F404652

General Info

Members Datasets Scaffolds Average Seq Length
318 216 636 319

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10037429|Ga0207703_100374293
Length 363
Sequence MESFGIYGSRLSLRSAGMTAVLAALGRGDSRALTRLCAPVSSTQMLDVLNLALPYFGLIFLGLLCGKLKQIPDTGLAWMNFFLIYVSLPCLFYRVLAQTPLEQLNNPRFIVATILATATMFALSFAVGWLFRRHMGEATIAGLSGAYGNIGYMGPGLALATLGPAANVPVALIFCFDTLLLFALVPFLMTLAAPRREGIAATAFEVGRRIVLHPFIIATVLGVASAAIHFEPPVALDRLMQFLQNAAAPCALFVLGVTVALRPVQKMPWEVPVTITAKLIVHPFVVLTLLSLLGPFDPTWVYTAVLMAALPPALNVFIMARQYDTWVAQASGSVLFGTFVSVVTLTATMWLVKTGALPVSLFR

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
193 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
194 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
204 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
205 2643221736 Bosea sp. Root483D1 Isolate Unclassified
206 2773857925 Microvirga vignae BR3299 Isolate Unclassified
207 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
208 2841760612 Bosea sp. Tri-49 Isolate Nodule
209 2842694124 Methylopila sp. R-72369 Isolate Unclassified
210 2844104063 Bosea sp. Tri-39 Isolate Nodule
211 2851182111 Bosea sp. Tri-44 Isolate Nodule
212 2851246043 Bosea sp. Tri-54 Isolate Nodule
213 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
214 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
215 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
216 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.91
Metatranscriptomes 0
Isolates 4.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.26
Nodule 1.57
Rhizoplane 3.14
Rhizosphere 79.56
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_10037429 3300026035 Bacteria 3865
2 JGI25159J45721_1010031 3300002987 Bacteria 2448
3 JGI25406J46586_10008160 3300003203 Bacteria 4756
4 Ga0065165_1000089 3300005262 Bacteria 150859
5 Ga0070658_10043726 3300005327 Bacteria 3619
6 Ga0070658_10059765 3300005327 Bacteria 3104
7 Ga0070658_10194323 3300005327 Bacteria 1711
8 Ga0070670_100157527 3300005331 Bacteria 1967
9 Ga0068869_100042065 3300005334 Bacteria 3274
10 Ga0070660_100072922 3300005339 Bacteria 2683
11 Ga0070661_100128530 3300005344 Bacteria 1902
12 Ga0070675_100171812 3300005354 Bacteria 1869
13 Ga0070688_100201495 3300005365 Bacteria 1393
14 Ga0070667_100102800 3300005367 Bacteria 2469
15 Ga0070714_100048797 3300005435 Bacteria 3601
16 Ga0070714_100270793 3300005435 Bacteria 1575
17 Ga0070713_100003732 3300005436 Bacteria 10083
18 Ga0070711_100082736 3300005439 Bacteria 2291
19 Ga0070711_100273806 3300005439 Bacteria 1333
20 Ga0070663_100114080 3300005455 Bacteria 2034
21 Ga0070678_100296512 3300005456 Bacteria 1372
22 Ga0070662_100335661 3300005457 Bacteria 1235
23 Ga0070681_10052609 3300005458 Bacteria 4062
24 Ga0070681_10359862 3300005458 Bacteria 1365
25 Ga0070679_100020929 3300005530 Bacteria 6382
26 Ga0070679_100055203 3300005530 Bacteria 3956
27 Ga0070679_100169261 3300005530 Bacteria 2158
28 Ga0070696_100206150 3300005546 Bacteria 1470
29 Ga0068855_100012274 3300005563 Bacteria 10352
30 Ga0068855_100062526 3300005563 Bacteria 4346
31 Ga0068855_100161591 3300005563 Bacteria 2542
32 Ga0068859_100063479 3300005617 Bacteria 3724
