F404802

General Info

Members Datasets Scaffolds Average Seq Length
318 231 636 246

Family's Representative Sequence

Representative Sequence 3300049460|Ga0495682_0004563|Ga0495682_0004563_409_1239
Length 276
Sequence MGGVSAFLRPTLSRLLIIGVETMSSDLSGRAILITGASSGLGRHFAKTAAAAGAQVAAAARRTDRLSALVDEIASAGGKAVAVAMDVEDEASVIAGFDAAQAAFGPIDGVVANAGMNSRGMALDLPMEEFDRVVSVNLRGAFLTVREGARRMIAAGSKQSGRGRIVLVGSLGARKALPGVAAYCATKAGVVMLGKALAREWANQGINVNSICPGYIATELNDEFLASESGQKLVASFPRRRLMRDSDLDGVVLHLLSDASRTITGASFDVDDGQGL

Samples

Sample ID Description Type Environment
1 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
2 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
131 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
132 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
198 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
201 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
202 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
203 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
204 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
205 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
209 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
218 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
219 2643221583 Caulobacter sp. Root655 Isolate Unclassified
220 2643221640 Caulobacter sp. Root342 Isolate Unclassified
221 2643221642 Caulobacter sp. Root343 Isolate Unclassified
222 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
223 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
224 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
225 2849560528 Caulobacter zeae 410 Isolate Unclassified
226 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
227 2851153111 Caulobacter radicis 736 Isolate Unclassified
228 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
229 2885266251 Ralstonia sp. SET104 Isolate Nodule
230 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
231 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.28
Metatranscriptomes 0
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.84
Nodule 0.31
Rhizoplane 1.57
Rhizosphere 78.62
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495682_0004563 3300049460 Bacteria 5901
2 Ga0055537_1001920 3300003773 Bacteria 7448
3 Ga0055536_1000434 3300003781 Bacteria 29703
4 Ga0055536_1000664 3300003781 Bacteria 23213
5 Ga0055528_1015688 3300003790 Bacteria 2723
6 Ga0055530_10002859 3300003791 Bacteria 10541
7 Ga0055530_10003071 3300003791 Bacteria 9925
8 Ga0070670_100183136 3300005331 Bacteria 1819
9 Ga0070670_100726575 3300005331 Bacteria 894
10 Ga0070677_10000061 3300005333 Bacteria 33960
11 Ga0070666_10002931 3300005335 Bacteria 10319
12 Ga0070666_10004791 3300005335 Bacteria 8272
13 Ga0070666_10196041 3300005335 Bacteria 1420
14 Ga0070680_100000408 3300005336 Bacteria 29300
15 Ga0068868_100017983 3300005338 Bacteria 5275
16 Ga0070660_100071705 3300005339 Unclassified 2705
