F404789

General Info

Members Datasets Scaffolds Average Seq Length
318 153 307 348

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0000077|Ga0496114_0000077_59159_60277
Length 372
Sequence MSRASTIKNFKKNIHAIFQSTNLIIMKKLLLLFALTILVVQGYAKPRIIILATGGTIAGSGASASRAGYTAGKIPIEDLIGAIPAAKDVADISGEQIASVGSQDMTIDIWKKLAMRANEIAAKGEADGIVVTHGTDTQEETAYFLDLVCGVNIPIVLTGSMRPATAISADGPKNLYDAITCAADPKSKGRGVIVSFNEGLYDGRDVMKMSTTKTNAFGSPNTGAIGQVYDGKVEYYANSIRGVGNKSPFNINTNTTLPRVDIVYMYADASGDMIDYLVSKKVAGIVIAGVGNGNFNKAYTEAVKRAVAAGVIVCRASRAPSGRVVLHDEINDDELGTIVSDDLTPQKARVLLMLALTQTKNKKQLQDYFFKY

Samples

Sample ID Description Type Environment
1 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
2 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
3 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
4 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
5 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
6 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
7 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
8 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
9 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
10 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
59 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
153 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 0.31
Isolates 3.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0.94
Rhizoplane 1.57
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_12839656 3300004803 Unclassified 2726
2 Ga0065714_10002588 3300005288 Bacteria 44774
3 Ga0065714_10128316 3300005288 Bacteria 1274
4 Ga0065712_10018465 3300005290 Bacteria 1944
5 Ga0065712_10069502 3300005290 Bacteria 7161
6 Ga0065712_10148619 3300005290 Bacteria 1388
7 Ga0065715_10009130 3300005293 Bacteria 3910
8 Ga0065715_10232013 3300005293 Bacteria 1230
9 Ga0070658_10017340 3300005327 Bacteria 5763
10 Ga0070676_10002371 3300005328 Bacteria 9643
11 Ga0070683_100062488 3300005329 Bacteria 3463
12 Ga0070683_100075601 3300005329 Bacteria 3147
13 Ga0070683_100314690 3300005329 Bacteria 1490
14 Ga0070670_100016918 3300005331 Bacteria 6260
15 Ga0070670_100242637 3300005331 Bacteria 1569
16 Ga0068869_100087785 3300005334 Unclassified 2333
17 Ga0070666_10003631 3300005335 Bacteria 9357
18 Ga0070682_100034529 3300005337 Bacteria 3081
19 Ga0068868_100008344 3300005338 Bacteria 7415
20 Ga0068868_100121404 3300005338 Unclassified 2132
21 Ga0068868_100160432 3300005338 Bacteria 1857
22 Ga0070689_100244883 3300005340 Bacteria 1478
23 Ga0070689_100279253 3300005340 Bacteria 1385
24 Ga0070661_100000796 3300005344 Bacteria 22660
25 Ga0070661_100282092 3300005344 Bacteria 1289
26 Ga0070668_100007431 3300005347 Bacteria 8132
27 Ga0070675_100077701 3300005354 Bacteria 2763
28 Ga0070675_100176125 3300005354 Bacteria 1847
29 Ga0070671_100031808 3300005355 Bacteria 4362
30 Ga0070671_100047173 3300005355 Bacteria 3583
31 Ga0070671_100112655 3300005355 Bacteria 2285
32 Ga0070674_100039619 3300005356 Unclassified 3183
33 Ga0070673_100022659 3300005364 Bacteria 4575
34 Ga0070673_100056277 3300005364 Bacteria 3102
35 Ga0070673_100144818 3300005364 Bacteria 2008
36 Ga0070673_100174912 3300005364 Bacteria 1834
37 Ga0070673_100215515 3300005364 Bacteria 1660
38 Ga0070673_100326909 3300005364 Bacteria 1356
39 Ga0070688_100017749 3300005365 Bacteria 4089
40 Ga0070688_100023499 3300005365 Bacteria 3627
41 Ga0070659_100140445 3300005366 Bacteria 1966
42 Ga0070667_100003221 3300005367 Bacteria 13980
43 Ga0070667_100074401 3300005367 Bacteria 2898
44 Ga0070667_100222981 3300005367 Bacteria 1679
45 Ga0070714_100326890 3300005435 Bacteria 1435
46 Ga0070700_100127196 3300005441 Bacteria 1715
47 Ga0070662_100014835 3300005457 Bacteria 5210
48 Ga0070662_100206174 3300005457 Bacteria 1562
49 Ga0070685_10003810 3300005466 Bacteria 7629
50 Ga0070685_10106616 3300005466 Bacteria 1719
51 Ga0070679_100115905 3300005530 Bacteria 2664
52 Ga0070679_100235260 3300005530 Unclassified 1791
53 Ga0070684_100010766 3300005535 Bacteria 7262
54 Ga0070684_100018128 3300005535 Bacteria 5792
55 Ga0070684_100145931 3300005535 Bacteria 2142
56 Ga0068853_100011339 3300005539 Bacteria 7239
57 Ga0070672_100003913 3300005543 Bacteria 9702
58 Ga0070665_100019113 3300005548 Bacteria 6873
59 Ga0070664_100000744 3300005564 Bacteria 25104
60 Ga0070664_100014895 3300005564 Bacteria 6344
61 Ga0070664_100218309 3300005564 Unclassified 1705
62 Ga0068857_100032248 3300005577 Bacteria 4633
63 Ga0068857_100355085 3300005577 Unclassified 1358
64 Ga0068852_100071782 3300005616 Unclassified 3041
65 Ga0068852_100344477 3300005616 Bacteria 1453
66 Ga0068859_100018920 3300005617 Bacteria 6918
67 Ga0068859_100149955 3300005617 Unclassified 2407
68 Ga0068859_100159702 3300005617 Unclassified 2333
69 Ga0068864_100002018 3300005618 Bacteria 16744
70 Ga0068861_100017609 3300005719 Bacteria 5076
71 Ga0068861_100018041 3300005719 Bacteria 5019
72 Ga0068861_100022434 3300005719 Bacteria 4548
73 Ga0068851_10000071 3300005834 Bacteria 57578
74 Ga0068851_10007284 3300005834 Bacteria 5073