33 Ga0068859_100524824 3300005617 Bacteria 1279
34 Ga0068860_100108763 3300005843 Bacteria 2650
35 Ga0081540_1000257 3300005983 Bacteria 55989
36 Ga0081539_10000800 3300005985 Bacteria 61179
37 Ga0070717_10107564 3300006028 Bacteria 2375
38 Ga0075365_10010543 3300006038 Bacteria 5387
39 Ga0075368_10007349 3300006042 Bacteria 3884
40 Ga0075363_100010411 3300006048 Bacteria 4417
41 Ga0075364_10024325 3300006051 Bacteria 3844
42 Ga0075364_10076994 3300006051 Bacteria 2201
43 Ga0075362_10178810 3300006177 Bacteria 1027
44 Ga0075367_10053478 3300006178 Bacteria 2392
45 Ga0075367_10092424 3300006178 Bacteria 1842
46 Ga0075369_10020779 3300006186 Bacteria 2690
47 Ga0075366_10040756 3300006195 Bacteria 2747
48 Ga0075366_10064955 3300006195 Bacteria 2170
49 Ga0075366_10118833 3300006195 Bacteria 1592
50 Ga0097621_100188337 3300006237 Bacteria 1786
51 Ga0075370_10060254 3300006353 Bacteria 2162
52 Ga0068865_100281574 3300006881 Bacteria 1324
53 Ga0075436_100022391 3300006914 Bacteria 4340
54 Ga0097620_100063484 3300006931 Bacteria 3724
55 Ga0097620_100524720 3300006931 Bacteria 1279
56 Ga0105240_10023458 3300009093 Bacteria 8157
57 Ga0105245_10024222 3300009098 Bacteria 5329
58 Ga0105243_10066877 3300009148 Bacteria 2892
59 Ga0105241_10171352 3300009174 Bacteria 1793
60 Ga0105238_10091855 3300009551 Bacteria 3023
61 Ga0105238_10193998 3300009551 Bacteria 2007
62 Ga0163162_10336489 3300013306 Bacteria 1642
63 Ga0157380_10361652 3300014326 Bacteria 1362
64 Ga0209130_1000087 3300025284 Bacteria 155407
65 Ga0209025_1003588 3300025294 Bacteria 14488
66 Ga0209025_1080154 3300025294 Bacteria 1113
67 Ga0207426_1003682 3300025302 Bacteria 8045
68 Ga0207682_10021895 3300025893 Bacteria 2516
69 Ga0207692_10035405 3300025898 Bacteria 2425
70 Ga0207699_10064858 3300025906 Bacteria 2212
71 Ga0207645_10191058 3300025907 Bacteria 1346
72 Ga0207705_10044728 3300025909 Bacteria 3182
73 Ga0207654_10053666 3300025911 Bacteria 2328
74 Ga0207707_10013826 3300025912 Bacteria 7038
75 Ga0207663_10009641 3300025916 Bacteria 5109
76 Ga0207663_10213601 3300025916 Bacteria 1400
77 Ga0207660_10059995 3300025917 Bacteria 2733
78 Ga0207657_10067345 3300025919 Bacteria 3045
79 Ga0207652_10025311 3300025921 Bacteria 4932
80 Ga0207652_10118848 3300025921 Bacteria 2350
81 Ga0207694_10050082 3300025924 Bacteria 3233
82 Ga0207659_10077185 3300025926 Bacteria 2451
83 Ga0207687_10020034 3300025927 Bacteria 4435
84 Ga0207664_10073686 3300025929 Bacteria 2756
85 Ga0207706_10395256 3300025933 Bacteria 1199
86 Ga0207669_10141131 3300025937 Bacteria 1672
87 Ga0207691_10008505 3300025940 Bacteria 9857
88 Ga0207711_10047782 3300025941 Bacteria 3660
89 Ga0207711_10173555 3300025941 Bacteria 1957
90 Ga0207711_10197670 3300025941 Bacteria 1834
91 Ga0207667_10012374 3300025949 Bacteria 9836
92 Ga0207667_10041317 3300025949 Bacteria 4905
93 Ga0207667_10178634 3300025949 Bacteria 2180
94 Ga0207677_10328064 3300026023 Bacteria 1274
95 Ga0207703_10034453 3300026035 Bacteria 4017
96 Ga0207639_10076992 3300026041 Bacteria 2628
97 Ga0207708_10197585 3300026075 Bacteria 1603
98 Ga0207702_10524352 3300026078 Bacteria 1157
99 Ga0207641_10268799 3300026088 Bacteria 1599