17 Ga0070661_100013495 3300005344 Bacteria 5736
18 Ga0070668_100000833 3300005347 Bacteria 21319
19 Ga0070668_100013152 3300005347 Bacteria 6170
20 Ga0070668_100018772 3300005347 Bacteria 5194
21 Ga0070668_100022877 3300005347 Bacteria 4725
22 Ga0070668_100040551 3300005347 Bacteria 3562
23 Ga0070669_100045309 3300005353 Bacteria 3205
24 Ga0070675_100058278 3300005354 Bacteria 3185
25 Ga0070674_100150644 3300005356 Bacteria 1755
26 Ga0070674_100473358 3300005356 Bacteria 1038
27 Ga0070673_100008496 3300005364 Bacteria 6828
28 Ga0070667_100002819 3300005367 Bacteria 14999
29 Ga0070667_100173814 3300005367 Bacteria 1903
30 Ga0070713_100082981 3300005436 Bacteria 2739
31 Ga0070711_100717290 3300005439 Unclassified 843
32 Ga0070678_100008665 3300005456 Bacteria 6102
33 Ga0070681_10000003 3300005458 Bacteria 252785
34 Ga0068867_100000066 3300005459 Bacteria 63559
35 Ga0068867_100010000 3300005459 Bacteria 6684
36 Ga0068867_100360161 3300005459 Bacteria 1216
37 Ga0070685_10073022 3300005466 Bacteria 2038
38 Ga0070679_100000541 3300005530 Bacteria 32093
39 Ga0068853_100001850 3300005539 Bacteria 15545
40 Ga0070672_100178726 3300005543 Bacteria 1768
41 Ga0070665_100007136 3300005548 Bacteria 11361
42 Ga0068855_100000006 3300005563 Bacteria 298092
43 Ga0070664_100063492 3300005564 Bacteria 3149
44 Ga0068852_100003619 3300005616 Bacteria 10810
45 Ga0068852_100026301 3300005616 Unclassified 4729
46 Ga0068852_100436259 3300005616 Bacteria 1294
47 Ga0068861_100752751 3300005719 Bacteria 910
48 Ga0068870_10040415 3300005840 Bacteria 2418
49 Ga0068863_100009126 3300005841 Bacteria 9686
50 Ga0068863_100010404 3300005841 Bacteria 9041
51 Ga0068863_100388519 3300005841 Bacteria 1363
52 Ga0068858_100052740 3300005842 Bacteria 3763
53 Ga0068860_100000515 3300005843 Bacteria 47393
54 Ga0068860_100232962 3300005843 Bacteria 1790
55 Ga0068862_100012610 3300005844 Bacteria 6997
56 Ga0068862_100049316 3300005844 Bacteria 3596
57 Ga0068862_100111061 3300005844 Bacteria 2406
58 Ga0075366_10149426 3300006195 Bacteria 1414
59 Ga0097621_100058673 3300006237 Bacteria 3149
60 Ga0075431_100264185 3300006847 Bacteria 1746
61 Ga0105240_10000357 3300009093 Bacteria 85936
62 Ga0105243_10004551 3300009148 Bacteria 10951
63 Ga0105241_10132180 3300009174 Bacteria 2022
64 Ga0105242_10026325 3300009176 Bacteria 4609
65 Ga0105248_10000001 3300009177 Bacteria 1881304
66 Ga0105248_10053687 3300009177 Bacteria 4521
67 Ga0105249_10056598 3300009553 Bacteria 3590
68 Ga0105239_10012041 3300010375 Bacteria 9644
69 Ga0105239_10062839 3300010375 Bacteria 4076
70 Ga0157373_10000082 3300013100 Bacteria 82240
71 Ga0157370_10314708 3300013104 Bacteria 1444
72 Ga0157369_10007279 3300013105 Bacteria 12740
73 Ga0157378_10742590 3300013297 Bacteria 1004
74 Ga0157375_10391479 3300013308 Bacteria 1556
75 Ga0157375_10915120 3300013308 Bacteria 1020
76 Ga0157377_10000035 3300014745 Bacteria 116860