75 Ga0068863_100000546 3300005841 Bacteria 38297
76 Ga0068863_100170596 3300005841 Bacteria 2087
77 Ga0068858_100012490 3300005842 Bacteria 8011
78 Ga0068858_100095185 3300005842 Bacteria 2774
79 Ga0068860_100000650 3300005843 Bacteria 40578
80 Ga0068860_100011007 3300005843 Bacteria 8919
81 Ga0068862_100039803 3300005844 Bacteria 3994
82 Ga0068862_100128513 3300005844 Bacteria 2239
83 Ga0068862_100276102 3300005844 Bacteria 1538
84 Ga0097621_100004280 3300006237 Bacteria 9912
85 Ga0097621_100010632 3300006237 Bacteria 6743
86 Ga0097621_100013452 3300006237 Bacteria 6100
87 Ga0097621_100030417 3300006237 Bacteria 4274
88 Ga0097621_100352786 3300006237 Bacteria 1309
89 Ga0068871_100007121 3300006358 Bacteria 7973
90 Ga0068871_100023835 3300006358 Unclassified 4740
91 Ga0068871_100122819 3300006358 Bacteria 2195
92 Ga0068871_100390345 3300006358 Bacteria 1238
93 Ga0075428_100025299 3300006844 Bacteria 6570
94 Ga0075428_100035086 3300006844 Bacteria 5529
95 Ga0075428_100403121 3300006844 Unclassified 1466
96 Ga0068865_100007558 3300006881 Bacteria 6689
97 Ga0097620_100018922 3300006931 Bacteria 6918
98 Ga0097620_100149969 3300006931 Unclassified 2407
99 Ga0097620_100159703 3300006931 Unclassified 2333
100 Ga0099824_1019851 3300006942 Bacteria 5102
101 Ga0099826_10052977 3300006948 Bacteria 2705
102 Ga0105240_10107607 3300009093 Unclassified 3380
103 Ga0111539_10004821 3300009094 Bacteria 17583
104 Ga0111539_10011263 3300009094 Bacteria 11237
105 Ga0111539_10027751 3300009094 Bacteria 6915
106 Ga0111539_10349609 3300009094 Bacteria 1721
107 Ga0105247_10010817 3300009101 Bacteria 5510
108 Ga0105242_10004177 3300009176 Bacteria 11252
109 Ga0105242_10042218 3300009176 Bacteria 3682
110 Ga0105242_10080883 3300009176 Bacteria 2716
111 Ga0105248_10029679 3300009177 Bacteria 6101
112 Ga0105248_10035227 3300009177 Bacteria 5599
113 Ga0105249_10006716 3300009553 Bacteria 10022
114 Ga0105249_10036265 3300009553 Unclassified 4473
115 Ga0105249_10065884 3300009553 Bacteria 3333
116 Ga0105249_10114654 3300009553 Bacteria 2552
117 Ga0105249_10314012 3300009553 Bacteria 1577
118 Ga0105249_10425188 3300009553 Unclassified 1363
119 Ga0105246_10197273 3300011119 Bacteria 1562
120 Ga0157371_10018172 3300013102 Bacteria 5206
121 Ga0157371_10085119 3300013102 Bacteria 2240
122 Ga0157370_10410090 3300013104 Bacteria 1247
123 Ga0157374_10006607 3300013296 Bacteria 9853
124 Ga0157374_10092284 3300013296 Bacteria 2889
125 Ga0157374_10121139 3300013296 Bacteria 2525
126 Ga0157378_10013201 3300013297 Bacteria 7224
127 Ga0157378_10072156 3300013297 Bacteria 3102
128 Ga0157378_10085796 3300013297 Bacteria 2853
129 Ga0157378_10252377 3300013297 Bacteria 1689
130 Ga0163162_10000157 3300013306 Bacteria 62611
131 Ga0163162_10000715 3300013306 Bacteria 30803
132 Ga0163162_10003946 3300013306 Bacteria 14228
133 Ga0163162_10030872 3300013306 Bacteria 5311
134 Ga0163162_10031211 3300013306 Bacteria 5285
135 Ga0163162_10104489 3300013306 Bacteria 2927
136 Ga0163162_10243247 3300013306 Bacteria 1930
137 Ga0163162_10260461 3300013306 Bacteria 1866
138 Ga0163162_10302837 3300013306 Unclassified 1731
139 Ga0163162_10353288 3300013306 Bacteria 1602
140 Ga0163162_10372913 3300013306 Bacteria 1560
141 Ga0157372_10221845 3300013307 Bacteria 2191
142 Ga0157372_10280366 3300013307 Bacteria 1938
143 Ga0157375_10000462 3300013308 Bacteria 37001
144 Ga0157375_10002492 3300013308 Bacteria 15952
145 Ga0157375_10011455 3300013308 Bacteria 7831
146 Ga0157375_10108032 3300013308 Bacteria 2876
147 Ga0157375_10179586 3300013308 Bacteria 2268
148 Ga0157375_10328263 3300013308 Bacteria 1695
149 Ga0163163_10000495 3300014325 Bacteria 35470
150 Ga0163163_10007299 3300014325 Bacteria 9748
151 Ga0163163_10011747 3300014325 Bacteria 7957
152 Ga0163163_10089737 3300014325 Bacteria 3086
153 Ga0163163_10162100 3300014325 Bacteria 2282
154 Ga0157380_10000008 3300014326 Bacteria 154993
155 Ga0157380_10000248 3300014326 Bacteria 32510
156 Ga0157380_10004239 3300014326 Bacteria 9919
157 Ga0157380_10007880 3300014326 Bacteria 7580
158 Ga0157377_10054948 3300014745 Bacteria 2256
159 Ga0157377_10078918 3300014745 Bacteria 1919
160 Ga0157379_10004827 3300014968 Bacteria 11587
161 Ga0157379_10009301 3300014968 Bacteria 8558
162 Ga0157379_10078437 3300014968 Bacteria 2958
163 Ga0157379_10093876 3300014968 Bacteria 2692
164 Ga0157379_10389135 3300014968 Bacteria 1280
165 Ga0157376_10000068 3300014969 Bacteria 83824
166 Ga0157376_10011965 3300014969 Bacteria 6417
167 Ga0157376_10055465 3300014969 Bacteria 3307
168 Ga0157376_10058149 3300014969 Bacteria 3238
169 Ga0157376_10217834 3300014969 Bacteria 1766
170 Ga0182006_1062100 3300015261 Bacteria 1407
171 Ga0163161_10039839 3300017792 Bacteria 3374
172 Ga0163161_10071051 3300017792 Unclassified 2546
173 Ga0163161_10100961 3300017792 Bacteria 2148
174 Ga0209050_1001521 3300025298 Bacteria 24443
175 Ga0209050_1001762 3300025298 Bacteria 21409
176 Ga0207697_10128470 3300025315 Unclassified 1094
177 Ga0207656_10000891 3300025321 Bacteria 9745
178 Ga0207656_10003284 3300025321 Bacteria 5543