100 Ga0207676_10054915 3300026095 Bacteria 3123
101 Ga0207683_10012783 3300026121 Bacteria 7164
102 Ga0207683_10207941 3300026121 Bacteria 1780
103 Ga0207698_10096863 3300026142 Bacteria 2433
104 Ga0209813_10019671 3300027866 Bacteria 1879
105 Ga0268266_10466690 3300028379 Bacteria 1202
106 Ga0265338_10215590 3300028800 Bacteria 1437
107 Ga0265330_10023626 3300031235 Bacteria 2791
108 Ga0265340_10023254 3300031247 Bacteria 3161
109 Ga0265339_10063799 3300031249 Bacteria 1977
110 Ga0265331_10040607 3300031250 Bacteria 2263
111 Ga0265316_10113232 3300031344 Bacteria 2053
112 Ga0265313_10023309 3300031595 Bacteria 3336
113 Ga0316579_10011992 3300031691 Bacteria 3698
114 Ga0265314_10005122 3300031711 Bacteria 11925
115 Ga0265314_10026124 3300031711 Bacteria 4393
116 Ga0265314_10061077 3300031711 Bacteria 2569
117 Ga0265314_10142661 3300031711 Bacteria 1479
118 Ga0265342_10004840 3300031712 Bacteria 10435
119 Ga0307405_10031189 3300031731 Bacteria 3135
120 Ga0373926_0045235 3300035083 Bacteria 1578
121 Ga0373934_0082038 3300035086 Bacteria 1296
122 Ga0373923_0000216 3300035111 Bacteria 11993
123 Ga0373936_0000683 3300035113 Bacteria 11820
124 Ga0373936_0013398 3300035113 Bacteria 3130
125 Ga0373945_0001832 3300035116 Bacteria 6566
126 Ga0373945_0069210 3300035116 Bacteria 1332
127 Ga0373953_0016093 3300035117 Bacteria 2725
128 Ga0373954_0004093 3300035118 Bacteria 6250
129 Ga0373956_0004320 3300035119 Bacteria 5703
130 Ga0373957_0011195 3300035120 Bacteria 2988
131 Ga0373943_0036037 3300035170 Bacteria 2368
132 Ga0373943_0080037 3300035170 Bacteria 1673
133 Ga0373955_0000426 3300035172 Bacteria 17789
134 Ga0373955_0001523 3300035172 Bacteria 9899
135 Ga0373961_0001648 3300035241 Bacteria 6258
136 Ga0373924_0000597 3300035410 Bacteria 11136
137 Ga0373931_0070518 3300035691 Bacteria 1907
138 Ga0373935_0000088 3300035692 Bacteria 40092
139 Ga0373927_0194344 3300035695 Bacteria 1331
140 Ga0373933_0006652 3300035724 Bacteria 6296
141 Ga0373947_0002738 3300035725 Bacteria 10562
142 Ga0373937_0000124 3300036401 Bacteria 73933
143 Ga0373937_0012121 3300036401 Bacteria 7568
144 Ga0373937_0270483 3300036401 Bacteria 1604
145 Ga0373925_0000929 3300037068 Bacteria 26669
146 Ga0237819_05234 3300038705 Bacteria 2051
147 Ga0436365_0255420 3300039437 Bacteria 6473
148 Ga0436365_1126455 3300039437 Bacteria 19004
149 Ga0436365_1741712 3300039437 Bacteria 4479
150 Ga0436363_0921248 3300039450 Bacteria 1367
151 Ga0436362_0556235 3300039453 Bacteria 2188
152 Ga0495592_0000020 3300046454 Bacteria 140576
153 Ga0495592_0024541 3300046454 Bacteria 4582
154 Ga0495603_0007829 3300046455 Bacteria 6441
155 Ga0495629_0045295 3300046459 Bacteria 3086
156 Ga0495629_0133809 3300046459 Bacteria 1726
157 Ga0495651_0001798 3300046462 Bacteria 16533
158 Ga0495653_0000046 3300046463 Bacteria 113893
159 Ga0495653_0084599 3300046463 Bacteria 2336
160 Ga0495639_0119806 3300046475 Bacteria 1255
161 Ga0495662_0001688 3300046476 Bacteria 11019
162 Ga0495664_0000017 3300046477 Bacteria 172210
163 Ga0495664_0016826 3300046477 Bacteria 4174
164 Ga0495664_0135785 3300046477 Bacteria 1490
165 Ga0495608_0000560 3300046511 Bacteria 25606