77 Ga0157379_10005836 3300014968 Bacteria 10581
78 Ga0157379_10025371 3300014968 Bacteria 5265
79 Ga0163161_10080206 3300017792 Bacteria 2401
80 Ga0213876_10000629 3300021384 Bacteria 25698
81 Ga0213876_10159774 3300021384 Bacteria 1199
82 Ga0209565_1001478 3300025263 Bacteria 10276
83 Ga0209673_1001479 3300025273 Bacteria 22008
84 Ga0209676_1000119 3300025292 Bacteria 201094
85 Ga0209676_1000382 3300025292 Bacteria 81366
86 Ga0209564_1001331 3300025295 Bacteria 26417
87 Ga0209564_1026732 3300025295 Bacteria 1896
88 Ga0209758_1000643 3300025297 Bacteria 53173
89 Ga0209050_1000263 3300025298 Bacteria 112797
90 Ga0209256_1000690 3300025299 Bacteria 45162
91 Ga0209256_1003662 3300025299 Bacteria 10495
92 Ga0209256_1008757 3300025299 Bacteria 4607
93 Ga0209256_1026715 3300025299 Bacteria 1658
94 Ga0209051_1006240 3300025303 Bacteria 6761
95 Ga0209257_1000234 3300025304 Bacteria 129712
96 Ga0209257_1003609 3300025304 Bacteria 13041
97 Ga0207656_10001440 3300025321 Bacteria 7891
98 Ga0207682_10000979 3300025893 Bacteria 13169
99 Ga0207692_10122051 3300025898 Bacteria 1460
100 Ga0207680_10001990 3300025903 Bacteria 9568
101 Ga0207680_10032682 3300025903 Bacteria 2960
102 Ga0207680_10154923 3300025903 Bacteria 1531
103 Ga0207643_10016103 3300025908 Bacteria 4075
104 Ga0207654_10076319 3300025911 Bacteria 2005
105 Ga0207695_10000004 3300025913 Bacteria 1288665
106 Ga0207663_10030378 3300025916 Bacteria 3187
107 Ga0207657_10093057 3300025919 Unclassified 2511
108 Ga0207652_10000736 3300025921 Bacteria 31695
109 Ga0207681_10030710 3300025923 Bacteria 3505
110 Ga0207681_10388448 3300025923 Bacteria 1125
111 Ga0207694_10000014 3300025924 Bacteria 374435
112 Ga0207659_10066529 3300025926 Bacteria 2616
113 Ga0207690_10082252 3300025932 Bacteria 2252
114 Ga0207686_10031357 3300025934 Bacteria 3155
115 Ga0207709_10000858 3300025935 Bacteria 23259
116 Ga0207669_10043007 3300025937 Bacteria 2642
117 Ga0207669_10048973 3300025937 Bacteria 2515
118 Ga0207704_10258481 3300025938 Bacteria 1312
119 Ga0207691_10000180 3300025940 Bacteria 59800
120 Ga0207691_10230136 3300025940 Bacteria 1605
121 Ga0207711_10000001 3300025941 Bacteria 1325674
122 Ga0207711_10249757 3300025941 Bacteria 1629
123 Ga0207679_10045627 3300025945 Bacteria 3171
124 Ga0207667_10000051 3300025949 Bacteria 233836
125 Ga0207651_10035882 3300025960 Bacteria 3230
126 Ga0207668_10012941 3300025972 Bacteria 5124
127 Ga0207668_10014598 3300025972 Bacteria 4862
128 Ga0207668_10015611 3300025972 Bacteria 4721
129 Ga0207668_10024237 3300025972 Bacteria 3913
130 Ga0207668_10044401 3300025972 Bacteria 3023
131 Ga0207658_10081361 3300025986 Bacteria 2483
132 Ga0207658_10313925 3300025986 Bacteria 1355
133 Ga0207677_10033968 3300026023 Bacteria 3297
134 Ga0207703_10054968 3300026035 Bacteria 3239
135 Ga0207639_10009488 3300026041 Bacteria 6718
136 Ga0207639_10176509 3300026041 Bacteria 1814