179 Ga0207680_10002930 3300025903 Bacteria 7999
180 Ga0207645_10028042 3300025907 Bacteria 3635
181 Ga0207643_10165570 3300025908 Bacteria 1332
182 Ga0207705_10044792 3300025909 Bacteria 3180
183 Ga0207695_10237591 3300025913 Unclassified 1724
184 Ga0207657_10024723 3300025919 Bacteria 5554
185 Ga0207649_10001731 3300025920 Bacteria 12538
186 Ga0207649_10033510 3300025920 Bacteria 3070
187 Ga0207652_10107948 3300025921 Bacteria 2466
188 Ga0207652_10216597 3300025921 Unclassified 1725
189 Ga0207650_10002302 3300025925 Bacteria 13311
190 Ga0207650_10136591 3300025925 Bacteria 1924
191 Ga0207650_10357782 3300025925 Bacteria 1202
192 Ga0207659_10030438 3300025926 Bacteria 3689
193 Ga0207644_10141819 3300025931 Bacteria 1851
194 Ga0207644_10288661 3300025931 Bacteria 1319
195 Ga0207690_10048598 3300025932 Bacteria 2822
196 Ga0207690_10172970 3300025932 Bacteria 1619
197 Ga0207706_10101131 3300025933 Unclassified 2536
198 Ga0207706_10138401 3300025933 Bacteria 2142
199 Ga0207706_10230413 3300025933 Bacteria 1621
200 Ga0207686_10003174 3300025934 Bacteria 8849
201 Ga0207686_10044727 3300025934 Bacteria 2721
202 Ga0207670_10005786 3300025936 Bacteria 6824
203 Ga0207670_10150040 3300025936 Bacteria 1729
204 Ga0207704_10018784 3300025938 Unclassified 3617
205 Ga0207691_10007144 3300025940 Bacteria 10774
206 Ga0207691_10105390 3300025940 Bacteria 2512
207 Ga0207689_10006265 3300025942 Bacteria 10543
208 Ga0207689_10040978 3300025942 Bacteria 3832
209 Ga0207661_10006953 3300025944 Bacteria 8022
210 Ga0207661_10124126 3300025944 Bacteria 2203
211 Ga0207661_10160322 3300025944 Bacteria 1951
212 Ga0207679_10000182 3300025945 Bacteria 51887
213 Ga0207679_10008176 3300025945 Bacteria 6658
214 Ga0207679_10024132 3300025945 Bacteria 4166
215 Ga0207679_10162971 3300025945 Bacteria 1827
216 Ga0207651_10010521 3300025960 Bacteria 5131
217 Ga0207651_10029328 3300025960 Bacteria 3485
218 Ga0207651_10030406 3300025960 Bacteria 3438
219 Ga0207651_10056446 3300025960 Bacteria 2703
220 Ga0207712_10005733 3300025961 Bacteria 7827
221 Ga0207712_10041334 3300025961 Bacteria 3168
222 Ga0207668_10005254 3300025972 Bacteria 7618
223 Ga0207658_10004407 3300025986 Bacteria 9790
224 Ga0207658_10005373 3300025986 Bacteria 8796
225 Ga0207658_10079133 3300025986 Bacteria 2514
226 Ga0207658_10312058 3300025986 Bacteria 1359
227 Ga0207677_10002812 3300026023 Bacteria 9181
228 Ga0207677_10144528 3300026023 Bacteria 1826
229 Ga0207703_10014942 3300026035 Bacteria 6057
230 Ga0207703_10237689 3300026035 Bacteria 1636
231 Ga0207639_10459415 3300026041 Bacteria 1157
232 Ga0207678_10049431 3300026067 Bacteria 3634
233 Ga0207708_10085386 3300026075 Bacteria 2428
234 Ga0207708_10185403 3300026075 Unclassified 1653
235 Ga0207641_10000539 3300026088 Bacteria 42499
236 Ga0207641_10021203 3300026088 Bacteria 5341
237 Ga0207641_10185106 3300026088 Bacteria 1910
238 Ga0207648_10035648 3300026089 Bacteria 4383
239 Ga0207648_10214841 3300026089 Bacteria 1708
240 Ga0207676_10002997 3300026095 Bacteria 12039
241 Ga0207676_10037491 3300026095 Bacteria 3695
242 Ga0207676_10201762 3300026095 Archaea 1758
243 Ga0207676_10378923 3300026095 Unclassified 1316
244 Ga0207674_10046074 3300026116 Bacteria 4480
245 Ga0207674_10063818 3300026116 Bacteria 3716
246 Ga0207674_10093214 3300026116 Bacteria 3001
247 Ga0207674_10123968 3300026116 Bacteria 2549
248 Ga0207674_10437141 3300026116 Bacteria 1265
249 Ga0207675_100080073 3300026118 Unclassified 3062
250 Ga0207675_100092657 3300026118 Bacteria 2842
251 Ga0207675_100180480 3300026118 Bacteria 2021
252 Ga0207683_10094624 3300026121 Bacteria 2663
253 Ga0207683_10116702 3300026121 Bacteria 2393
254 Ga0207683_10330495 3300026121 Bacteria 1397
255 Ga0207698_10447873 3300026142 Bacteria 1246
256 Ga0209282_1111477 3300027666 Bacteria 1387
257 Ga0207428_10144782 3300027907 Bacteria 1812
258 Ga0268266_10009793 3300028379 Bacteria 8430
259 Ga0268265_10084056 3300028380 Bacteria 2522
260 Ga0268265_10114963 3300028380 Bacteria 2205
261 Ga0268264_10000809 3300028381 Bacteria 33699
262 Ga0268264_10006080 3300028381 Bacteria 10200
263 Ga0268264_10254505 3300028381 Bacteria 1633
264 Ga0265327_10000055 3300031251 Bacteria 247188
265 Ga0307414_10031741 3300032004 Bacteria 3469
266 Ga0307414_10109012 3300032004 Unclassified 2102
267 Ga0307414_10177067 3300032004 Bacteria 1711
268 Ga0307414_10194471 3300032004 Bacteria 1644
269 Ga0373947_0131743 3300035725 Unclassified 1597
270 Ga0373937_0152378 3300036401 Unclassified 2166
271 Ga0373937_0198299 3300036401 Bacteria 1887
272 Ga0395900_0199712 3300037418 Bacteria 2024
273 Ga0395905_0002208 3300037471 Bacteria 21964
274 Ga0439431_0009031 3300041997 Bacteria 2247
275 Ga0439445_0005758 3300042004 Bacteria 2831
276 Ga0451577_0034384 3300042876 Bacteria 4568
277 Ga0453683_0007719 3300044673 Bacteria 7279
278 Ga0453683_0028045 3300044673 Bacteria 3566
279 Ga0453683_0048880 3300044673 Bacteria 2652
280 Ga0453684_0002019 3300044712 Bacteria 51893
281 Ga0453684_0099846 3300044712 Bacteria 3554