166 Ga0495618_0000059 3300046514 Bacteria 79623
167 Ga0495618_0027234 3300046514 Bacteria 3558
168 Ga0495628_0000530 3300046516 Bacteria 34897
169 Ga0495628_0001927 3300046516 Bacteria 18830
170 Ga0495630_0002351 3300046517 Bacteria 13117
171 Ga0495652_0001393 3300046529 Bacteria 26853
172 Ga0495652_0015699 3300046529 Bacteria 6778
173 Ga0495652_0145379 3300046529 Bacteria 1859
174 Ga0495665_0095142 3300046531 Bacteria 1564
175 Ga0495640_0000029 3300046533 Bacteria 79567
176 Ga0495640_0020173 3300046533 Bacteria 4909
177 Ga0495586_0066283 3300046535 Bacteria 1969
178 Ga0495587_0000019 3300046536 Bacteria 161972
179 Ga0495587_0042135 3300046536 Bacteria 2723
180 Ga0495645_0000006 3300046543 Bacteria 382503
181 Ga0495645_0023203 3300046543 Bacteria 4492
182 Ga0495667_0000061 3300046559 Bacteria 94650
183 Ga0495634_0000345 3300046642 Bacteria 44890
184 Ga0495634_0163765 3300046642 Bacteria 1401
185 Ga0495635_0000023 3300046663 Bacteria 153429
186 Ga0495635_0050144 3300046663 Bacteria 2878
187 Ga0495657_0002787 3300046675 Bacteria 14535
188 Ga0495599_0000066 3300046678 Bacteria 72412
189 Ga0495599_0009859 3300046678 Bacteria 5848
190 Ga0495623_0000428 3300046679 Bacteria 27653
191 Ga0495646_0000108 3300046680 Bacteria 40754
192 Ga0495646_0128091 3300046680 Bacteria 1431
193 Ga0495647_0096480 3300046681 Bacteria 1219
194 Ga0495613_0157153 3300046689 Bacteria 1619
195 Ga0495624_0039009 3300046690 Bacteria 3047
196 Ga0495600_0000030 3300046809 Bacteria 89424
197 Ga0495600_0001326 3300046809 Bacteria 13661
198 Ga0495581_0015790 3300047315 Bacteria 4385
199 Ga0495604_0000501 3300047317 Bacteria 34507
200 Ga0495674_0001027 3300047319 Bacteria 26811
201 Ga0495674_0047567 3300047319 Bacteria 3802
202 Ga0495680_0024077 3300047322 Bacteria 5054
203 Ga0495680_0044564 3300047322 Bacteria 3507
204 Ga0495675_0000056 3300047444 Bacteria 77625
205 Ga0495675_0116447 3300047444 Unclassified 1666
206 Ga0495684_0000056 3300047471 Bacteria 79718
207 Ga0495684_0440336 3300047471 Bacteria 907
208 Ga0495593_0023880 3300047673 Bacteria 3393
209 Ga0495602_0000006 3300048088 Bacteria 322593
210 Ga0495602_0024466 3300048088 Bacteria 5858
211 Ga0496100_0367881 3300048903 Bacteria 1089
212 Ga0496102_0041646 3300048905 Bacteria 4160
213 Ga0496103_0183004 3300048906 Bacteria 1347
214 Ga0496104_0000090 3300048907 Bacteria 87877
215 Ga0496105_0069997 3300048908 Bacteria 2900
216 Ga0496106_0066563 3300048909 Bacteria 2744
217 Ga0496107_0066871 3300048910 Bacteria 2606
218 Ga0496108_0235999 3300048911 Bacteria 1591
219 Ga0496115_0010308 3300048918 Bacteria 6977
220 Ga0496115_0053290 3300048918 Bacteria 3246
221 Ga0501031_0005509 3300049568 Bacteria 8242
222 Ga0501031_0116458 3300049568 Bacteria 1746
223 Ga0501032_0032382 3300049569 Bacteria 3582
224 Ga0501032_0125815 3300049569 Bacteria 1693
225 Ga0501033_0004953 3300049570 Bacteria 10591
226 Ga0501033_0012284 3300049570 Bacteria 6536
227 Ga0501034_0000852 3300049571 Bacteria 45151
228 Ga0501034_0009488 3300049571 Bacteria 10186
229 Ga0501034_0176364 3300049571 Bacteria 2103
230 Ga0501034_0179219 3300049571 Bacteria 2084
231 Ga0501036_0006505 3300049572 Bacteria 9494
