013339
444 Ga0207682_10070472
445 Ga0207645_10003256
446 Ga0207684_10164571
447 Ga0207654_10018301
448 Ga0207671_10079601
449 Ga0207660_10064013
450 Ga0207646_10016503
451 Ga0207681_10046901
452 Ga0207644_10102252
453 Ga0207690_10162532
454 Ga0207706_10001508
455 Ga0207704_10068501
456 Ga0207691_10002454
457 Ga0207639_10001641
458 Ga0207708_10056553
459 Ga0207708_10355321
460 Ga0207702_10018453
461 Ga0207702_10403034
462 Ga0207648_10003102
463 Ga0207675_100000205
464 Ga0207683_10110322
465 Ga0209982_1007004
466 Ga0210002_1001501
467 Ga0209983_1000057
468 Ga0209971_1003992
469 Ga0209966_1011181
470 Ga0209998_10000641
471 Ga0209974_10002031
472 Ga0207428_10009790
473 Ga0207428_10024731
474 Ga0307515_10007099
475 Ga0307515_10055819
476 Ga0268256_1001086
477 Ga0307513_10042369
478 Ga0307513_10104416
479 Ga0307509_10000189
480 Ga0307408_100088432
481 Ga0307410_10157125
482 Ga0373937_0592053
483 Ga0436364_0630663
484 Ga0436364_0820266
485 Ga0436365_0387253
486 Ga0436365_0746130
487 Ga0436365_1074806
488 Ga0436365_1199995
489 Ga0436360_1109844
490 Ga0436360_1309412
491 Ga0436361_0304034
492 Ga0436362_0267176
493 Ga0439442_045074
494 Ga0439449_0017489
495 Ga0450914_003291
496 Ga0450896_006783
497 Ga0466972_0020808
498 Ga0466966_0122023
499 Ga0466970_0000741
500 Ga0466957_0002063
501 Ga0466958_0031809
502 Ga0495638_0042622
503 Ga0495650_0003612
504 Ga0495672_0021416
505 Ga0496105_0181334
506 Ga0496108_0478840
507 Ga0496109_0179539
508 Ga0496110_0315266
509 Ga0496111_0268394
510 Ga0496116_0015097
511 Ga0496117_0056329
512 Ga0496119_0002271
513 Ga0496119_0022631
514 Ga0496120_0019298
515 Ga0496120_0066204
516 Ga0496120_0104267
517 Ga0496121_0001430
518 Ga0496121_0232427
519 Ga0496122_0000484
520 Ga0496122_0044052
521 Ga0496122_0056012
522 Ga0496123_0000641
523 Ga0496124_0050942
524 Ga0496124_0070659
525 Ga0496124_0429446
526 Ga0496125_0000011
527 Ga0496125_0053529
528 Ga0496125_0073124
529 Ga0496126_0162544
530 Ga0501032_0358313
531 Ga0501033_0000942
532 Ga0501033_0007581
533 Ga0501033_0235885
534 Ga0501033_0255414
535 Ga0501034_0033987
536 Ga0501034_0055343
537 Ga0501034_0069214
538 Ga0501034_0158480
539 Ga0501034_0548817
540 Ga0501037_0014354
541 Ga0501037_0173239
542 Ga0501037_0380840
543 Ga0501039_0121983
544 Ga0501046_0030231
545 Ga0501047_0001116
546 Ga0501067_0047668
547 Ga0501068_0005693
548 Ga0501069_0138590
549 Ga0501071_0022048
550 Ga0501075_0464976
551 Ga0501035_0005194
552 Ga0501035_0394965
553 Ga0501044_0001409
554 Ga0501044_0029505
555 Ga0501044_0091922
556 nmdc:mga05p37_44564_c1
557 nmdc:mga09592_2703_c1
558 nmdc:mga06r32_110_c1
559 nmdc:mga06r32_111502_c1
560 nmdc:mga06r32_348916_c1
561 nmdc:mga06r32_36808_c1
562 nmdc:mga08y16_330805_c1
563 nmdc:mga08y16_332166_c1
564 nmdc:mga08y16_3896_c1
565 nmdc:mga0rr50_258855_c1
566 nmdc:mga0a205_2569_c1
567 nmdc:mga0sz30_158841_c1
568 Ga0500651_0056619
569 Ga0500617_067171
570 Ga0500618_001473
571 Ga0500568_0045499
572 Ga0500568_0064809
573 Ga0500588_0027121
574 Ga0500604_0082790
575 Ga0500622_0003800
576 Ga0500622_0015374
577 Ga0500622_0017572
578 Ga0500627_0077470
579 Ga0466962_0030014
580 2753463786
581 2511185949
582 2513595795
583 2513870465
584 2516207721
585 2524451245
586 2524463213
587 2535519903
588 2585204741
589 2585268662
590 2585334901
591 2585401339
592 2585821516
593 2599903416
594 2616552760
595 2644003546
596 2644122330
597 2671114288
598 2776267814
599 2776281785
600 2792583553
601 2808990096
602 2819608073
603 2837654380
604 2838030606
605 2841863021
606 2842303923
607 2842477113
608 2842485976
609 2842503910
610 2842519462
611 2857542633
612 2858955515
613 2916004518
614 2919412385
615 2923560396
616 2924179830
617 2933016667
618 2941482181
619 2970096066
620 2989354522
621 2996891267
622 3003672004
623 3005420579
624 3005458433
625 643601036
626 8005263816
627 8005318000
628 8005325794
629 8005487703
630 8005547627
631 8005650350
632 8005683799
633 8049297933
634 8055436156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

1

249

0.98

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

244

315

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.9944 17 249
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.9875 14 260
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.987 13 260
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.9817 17 249
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.9796 14 260
ID Description Score Start End Superfamily
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9873 13 260 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9794 13 260 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8602 12 224 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8444 8 254 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8128 12 224 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A519PAS0-F1-model_v4 deleted 0.9987 12 115
AF-A0A533J113-F1-model_v4 deleted 0.9967 15 160
AF-A0A699WU94-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9961 50 170 GO:0005829
GO:0010124
AF-A0A2N2ZBI9-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9958 11 167 GO:0005829
GO:0010124
AF-A0A3D3K2S3-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9951 15 119 GO:0005829
GO:0010124

Map