282 Ga0453684_0150503 3300044712 Bacteria 2766
283 Ga0453684_0407140 3300044712 Bacteria 1522
284 Ga0453684_0503841 3300044712 Unclassified 1340
285 Ga0466959_0031189 3300045049 Unclassified 3945
286 Ga0451576_0005922 3300045051 Bacteria 15144
287 Ga0451576_0011062 3300045051 Bacteria 10301
288 Ga0451576_0066912 3300045051 Bacteria 3740
289 Ga0495638_0000008 3300046460 Bacteria 565643
290 Ga0495647_0052637 3300046681 Bacteria 1586
291 Ga0495613_0222156 3300046689 Bacteria 1326
292 Ga0495674_0117839 3300047319 Bacteria 2246
293 Ga0495676_0226143 3300047321 Unclassified 1287
294 Ga0495684_0078477 3300047471 Bacteria 2506
295 Ga0496100_0199642 3300048903 Bacteria 1457
296 Ga0496109_0050008 3300048912 Unclassified 3808
297 Ga0496111_0159832 3300048914 Bacteria 1673
298 Ga0496114_0000077 3300048917 Bacteria 70285
299 Ga0496115_0021446 3300048918 Bacteria 4992
300 Ga0496125_0004055 3300048928 Bacteria 17152
301 nmdc:mga08y16_189330_c1 3300050511 Bacteria 2135
302 nmdc:mga08y16_200038_c1 3300050511 Unclassified 2070
303 nmdc:mga08y16_296818_c1 3300050511 Unclassified 1666
304 nmdc:mga08y16_307842_c1 3300050511 Bacteria 1632
305 nmdc:mga08y16_4700_c1 3300050511 Bacteria 14233
306 Ga0500616_0000003 3300053153 Bacteria 1220687
307 Ga0500645_043015 3300053730 Bacteria 1331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0407140 Ga0453684_0407140_611_1495 258
2 3300044673 Ga0453683_0028045 Ga0453683_0028045_2281_3354 314
3 3300045051 Ga0451576_0005922 Ga0451576_0005922_11783_12856 314
4 3300037418 Ga0395900_0199712 Ga0395900_0199712_20_1066 315
5 3300037471 Ga0395905_0002208 Ga0395905_0002208_7578_8624 315
6 3300005617 Ga0068859_100149955 Ga0068859_1001499553 328
7 3300006931 Ga0097620_100149969 Ga0097620_1001499692 328
8 3300006844 Ga0075428_100403121 Ga0075428_1004031212 332
9 3300009553 Ga0105249_10425188 Ga0105249_104251882 332
10 3300026116 Ga0207674_10123968 Ga0207674_101239682 332
11 3300041997 Ga0439431_0009031 Ga0439431_0009031_707_1756 334
12 3300042004 Ga0439445_0005758 Ga0439445_0005758_186_1235 334
13 3300006844 Ga0075428_100025299 Ga0075428_1000252994 336
14 3300009094 Ga0111539_10011263 Ga0111539_100112637 336
15 3300013296 Ga0157374_10092284 Ga0157374_100922842 336
16 3300013307 Ga0157372_10280366 Ga0157372_102803662 336
17 3300050511 nmdc:mga08y16_4700_c1 nmdc:mga08y16_4700_c1_7177_8229 336
18 3300005841 Ga0068863_100000546 Ga0068863_10000054617 337
19 3300026088 Ga0207641_10000539 Ga0207641_1000053918 337
20 3300044712 Ga0453684_0002019 Ga0453684_0002019_22565_23620 337
21 3300045051 Ga0451576_0011062 Ga0451576_0011062_729_1784 337
22 3300013308 Ga0157375_10179586 Ga0157375_101795862 338
23 3300005293 Ga0065715_10232013 Ga0065715_102320131 339
24 3300005834 Ga0068851_10000071 Ga0068851_100000716 339
25 3300025321 Ga0207656_10000891 Ga0207656_100008915 339
26 3300025986 Ga0207658_10079133 Ga0207658_100791332 339
27 3300025931 Ga0207644_10141819 Ga0207644_101418191 341
28 3300044673 Ga0453683_0048880 Ga0453683_0048880_1582_2613 341
29 3300005327 Ga0070658_10017340 Ga0070658_100173401 342
30 3300005364 Ga0070673_100022659 Ga0070673_1000226591 342
31 3300025909 Ga0207705_10044792 Ga0207705_100447921 342
32 iso_pu_bacteria 2585428115 2587942129 344
33 iso_pu_bacteria 2929177148 2929179243 344
34 iso_pu_bacteria 2945977869 2945981648 344
35 iso_pu_bacteria 2946013367 2946018949 344
36 iso_pu_bacteria 2519899754 2520879066 345
37 iso_pu_bacteria 2816332280 2817416044 345
38 iso_pu_bacteria 2884791551 2884794050 345
39 iso_pu_bacteria 2903895155 2903897195 345
40 iso_pu_bacteria 2929921140 2929926545 345
41 iso_pu_bacteria 2958458903 2958461524 345
42 iso_pu_bacteria 8055419101 8055421773 345
43 3300009553 Ga0105249_10065884 Ga0105249_100658842 347
44 3300014326 Ga0157380_10000248 Ga0157380_1000024811 347
45 3300048917 Ga0496114_0000077 Ga0496114_0000077_59159_60277 347
46 3300005288 Ga0065714_10002588 Ga0065714_1000258811 348
47 3300005288 Ga0065714_10128316 Ga0065714_101283161 348
48 3300005290 Ga0065712_10018465 Ga0065712_100184652 348
49 3300005290 Ga0065712_10069502 Ga0065712_100695024 348
50 3300005290 Ga0065712_10148619 Ga0065712_101486191 348
51 3300005293 Ga0065715_10009130 Ga0065715_100091304 348
52 3300005331 Ga0070670_100242637 Ga0070670_1002426372 348
53 3300005338 Ga0068868_100160432 Ga0068868_1001604322 348
54 3300005340 Ga0070689_100244883 Ga0070689_1002448832 348
55 3300005344 Ga0070661_100000796 Ga0070661_1000007965 348
56 3300005344 Ga0070661_100282092 Ga0070661_1002820921 348
57 3300005354 Ga0070675_100077701 Ga0070675_1000777012 348
58 3300005355 Ga0070671_100031808 Ga0070671_1000318082 348
59 3300005355 Ga0070671_100047173 Ga0070671_1000471733 348
60 3300005356 Ga0070674_100039619 Ga0070674_1000396192 348
61 3300005364 Ga0070673_100056277 Ga0070673_1000562772 348
62 3300005364 Ga0070673_100215515 Ga0070673_1002155151 348
63 3300005364 Ga0070673_100326909 Ga0070673_1003269092 348
64 3300005366 Ga0070659_100140445 Ga0070659_1001404452 348
65 3300005367 Ga0070667_100074401 Ga0070667_1000744012 348