232 Ga0501037_0242311 3300049573 Bacteria 1263
233 Ga0501038_0023935 3300049574 Bacteria 5453
234 Ga0501039_0144967 3300049575 Bacteria 1866
235 Ga0501039_0180121 3300049575 Bacteria 1662
236 Ga0501046_0006709 3300049580 Bacteria 10165
237 Ga0501046_0287156 3300049580 Bacteria 1204
238 Ga0501047_0009616 3300049581 Bacteria 9142
239 Ga0501047_0014941 3300049581 Bacteria 7389
240 Ga0501047_0022597 3300049581 Bacteria 6039
241 Ga0501047_0044943 3300049581 Bacteria 4269
242 Ga0501047_0048080 3300049581 Bacteria 4120
243 Ga0501069_0012513 3300049585 Bacteria 4514
244 Ga0501069_0073102 3300049585 Bacteria 1922
245 Ga0501070_0011777 3300049586 Bacteria 7386
246 Ga0501070_0041261 3300049586 Bacteria 3845
247 Ga0501070_0069351 3300049586 Bacteria 2919
248 Ga0501070_0105845 3300049586 Bacteria 2325
249 Ga0501070_0196924 3300049586 Bacteria 1655
250 Ga0501072_0173220 3300049588 Bacteria 1722
251 Ga0501072_0205538 3300049588 Bacteria 1570
252 Ga0501073_0079293 3300049589 Bacteria 2285
253 Ga0501073_0233872 3300049589 Bacteria 1269
254 Ga0501076_0037645 3300049592 Bacteria 3795
255 Ga0501252_005242 3300049682 Bacteria 1404
256 Ga0501083_0013974 3300049744 Bacteria 5610
257 Ga0501083_0291215 3300049744 Bacteria 1062
258 Ga0501035_0001359 3300049822 Bacteria 25173
259 Ga0501035_0006609 3300049822 Bacteria 10852
260 Ga0501035_0088731 3300049822 Bacteria 2724
261 Ga0501035_0194802 3300049822 Bacteria 1741
262 Ga0501044_0045601 3300049823 Bacteria 4541
263 Ga0501044_0171698 3300049823 Bacteria 2139
264 nmdc:mga0yw44_137986_c1 3300050492 Bacteria 1583
265 nmdc:mga0k408_15093_c1 3300050493 Bacteria 4269
266 nmdc:mga06z11_22758_c1 3300050494 Bacteria 2932
267 nmdc:mga06z11_9161_c1 3300050494 Bacteria 4161
268 nmdc:mga07m45_92514_c1 3300050496 Bacteria 1733
269 nmdc:mga0qj67_45013_c1 3300050509 Bacteria 3481
270 nmdc:mga08y16_230517_c1 3300050511 Bacteria 1915
271 nmdc:mga08y16_281487_c1 3300050511 Bacteria 1715
272 nmdc:mga08x19_4942_c1 3300050514 Bacteria 7874
273 Ga0495601_0000007 3300053077 Bacteria 365972
274 Ga0495601_0000360 3300053077 Bacteria 23959
275 Ga0495601_0005300 3300053077 Bacteria 7505
276 Ga0495601_0012407 3300053077 Bacteria 5112
277 Ga0495612_0000108 3300053078 Bacteria 34924
278 Ga0495612_0001978 3300053078 Bacteria 8443
279 Ga0495612_0042581 3300053078 Bacteria 1853
280 Ga0495595_0000031 3300053084 Bacteria 89199
281 Ga0495595_0000969 3300053084 Bacteria 11036
282 Ga0495595_0013814 3300053084 Bacteria 3417
283 Ga0495619_0000023 3300053085 Bacteria 182266
284 Ga0495619_0000581 3300053085 Bacteria 24290
285 Ga0495619_0001851 3300053085 Bacteria 14080
286 Ga0495619_0002471 3300053085 Bacteria 12094
287 Ga0500643_005433 3300053087 Bacteria 5491
288 Ga0500644_0000331 3300053088 Bacteria 24183
289 Ga0500651_0134301 3300053093 Bacteria 1495
290 Ga0500641_0009223 3300053096 Bacteria 3543
291 Ga0500641_0029281 3300053096 Bacteria 2157
292 Ga0500595_000002 3300053119 Bacteria 1074388
293 Ga0500595_007827 3300053119 Bacteria 4402
294 Ga0500595_019486 3300053119 Bacteria 2460
295 Ga0500652_000002 3300053131 Bacteria 273315
296 Ga0500616_0000002 3300053153 Bacteria 1611257
297 Ga0500616_0018077 3300053153 Bacteria 3989