137 Ga0207641_10317027 3300026088 Bacteria 1477
138 Ga0207648_10000040 3300026089 Bacteria 116539
139 Ga0207648_10002782 3300026089 Bacteria 18552
140 Ga0207683_10000146 3300026121 Bacteria 58543
141 Ga0207698_10001624 3300026142 Bacteria 13092
142 Ga0207698_10061675 3300026142 Bacteria 2924
143 Ga0207698_10312642 3300026142 Bacteria 1468
144 Ga0268265_10003922 3300028380 Bacteria 10479
145 Ga0268265_10005673 3300028380 Bacteria 8524
146 Ga0268264_10000021 3300028381 Bacteria 481580
147 Ga0265334_10002838 3300028573 Bacteria 7977
148 Ga0265318_10000107 3300028577 Bacteria 77965
149 Ga0307515_10029804 3300028794 Bacteria 9202
150 Ga0307515_10092741 3300028794 Bacteria 3755
151 Ga0265338_10000006 3300028800 Bacteria 570804
152 Ga0265338_10017709 3300028800 Bacteria 7661
153 Ga0265320_10000482 3300031240 Bacteria 31136
154 Ga0265325_10000003 3300031241 Bacteria 370490
155 Ga0265325_10000330 3300031241 Bacteria 33410
156 Ga0265325_10035497 3300031241 Bacteria 2648
157 Ga0265339_10001397 3300031249 Bacteria 17979
158 Ga0265339_10002187 3300031249 Bacteria 14185
159 Ga0265339_10012439 3300031249 Bacteria 5198
160 Ga0265331_10011769 3300031250 Viruses 4776
161 Ga0265331_10182321 3300031250 Unclassified 948
162 Ga0265327_10000178 3300031251 Bacteria 135732
163 Ga0265316_10012832 3300031344 Bacteria 7483
164 Ga0307408_100005260 3300031548 Bacteria 8671
165 Ga0265313_10003952 3300031595 Bacteria 11666
166 Ga0265313_10007731 3300031595 Bacteria 7277
167 Ga0265314_10007735 3300031711 Bacteria 9290
168 Ga0265314_10097048 3300031711 Bacteria 1905
169 Ga0265314_10101737 3300031711 Bacteria 1845
170 Ga0265342_10003917 3300031712 Bacteria 11954
171 Ga0265342_10149637 3300031712 Bacteria 1297
172 Ga0307516_10099257 3300031730 Unclassified 2729
173 Ga0307413_10002575 3300031824 Bacteria 7412
174 Ga0307410_10049533 3300031852 Bacteria 2820
175 Ga0307406_10003656 3300031901 Bacteria 8377
176 Ga0307406_10004209 3300031901 Bacteria 7831
177 Ga0307407_10009370 3300031903 Bacteria 4556
178 Ga0307412_10015052 3300031911 Bacteria 4575
179 Ga0307412_10043932 3300031911 Bacteria 2913
180 Ga0307409_100000331 3300031995 Bacteria 19505
181 Ga0307411_10026476 3300032005 Bacteria 3493
182 Ga0307415_100000986 3300032126 Bacteria 13119
183 Ga0373937_0007929 3300036401 Bacteria 9205
184 Ga0373937_0047088 3300036401 Bacteria 3945
185 Ga0373937_0483110 3300036401 Bacteria 1177
186 Ga0373925_0040140 3300037068 Bacteria 3464
187 Ga0395905_1088903 3300037471 Bacteria 702
188 Ga0436365_1094327 3300039437 Bacteria 5802
189 Ga0436365_1168772 3300039437 Bacteria 186262
190 Ga0436363_0082837 3300039450 Bacteria 833
191 Ga0439436_0000295 3300041404 Bacteria 12100
192 Ga0439449_0048931 3300042007 Bacteria 1565
193 Ga0439455_0021035 3300042012 Bacteria 1552
194 Ga0450898_028076 3300042134 Bacteria 1021
195 Ga0439458_0003335 3300042157 Bacteria 3775
196 Ga0451577_0034963 3300042876 Bacteria 4528
197 Ga0466972_0003012 3300044658 Bacteria 8351