66 3300005367 Ga0070667_100222981 Ga0070667_1002229812 348
67 3300005435 Ga0070714_100326890 Ga0070714_1003268901 348
68 3300005441 Ga0070700_100127196 Ga0070700_1001271962 348
69 3300005466 Ga0070685_10003810 Ga0070685_100038102 348
70 3300005466 Ga0070685_10106616 Ga0070685_101066162 348
71 3300005535 Ga0070684_100010766 Ga0070684_1000107662 348
72 3300005535 Ga0070684_100145931 Ga0070684_1001459313 348
73 3300005539 Ga0068853_100011339 Ga0068853_1000113393 348
74 3300005564 Ga0070664_100000744 Ga0070664_10000074422 348
75 3300005616 Ga0068852_100344477 Ga0068852_1003444771 348
76 3300005841 Ga0068863_100170596 Ga0068863_1001705963 348
77 3300005842 Ga0068858_100095185 Ga0068858_1000951852 348
78 3300005844 Ga0068862_100128513 Ga0068862_1001285132 348
79 3300005844 Ga0068862_100276102 Ga0068862_1002761022 348
80 3300006237 Ga0097621_100004280 Ga0097621_10000428010 348
81 3300006237 Ga0097621_100013452 Ga0097621_1000134522 348
82 3300006237 Ga0097621_100030417 Ga0097621_1000304172 348
83 3300006358 Ga0068871_100007121 Ga0068871_1000071213 348
84 3300006358 Ga0068871_100122819 Ga0068871_1001228192 348
85 3300009094 Ga0111539_10349609 Ga0111539_103496091 348
86 3300009176 Ga0105242_10004177 Ga0105242_100041776 348
87 3300009176 Ga0105242_10042218 Ga0105242_100422182 348
88 3300009176 Ga0105242_10080883 Ga0105242_100808832 348
89 3300009177 Ga0105248_10035227 Ga0105248_100352273 348
90 3300009553 Ga0105249_10006716 Ga0105249_100067165 348
91 3300009553 Ga0105249_10314012 Ga0105249_103140121 348
92 3300011119 Ga0105246_10197273 Ga0105246_101972731 348
93 3300013102 Ga0157371_10085119 Ga0157371_100851192 348
94 3300013104 Ga0157370_10410090 Ga0157370_104100901 348
95 3300013296 Ga0157374_10121139 Ga0157374_101211392 348
96 3300013297 Ga0157378_10085796 Ga0157378_100857962 348
97 3300013297 Ga0157378_10252377 Ga0157378_102523772 348
98 3300013306 Ga0163162_10000157 Ga0163162_1000015743 348
99 3300013306 Ga0163162_10031211 Ga0163162_100312113 348
100 3300013306 Ga0163162_10260461 Ga0163162_102604612 348
101 3300013306 Ga0163162_10302837 Ga0163162_103028372 348
102 3300013306 Ga0163162_10353288 Ga0163162_103532882 348
103 3300013306 Ga0163162_10372913 Ga0163162_103729132 348
104 3300013308 Ga0157375_10000462 Ga0157375_100004623 348
105 3300013308 Ga0157375_10328263 Ga0157375_103282631 348
106 3300014325 Ga0163163_10007299 Ga0163163_100072996 348
107 3300014325 Ga0163163_10089737 Ga0163163_100897372 348
108 3300014325 Ga0163163_10162100 Ga0163163_101621002 348
109 3300014326 Ga0157380_10004239 Ga0157380_100042397 348
110 3300014326 Ga0157380_10007880 Ga0157380_100078806 348
111 3300014745 Ga0157377_10054948 Ga0157377_100549482 348
112 3300014745 Ga0157377_10078918 Ga0157377_100789182 348
113 3300014968 Ga0157379_10004827 Ga0157379_100048274 348
114 3300014968 Ga0157379_10093876 Ga0157379_100938761 348
115 3300014968 Ga0157379_10389135 Ga0157379_103891352 348
116 3300014969 Ga0157376_10000068 Ga0157376_1000006852 348
117 3300014969 Ga0157376_10217834 Ga0157376_102178342 348
118 3300017792 Ga0163161_10039839 Ga0163161_100398393 348
119 3300017792 Ga0163161_10071051 Ga0163161_100710511 348
120 3300017792 Ga0163161_10100961 Ga0163161_101009612 348
121 3300025907 Ga0207645_10028042 Ga0207645_100280422 348
122 3300025920 Ga0207649_10001731 Ga0207649_100017318 348
123 3300025925 Ga0207650_10002302 Ga0207650_100023028 348
124 3300025925 Ga0207650_10136591 Ga0207650_101365912 348
125 3300025925 Ga0207650_10357782 Ga0207650_103577821 348
126 3300025926 Ga0207659_10030438 Ga0207659_100304384 348
127 3300025931 Ga0207644_10288661 Ga0207644_102886611 348
128 3300025932 Ga0207690_10172970 Ga0207690_101729701 348
129 3300025933 Ga0207706_10230413 Ga0207706_102304132 348
130 3300025934 Ga0207686_10003174 Ga0207686_100031747 348
131 3300025934 Ga0207686_10044727 Ga0207686_100447272 348
132 3300025936 Ga0207670_10005786 Ga0207670_100057864 348
133 3300025940 Ga0207691_10105390 Ga0207691_101053902 348
134 3300025942 Ga0207689_10040978 Ga0207689_100409782 348
135 3300025944 Ga0207661_10006953 Ga0207661_100069533 348
136 3300025944 Ga0207661_10160322 Ga0207661_101603221 348
137 3300025945 Ga0207679_10000182 Ga0207679_100001824 348
138 3300025960 Ga0207651_10030406 Ga0207651_100304061 348
139 3300025961 Ga0207712_10005733 Ga0207712_100057336 348
140 3300025961 Ga0207712_10041334 Ga0207712_100413342 348
141 3300025986 Ga0207658_10005373 Ga0207658_100053732 348
142 3300025986 Ga0207658_10312058 Ga0207658_103120581 348
143 3300026023 Ga0207677_10144528 Ga0207677_101445281 348
144 3300026035 Ga0207703_10237689 Ga0207703_102376892 348
145 3300026041 Ga0207639_10459415 Ga0207639_104594151 348
146 3300026067 Ga0207678_10049431 Ga0207678_100494312 348
147 3300026075 Ga0207708_10185403 Ga0207708_101854032 348
148 3300026088 Ga0207641_10185106 Ga0207641_101851062 348
149 3300026089 Ga0207648_10035648 Ga0207648_100356482 348
150 3300026095 Ga0207676_10037491 Ga0207676_100374912 348
151 3300026095 Ga0207676_10378923 Ga0207676_103789231 348
152 3300026116 Ga0207674_10093214 Ga0207674_100932142 348