298 Ga0500636_0168249 3300053177 Bacteria 1188
299 Ga0500645_000471 3300053730 Bacteria 27490
300 Ga0500645_020930 3300053730 Bacteria 2022
301 Ga0501084_0163498 3300054114 Bacteria 1878
302 Ga0501084_0294928 3300054114 Bacteria 1369
303 Ga0501082_0000012 3300060353 Bacteria 119898
304 Ga0501082_0010372 3300060353 Bacteria 8024
305 Ga0530510_0234704 3300061734 Bacteria 1365
306 2643756398 2643221547 Bacteria 4740017
307 2644747359 2643221736 Bacteria 6608466
308 2774871421 2773857925 Bacteria 6472445
309 2776260630 2775506901 Bacteria 9631051
310 2841761918 2841760612 Bacteria 6454112
311 2842697651 2842694124 Bacteria 4063419
312 2844104943 2844104063 Bacteria 6440972
313 2851184903 2851182111 Bacteria 6047226
314 2851247931 2851246043 Bacteria 6439203
315 2882460224 2882456835 Bacteria 6863978
316 2884300072 2884298095 Bacteria 3823049
317 2917555520 2917554339 Bacteria 4987857
318 8057529914 8057529695 Bacteria 6306553
319 Ga0207703_10037429
320 JGI25159J45721_1010031
321 JGI25406J46586_10008160
322 Ga0065165_1000089
323 Ga0070658_10043726
324 Ga0070658_10059765
325 Ga0070658_10194323
326 Ga0070670_100157527
327 Ga0068869_100042065
328 Ga0070660_100072922
329 Ga0070661_100128530
330 Ga0070675_100171812
331 Ga0070688_100201495
332 Ga0070667_100102800
333 Ga0070714_100048797
334 Ga0070714_100270793
335 Ga0070713_100003732
336 Ga0070711_100082736
337 Ga0070711_100273806
338 Ga0070663_100114080
339 Ga0070678_100296512
340 Ga0070662_100335661
341 Ga0070681_10052609
342 Ga0070681_10359862
343 Ga0070679_100020929
344 Ga0070679_100055203
345 Ga0070679_100169261
346 Ga0070696_100206150
347 Ga0068855_100012274
348 Ga0068855_100062526
349 Ga0068855_100161591
350 Ga0068859_100063479
351 Ga0068859_100524824
352 Ga0068860_100108763
353 Ga0081540_1000257
354 Ga0081539_10000800
355 Ga0070717_10107564
356 Ga0075365_10010543
357 Ga0075368_10007349
358 Ga0075363_100010411
359 Ga0075364_10024325
360 Ga0075364_10076994
361 Ga0075362_10178810
362 Ga0075367_10053478
363 Ga0075367_10092424
364 Ga0075369_10020779
365 Ga0075366_10040756
366 Ga0075366_10064955
367 Ga0075366_10118833
368 Ga0097621_100188337
369 Ga0075370_10060254
370 Ga0068865_100281574
371 Ga0075436_100022391
372 Ga0097620_100063484
373 Ga0097620_100524720
374 Ga0105240_10023458
375 Ga0105245_10024222
376 Ga0105243_10066877
377 Ga0105241_10171352
378 Ga0105238_10091855
379 Ga0105238_10193998
380 Ga0163162_10336489
381 Ga0157380_10361652
382 Ga0209130_1000087
383 Ga0209025_1003588
384 Ga0209025_1080154
385 Ga0207426_1003682
386 Ga0207682_10021895
387 Ga0207692_10035405
388 Ga0207699_10064858
389 Ga0207645_10191058
390 Ga0207705_10044728
391 Ga0207654_10053666
392 Ga0207707_10013826
393 Ga0207663_10009641
394 Ga0207663_10213601
395 Ga0207660_10059995
396 Ga0207657_10067345
397 Ga0207652_10025311
398 Ga0207652_10118848
399 Ga0207694_10050082
400 Ga0207659_10077185
401 Ga0207687_10020034
402 Ga0207664_10073686
403 Ga0207706_10395256
404 Ga0207669_10141131
405 Ga0207691_10008505
406 Ga0207711_10047782
407 Ga0207711_10173555
408 Ga0207711_10197670
409 Ga0207667_10012374
410 Ga0207667_10041317
411 Ga0207667_10178634
412 Ga0207677_10328064