198 Ga0466965_0016500 3300044683 Bacteria 3516
199 Ga0466961_0014711 3300044693 Bacteria 5028
200 Ga0466963_0074446 3300044694 Bacteria 2290
201 Ga0466968_0062309 3300044735 Bacteria 1610
202 Ga0466957_0150909 3300044842 Bacteria 1503
203 Ga0466960_0005830 3300044901 Bacteria 4907
204 Ga0466959_0006625 3300045049 Bacteria 8043
205 Ga0466967_0022903 3300045976 Bacteria 5108
206 Ga0495627_000806 3300046453 Bacteria 22874
207 Ga0495590_0002974 3300046457 Bacteria 6957
208 Ga0495638_0000320 3300046460 Bacteria 61710
209 Ga0495638_0000513 3300046460 Bacteria 45532
210 Ga0495638_0001360 3300046460 Bacteria 22422
211 Ga0495650_0000030 3300046471 Bacteria 436318
212 Ga0495580_0381920 3300046472 Bacteria 951
213 Ga0495664_0044813 3300046477 Bacteria 2622
214 Ga0495664_0149589 3300046477 Unclassified 1416
215 Ga0495606_0021737 3300046507 Bacteria 4693
216 Ga0495610_0000046 3300046512 Bacteria 153789
217 Ga0495610_0003426 3300046512 Bacteria 12370
218 Ga0495637_0006315 3300046520 Bacteria 5962
219 Ga0495643_0204846 3300046522 Bacteria 945
220 Ga0495648_0000334 3300046524 Bacteria 51958
221 Ga0495654_0002689 3300046530 Bacteria 11249
222 Ga0495597_0045093 3300046542 Bacteria 1958
223 Ga0495645_0281116 3300046543 Bacteria 1094
224 Ga0495668_0005349 3300046616 Bacteria 8755
225 Ga0495668_0101956 3300046616 Bacteria 1570
226 Ga0495625_0000068 3300046660 Bacteria 169922
227 Ga0495625_0001259 3300046660 Bacteria 31933
228 Ga0495625_0006512 3300046660 Bacteria 10374
229 Ga0495625_0006871 3300046660 Bacteria 10050
230 Ga0495625_0048075 3300046660 Bacteria 3073
231 Ga0495599_0382638 3300046678 Bacteria 840
232 Ga0495589_0004298 3300046794 Bacteria 7615
233 Ga0495672_0004077 3300047320 Bacteria 12190
234 Ga0495673_0000091 3300047469 Bacteria 187985
235 Ga0495673_0002690 3300047469 Bacteria 12243
236 Ga0495684_0349342 3300047471 Bacteria 1050
237 Ga0495686_0001810 3300047472 Bacteria 21581
238 Ga0495686_0002204 3300047472 Bacteria 18924
239 Ga0496102_0000074 3300048905 Bacteria 148938
240 Ga0496103_0010492 3300048906 Bacteria 5483
241 Ga0496104_0258129 3300048907 Bacteria 1656
242 Ga0496115_0009719 3300048918 Bacteria 7163
243 Ga0496115_0020327 3300048918 Bacteria 5121
244 Ga0496122_0335787 3300048925 Bacteria 796
245 Ga0501031_0254416 3300049568 Bacteria 1141
246 Ga0501032_0130615 3300049569 Bacteria 1657
247 Ga0501034_0069022 3300049571 Bacteria 3545
248 Ga0501036_0086889 3300049572 Bacteria 2643
249 Ga0501037_0154393 3300049573 Bacteria 1639
250 Ga0501038_0018101 3300049574 Bacteria 6365
251 Ga0501038_0068700 3300049574 Bacteria 3012
252 Ga0501039_0126579 3300049575 Bacteria 2004
253 Ga0501043_0238758 3300049579 Bacteria 1402
254 Ga0501047_0075495 3300049581 Bacteria 3243
255 Ga0501047_0116536 3300049581 Bacteria 2553
256 Ga0501048_0020709 3300049582 Bacteria 4821
257 Ga0501067_0031552 3300049583 Bacteria 2939
258 Ga0501068_0260721 3300049584 Bacteria 1106