153 3300026116 Ga0207674_10437141 Ga0207674_104371411 348
154 3300026118 Ga0207675_100092657 Ga0207675_1000926572 348
155 3300026121 Ga0207683_10116702 Ga0207683_101167022 348
156 3300026121 Ga0207683_10330495 Ga0207683_103304951 348
157 3300026142 Ga0207698_10447873 Ga0207698_104478731 348
158 3300027907 Ga0207428_10144782 Ga0207428_101447822 348
159 3300028380 Ga0268265_10114963 Ga0268265_101149632 348
160 3300028381 Ga0268264_10254505 Ga0268264_102545051 348
161 3300045049 Ga0466959_0031189 Ga0466959_0031189_452_1498 348
162 3300047321 Ga0495676_0226143 Ga0495676_0226143_54_1100 348
163 3300048903 Ga0496100_0199642 Ga0496100_0199642_361_1407 348
164 3300050511 nmdc:mga08y16_189330_c1 nmdc:mga08y16_189330_c1_656_1702 348
165 3300050511 nmdc:mga08y16_200038_c1 nmdc:mga08y16_200038_c1_274_1320 348
166 3300004803 Ga0058862_12839656 Ga0058862_128396564 349
167 3300005328 Ga0070676_10002371 Ga0070676_100023714 349
168 3300005329 Ga0070683_100062488 Ga0070683_1000624882 349
169 3300005329 Ga0070683_100075601 Ga0070683_1000756012 349
170 3300005329 Ga0070683_100314690 Ga0070683_1003146902 349
171 3300005331 Ga0070670_100016918 Ga0070670_1000169183 349
172 3300005334 Ga0068869_100087785 Ga0068869_1000877852 349
173 3300005335 Ga0070666_10003631 Ga0070666_100036314 349
174 3300005337 Ga0070682_100034529 Ga0070682_1000345291 349
175 3300005338 Ga0068868_100008344 Ga0068868_1000083444 349
176 3300005338 Ga0068868_100121404 Ga0068868_1001214041 349
177 3300005340 Ga0070689_100279253 Ga0070689_1002792532 349
178 3300005347 Ga0070668_100007431 Ga0070668_1000074316 349
179 3300005354 Ga0070675_100176125 Ga0070675_1001761252 349
180 3300005355 Ga0070671_100112655 Ga0070671_1001126552 349
181 3300005364 Ga0070673_100144818 Ga0070673_1001448182 349
182 3300005364 Ga0070673_100174912 Ga0070673_1001749122 349
183 3300005365 Ga0070688_100017749 Ga0070688_1000177492 349
184 3300005365 Ga0070688_100023499 Ga0070688_1000234993 349
185 3300005367 Ga0070667_100003221 Ga0070667_1000032217 349
186 3300005457 Ga0070662_100014835 Ga0070662_1000148353 349
187 3300005457 Ga0070662_100206174 Ga0070662_1002061742 349
188 3300005530 Ga0070679_100115905 Ga0070679_1001159052 349
189 3300005530 Ga0070679_100235260 Ga0070679_1002352602 349
190 3300005535 Ga0070684_100018128 Ga0070684_1000181283 349
191 3300005543 Ga0070672_100003913 Ga0070672_1000039134 349
192 3300005548 Ga0070665_100019113 Ga0070665_1000191133 349
193 3300005564 Ga0070664_100014895 Ga0070664_1000148955 349
194 3300005564 Ga0070664_100218309 Ga0070664_1002183092 349
195 3300005577 Ga0068857_100032248 Ga0068857_1000322482 349
196 3300005577 Ga0068857_100355085 Ga0068857_1003550852 349
197 3300005616 Ga0068852_100071782 Ga0068852_1000717822 349
198 3300005617 Ga0068859_100018920 Ga0068859_1000189205 349
199 3300005617 Ga0068859_100159702 Ga0068859_1001597021 349
200 3300005618 Ga0068864_100002018 Ga0068864_10000201813 349
201 3300005719 Ga0068861_100017609 Ga0068861_1000176095 349
202 3300005719 Ga0068861_100018041 Ga0068861_1000180412 349
203 3300005719 Ga0068861_100022434 Ga0068861_1000224343 349
204 3300005834 Ga0068851_10007284 Ga0068851_100072842 349
205 3300005842 Ga0068858_100012490 Ga0068858_1000124903 349
206 3300005843 Ga0068860_100000650 Ga0068860_10000065029 349
207 3300005843 Ga0068860_100011007 Ga0068860_1000110074 349
208 3300005844 Ga0068862_100039803 Ga0068862_1000398033 349
209 3300006237 Ga0097621_100010632 Ga0097621_1000106322 349
210 3300006237 Ga0097621_100352786 Ga0097621_1003527861 349
211 3300006358 Ga0068871_100023835 Ga0068871_1000238352 349
212 3300006358 Ga0068871_100390345 Ga0068871_1003903451 349
213 3300006844 Ga0075428_100035086 Ga0075428_1000350864 349
214 3300006881 Ga0068865_100007558 Ga0068865_1000075583 349
215 3300006931 Ga0097620_100018922 Ga0097620_1000189225 349
216 3300006931 Ga0097620_100159703 Ga0097620_1001597031 349
217 3300006942 Ga0099824_1019851 Ga0099824_10198514 349
218 3300006948 Ga0099826_10052977 Ga0099826_100529772 349
219 3300009093 Ga0105240_10107607 Ga0105240_101076072 349
220 3300009094 Ga0111539_10004821 Ga0111539_1000482111 349
221 3300009094 Ga0111539_10027751 Ga0111539_100277514 349
222 3300009101 Ga0105247_10010817 Ga0105247_100108172 349
223 3300009177 Ga0105248_10029679 Ga0105248_100296794 349
224 3300009553 Ga0105249_10036265 Ga0105249_100362653 349
225 3300009553 Ga0105249_10114654 Ga0105249_101146542 349
226 3300013102 Ga0157371_10018172 Ga0157371_100181721 349
227 3300013296 Ga0157374_10006607 Ga0157374_100066076 349
228 3300013297 Ga0157378_10013201 Ga0157378_100132012 349
229 3300013297 Ga0157378_10072156 Ga0157378_100721562 349
230 3300013306 Ga0163162_10000715 Ga0163162_1000071527 349
231 3300013306 Ga0163162_10003946 Ga0163162_100039463 349
232 3300013306 Ga0163162_10030872 Ga0163162_100308722 349
233 3300013306 Ga0163162_10104489 Ga0163162_101044892 349
234 3300013306 Ga0163162_10243247 Ga0163162_102432472 349
235 3300013307 Ga0157372_10221845 Ga0157372_102218452 349