413 Ga0207703_10034453
414 Ga0207639_10076992
415 Ga0207708_10197585
416 Ga0207702_10524352
417 Ga0207641_10268799
418 Ga0207676_10054915
419 Ga0207683_10012783
420 Ga0207683_10207941
421 Ga0207698_10096863
422 Ga0209813_10019671
423 Ga0268266_10466690
424 Ga0265338_10215590
425 Ga0265330_10023626
426 Ga0265340_10023254
427 Ga0265339_10063799
428 Ga0265331_10040607
429 Ga0265316_10113232
430 Ga0265313_10023309
431 Ga0316579_10011992
432 Ga0265314_10005122
433 Ga0265314_10026124
434 Ga0265314_10061077
435 Ga0265314_10142661
436 Ga0265342_10004840
437 Ga0307405_10031189
438 Ga0373926_0045235
439 Ga0373934_0082038
440 Ga0373923_0000216
441 Ga0373936_0000683
442 Ga0373936_0013398
443 Ga0373945_0001832
444 Ga0373945_0069210
445 Ga0373953_0016093
446 Ga0373954_0004093
447 Ga0373956_0004320
448 Ga0373957_0011195
449 Ga0373943_0036037
450 Ga0373943_0080037
451 Ga0373955_0000426
452 Ga0373955_0001523
453 Ga0373961_0001648
454 Ga0373924_0000597
455 Ga0373931_0070518
456 Ga0373935_0000088
457 Ga0373927_0194344
458 Ga0373933_0006652
459 Ga0373947_0002738
460 Ga0373937_0000124
461 Ga0373937_0012121
462 Ga0373937_0270483
463 Ga0373925_0000929
464 Ga0237819_05234
465 Ga0436365_0255420
466 Ga0436365_1126455
467 Ga0436365_1741712
468 Ga0436363_0921248
469 Ga0436362_0556235
470 Ga0495592_0000020
471 Ga0495592_0024541
472 Ga0495603_0007829
473 Ga0495629_0045295
474 Ga0495629_0133809
475 Ga0495651_0001798
476 Ga0495653_0000046
477 Ga0495653_0084599
478 Ga0495639_0119806
479 Ga0495662_0001688
480 Ga0495664_0000017
481 Ga0495664_0016826
482 Ga0495664_0135785
483 Ga0495608_0000560
484 Ga0495618_0000059
485 Ga0495618_0027234
486 Ga0495628_0000530
487 Ga0495628_0001927
488 Ga0495630_0002351
489 Ga0495652_0001393
490 Ga0495652_0015699
491 Ga0495652_0145379
492 Ga0495665_0095142
493 Ga0495640_0000029
494 Ga0495640_0020173
495 Ga0495586_0066283
496 Ga0495587_0000019
497 Ga0495587_0042135
498 Ga0495645_0000006
499 Ga0495645_0023203
500 Ga0495667_0000061
501 Ga0495634_0000345
502 Ga0495634_0163765
503 Ga0495635_0000023
504 Ga0495635_0050144
505 Ga0495657_0002787
506 Ga0495599_0000066
507 Ga0495599_0009859
508 Ga0495623_0000428
509 Ga0495646_0000108
510 Ga0495646_0128091
511 Ga0495647_0096480
512 Ga0495613_0157153
513 Ga0495624_0039009
514 Ga0495600_0000030
515 Ga0495600_0001326
516 Ga0495581_0015790
517 Ga0495604_0000501
518 Ga0495674_0001027
519 Ga0495674_0047567
520 Ga0495680_0024077
521 Ga0495680_0044564
522 Ga0495675_0000056
523 Ga0495675_0116447
524 Ga0495684_0000056
525 Ga0495684_0440336
526 Ga0495593_0023880
527 Ga0495602_0000006
528 Ga0495602_0024466
529 Ga0496100_0367881
530 Ga0496102_0041646
531 Ga0496103_0183004
532 Ga0496104_0000090
533 Ga0496105_0069997
534 Ga0496106_0066563
535 Ga0496107_0066871
536 Ga0496108_0235999
537 Ga0496115_0010308
538 Ga0496115_0053290
539 Ga0501031_0005509
540 Ga0501031_0116458
541 Ga0501032_0032382
542 Ga0501032_0125815
543 Ga0501033_0004953
544 Ga0501033_0012284
545 Ga0501034_0000852
546 Ga0501034_0009488
547 Ga0501034_0176364
548 Ga0501034_0179219
549 Ga0501036_0006505
550 Ga0501037_0242311
551 Ga0501038_0023935
552 Ga0501039_0144967
553 Ga0501039_0180121
554 Ga0501046_0006709