236 3300013308 Ga0157375_10002492 Ga0157375_100024924 349
237 3300013308 Ga0157375_10011455 Ga0157375_100114553 349
238 3300013308 Ga0157375_10108032 Ga0157375_101080322 349
239 3300014325 Ga0163163_10000495 Ga0163163_1000049523 349
240 3300014325 Ga0163163_10011747 Ga0163163_100117474 349
241 3300014326 Ga0157380_10000008 Ga0157380_1000000852 349
242 3300014968 Ga0157379_10009301 Ga0157379_100093012 349
243 3300014968 Ga0157379_10078437 Ga0157379_100784372 349
244 3300014969 Ga0157376_10011965 Ga0157376_100119654 349
245 3300014969 Ga0157376_10055465 Ga0157376_100554652 349
246 3300014969 Ga0157376_10058149 Ga0157376_100581492 349
247 3300015261 Ga0182006_1062100 Ga0182006_10621002 349
248 3300025298 Ga0209050_1001521 Ga0209050_10015212 349
249 3300025298 Ga0209050_1001762 Ga0209050_100176220 349
250 3300025315 Ga0207697_10128470 Ga0207697_101284701 349
251 3300025321 Ga0207656_10003284 Ga0207656_100032843 349
252 3300025903 Ga0207680_10002930 Ga0207680_100029304 349
253 3300025908 Ga0207643_10165570 Ga0207643_101655702 349
254 3300025913 Ga0207695_10237591 Ga0207695_102375912 349
255 3300025919 Ga0207657_10024723 Ga0207657_100247232 349
256 3300025920 Ga0207649_10033510 Ga0207649_100335102 349
257 3300025921 Ga0207652_10107948 Ga0207652_101079482 349
258 3300025921 Ga0207652_10216597 Ga0207652_102165972 349
259 3300025932 Ga0207690_10048598 Ga0207690_100485981 349
260 3300025933 Ga0207706_10101131 Ga0207706_101011312 349
261 3300025933 Ga0207706_10138401 Ga0207706_101384012 349
262 3300025936 Ga0207670_10150040 Ga0207670_101500402 349
263 3300025938 Ga0207704_10018784 Ga0207704_100187842 349
264 3300025940 Ga0207691_10007144 Ga0207691_100071447 349
265 3300025942 Ga0207689_10006265 Ga0207689_100062658 349
266 3300025944 Ga0207661_10124126 Ga0207661_101241262 349
267 3300025945 Ga0207679_10008176 Ga0207679_100081764 349
268 3300025945 Ga0207679_10024132 Ga0207679_100241324 349
269 3300025945 Ga0207679_10162971 Ga0207679_101629711 349
270 3300025960 Ga0207651_10010521 Ga0207651_100105214 349
271 3300025960 Ga0207651_10029328 Ga0207651_100293282 349
272 3300025960 Ga0207651_10056446 Ga0207651_100564462 349
273 3300025972 Ga0207668_10005254 Ga0207668_100052542 349
274 3300025986 Ga0207658_10004407 Ga0207658_100044074 349
275 3300026023 Ga0207677_10002812 Ga0207677_100028125 349
276 3300026035 Ga0207703_10014942 Ga0207703_100149424 349
277 3300026075 Ga0207708_10085386 Ga0207708_100853862 349
278 3300026088 Ga0207641_10021203 Ga0207641_100212033 349
279 3300026089 Ga0207648_10214841 Ga0207648_102148412 349
280 3300026095 Ga0207676_10002997 Ga0207676_100029976 349
281 3300026095 Ga0207676_10201762 Ga0207676_102017622 349
282 3300026116 Ga0207674_10046074 Ga0207674_100460743 349
283 3300026116 Ga0207674_10063818 Ga0207674_100638182 349
284 3300026118 Ga0207675_100080073 Ga0207675_1000800732 349
285 3300026118 Ga0207675_100180480 Ga0207675_1001804802 349
286 3300026121 Ga0207683_10094624 Ga0207683_100946242 349
287 3300027666 Ga0209282_1111477 Ga0209282_11114772 349
288 3300028379 Ga0268266_10009793 Ga0268266_100097934 349
289 3300028380 Ga0268265_10084056 Ga0268265_100840562 349
290 3300028381 Ga0268264_10000809 Ga0268264_1000080922 349
291 3300028381 Ga0268264_10006080 Ga0268264_100060806 349
292 3300031251 Ga0265327_10000055 Ga0265327_100000553 349
293 3300032004 Ga0307414_10031741 Ga0307414_100317412 349
294 3300032004 Ga0307414_10109012 Ga0307414_101090122 349
295 3300032004 Ga0307414_10177067 Ga0307414_101770672 349
296 3300032004 Ga0307414_10194471 Ga0307414_101944711 349
297 3300035725 Ga0373947_0131743 Ga0373947_0131743_330_1379 349
298 3300036401 Ga0373937_0152378 Ga0373937_0152378_255_1310 349
299 3300036401 Ga0373937_0198299 Ga0373937_0198299_275_1330 349
300 3300042876 Ga0451577_0034384 Ga0451577_0034384_2915_3967 349
301 3300044673 Ga0453683_0007719 Ga0453683_0007719_3263_4336 349
302 3300044712 Ga0453684_0099846 Ga0453684_0099846_793_1866 349
303 3300044712 Ga0453684_0150503 Ga0453684_0150503_426_1499 349
304 3300044712 Ga0453684_0503841 Ga0453684_0503841_28_1077 349
305 3300045051 Ga0451576_0066912 Ga0451576_0066912_1646_2719 349
306 3300046460 Ga0495638_0000008 Ga0495638_0000008_238894_239943 349
307 3300046681 Ga0495647_0052637 Ga0495647_0052637_378_1433 349
308 3300046689 Ga0495613_0222156 Ga0495613_0222156_52_1107 349
309 3300047319 Ga0495674_0117839 Ga0495674_0117839_870_1925 349
310 3300047471 Ga0495684_0078477 Ga0495684_0078477_16_1068 349
311 3300048912 Ga0496109_0050008 Ga0496109_0050008_984_2042 349
312 3300048914 Ga0496111_0159832 Ga0496111_0159832_256_1305 349
313 3300048918 Ga0496115_0021446 Ga0496115_0021446_2940_4055 349
314 3300048928 Ga0496125_0004055 Ga0496125_0004055_6954_8069 349
315 3300050511 nmdc:mga08y16_296818_c1 nmdc:mga08y16_296818_c1_242_1339 349
316 3300050511 nmdc:mga08y16_307842_c1 nmdc:mga08y16_307842_c1_313_1362 349
317 3300053153 Ga0500616_0000003 Ga0500616_0000003_341216_342265 349
318 3300053730 Ga0500645_043015 Ga0500645_043015_160_1212 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17763