555 Ga0501046_0287156
556 Ga0501047_0009616
557 Ga0501047_0014941
558 Ga0501047_0022597
559 Ga0501047_0044943
560 Ga0501047_0048080
561 Ga0501069_0012513
562 Ga0501069_0073102
563 Ga0501070_0011777
564 Ga0501070_0041261
565 Ga0501070_0069351
566 Ga0501070_0105845
567 Ga0501070_0196924
568 Ga0501072_0173220
569 Ga0501072_0205538
570 Ga0501073_0079293
571 Ga0501073_0233872
572 Ga0501076_0037645
573 Ga0501252_005242
574 Ga0501083_0013974
575 Ga0501083_0291215
576 Ga0501035_0001359
577 Ga0501035_0006609
578 Ga0501035_0088731
579 Ga0501035_0194802
580 Ga0501044_0045601
581 Ga0501044_0171698
582 nmdc:mga0yw44_137986_c1
583 nmdc:mga0k408_15093_c1
584 nmdc:mga06z11_22758_c1
585 nmdc:mga06z11_9161_c1
586 nmdc:mga07m45_92514_c1
587 nmdc:mga0qj67_45013_c1
588 nmdc:mga08y16_230517_c1
589 nmdc:mga08y16_281487_c1
590 nmdc:mga08x19_4942_c1
591 Ga0495601_0000007
592 Ga0495601_0000360
593 Ga0495601_0005300
594 Ga0495601_0012407
595 Ga0495612_0000108
596 Ga0495612_0001978
597 Ga0495612_0042581
598 Ga0495595_0000031
599 Ga0495595_0000969
600 Ga0495595_0013814
601 Ga0495619_0000023
602 Ga0495619_0000581
603 Ga0495619_0001851
604 Ga0495619_0002471
605 Ga0500643_005433
606 Ga0500644_0000331
607 Ga0500651_0134301
608 Ga0500641_0009223
609 Ga0500641_0029281
610 Ga0500595_000002
611 Ga0500595_007827
612 Ga0500595_019486
613 Ga0500652_000002
614 Ga0500616_0000002
615 Ga0500616_0018077
616 Ga0500636_0168249
617 Ga0500645_000471
618 Ga0500645_020930
619 Ga0501084_0163498
620 Ga0501084_0294928
621 Ga0501082_0000012
622 Ga0501082_0010372
623 Ga0530510_0234704
624 2643756398
625 2644747359
626 2774871421
627 2776260630
628 2841761918
629 2842697651
630 2844104943
631 2851184903
632 2851247931
633 2882460224
634 2884300072
635 2917555520
636 8057529914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03547

Mem_trans

Membrane transport protein

47

349

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.856 3 313
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.8246 3 313
7wks-assembly1.cif.gz_A apo state of atpin3 0.8235 3 313
7y9t-assembly1.cif.gz_B structure of the auxin exporter pin1 in arabidopsis thaliana in the apo state 0.7964 3 313
7wks-assembly1.cif.gz_A apo state of atpin3 0.7943 3 313
ID Description Score Start End Superfamily
af_Q5JLM1_10_355_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8614 8 307 1.20.1530.20
af_I1MAE5_9_526_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8411 7 308 1.20.1530.20
af_K7LC37_9_437_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8356 7 308 1.20.1530.20
af_I1MI30_9_487_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8338 7 308 1.20.1530.20
af_Q9C9K5_10_382_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8244 7 308 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A543NYZ1-F1-model_v4 deleted 0.9911 1 323
AF-A0A1E1V946-F1-model_v4 Malonate transporter 0.9821 1 323 GO:0005886
GO:0055085
AF-A0A1E1V946-F1-model_v4 Malonate transporter 0.9791 1 323 GO:0005886
GO:0055085
AF-J6LEZ5-F1-model_v4 Malonate transporter 0.9768 4 322 GO:0016020
GO:0055085
AF-A0A2G9WSP3-F1-model_v4 Malonate transporter 0.9755 4 319 GO:0005886
GO:0055085

Map