Asparaginase_C

Glutaminase/Asparaginase C-terminal domain

259

369

0.99

PF00710

Asparaginase

Asparaginase, N-terminal

47

241

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v29-assembly1.cif.gz_B-2 complex of double mutant (t89v,k162t) of e. coli l-asparaginase ii with l-asp 0.9627 21 349
6eok-assembly1.cif.gz_D crystal structure of e. coli l-asparaginase ii 0.9625 22 349
8ece-assembly1.cif.gz_D e. coli l-asparaginase ii mutant (v27t) in complex with l-glu 0.962 22 349
8ece-assembly1.cif.gz_C e. coli l-asparaginase ii mutant (v27t) in complex with l-glu 0.962 22 349
7r5q-assembly1.cif.gz_A escherichia coli type ii asparaginase n24s mutant in complex with glu 0.9617 22 349
ID Description Score Start End Superfamily
2wt4A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9678 236 346 3.40.50.40
1djoB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9632 236 347 3.40.50.40
3ecaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9631 236 349 3.40.50.40
1zcfG02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9566 236 349 3.40.50.40
3ecaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.955 236 349 3.40.50.40
ID Description Score Start End GO Terms
AF-K2BSP7-F1-model_v4 L-asparaginase type II (EC 3.5.1.1) 0.9667 151 349 GO:0004067
AF-A0A1I4I3Q2-F1-model_v4 L-asparaginase 0.9665 54 349 GO:0004067
GO:0006528
AF-A0A7U2YIL8-F1-model_v4 deleted 0.9665 231 349
AF-A0A496LDW4-F1-model_v4 Type II asparaginase (EC 3.5.1.1) 0.9652 61 349 GO:0004067
GO:0006528
AF-A0A2M9P8P2-F1-model_v4 L-asparaginase 0.9652 233 349 GO:0004067

Feature Viewer

pLDDT pTM Quality
86.8 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map