259 Ga0501069_0012736 3300049585 Bacteria 4477
260 Ga0501070_0068543 3300049586 Bacteria 2936
261 Ga0501072_0494921 3300049588 Bacteria 967
262 Ga0501073_0460064 3300049589 Bacteria 879
263 Ga0501074_0044071 3300049590 Bacteria 3230
264 Ga0501076_0121359 3300049592 Bacteria 2116
265 Ga0501077_0022036 3300049593 Bacteria 4035
266 Ga0501238_006061 3300049671 Bacteria 1550
267 Ga0501079_0004909 3300049741 Bacteria 9916
268 Ga0501079_0071416 3300049741 Bacteria 2682
269 Ga0501080_0364925 3300049742 Bacteria 1302
270 Ga0501081_0008418 3300049743 Bacteria 6701
271 Ga0501083_0132919 3300049744 Bacteria 1631
272 Ga0501035_0002718 3300049822 Bacteria 17190
273 Ga0501044_0135155 3300049823 Bacteria 2457
274 Ga0501045_0087048 3300049824 Bacteria 2306
275 Ga0500578_0000082 3300053086 Bacteria 105580
276 Ga0500644_0000650 3300053088 Bacteria 12874
277 Ga0500644_0002330 3300053088 Bacteria 4779
278 Ga0500651_0008709 3300053093 Bacteria 5991
279 Ga0500556_0002699 3300053104 Bacteria 5497
280 Ga0500556_0123185 3300053104 Bacteria 1012
281 Ga0500562_001145 3300053108 Bacteria 6527
282 Ga0500594_0000213 3300053118 Bacteria 14182
283 Ga0500608_037461 3300053122 Bacteria 2317
284 Ga0500618_000626 3300053125 Bacteria 21346
285 Ga0500655_004365 3300053133 Bacteria 2552
286 Ga0500655_008454 3300053133 Unclassified 1852
287 Ga0500658_0009237 3300053134 Bacteria 3636
288 Ga0500559_0000031 3300053136 Bacteria 114782
289 Ga0500559_0001712 3300053136 Bacteria 12048
290 Ga0500559_0026746 3300053136 Bacteria 2459
291 Ga0500564_002811 3300053138 Bacteria 6557
292 Ga0500619_029660 3300053154 Bacteria 1656
293 Ga0500622_0004461 3300053156 Bacteria 8777
294 Ga0500622_0052792 3300053156 Bacteria 2089
295 Ga0500645_003369 3300053730 Bacteria 6538
296 Ga0501084_0000347 3300054114 Bacteria 35283
297 Ga0501084_0052916 3300054114 Bacteria 3396
298 Ga0501084_0072524 3300054114 Bacteria 2884
299 Ga0500661_014751 3300055283 Bacteria 1405
300 Ga0501082_0050459 3300060353 Bacteria 3588
301 Ga0466962_0001731 3300061719 Bacteria 10263
302 Ga0466962_0043889 3300061719 Bacteria 2139
303 Ga0530510_0029284 3300061734 Bacteria 3952
304 2585147578 2582581279 Bacteria 4980720
305 2587917324 2585428106 Bacteria 5179711
306 2643926001 2643221583 Bacteria 5218014
307 2644227189 2643221640 Bacteria 5258820
308 2644233344 2643221642 Bacteria 5357871
309 2644508681 2643221691 Bacteria 5093099
310 2792460275 2791355048 Bacteria 5832535
311 2843746846 2843744320 Bacteria 5659202
312 2849560920 2849560528 Bacteria 5393480
313 2849576649 2849573788 Bacteria 5421256
314 2851154126 2851153111 Bacteria 5542585
315 2857508291 2857504554 Bacteria 5369913
316 2885270789 2885266251 Bacteria 4796748
317 2898333260 2898329390 Bacteria 5168154
318 2928535891 2928531327 Bacteria 5101314
319 Ga0495682_0004563
320 Ga0055537_1001920
321 Ga0055536_1000434
322 Ga0055536_1000664
323 Ga0055528_1015688
324 Ga0055530_10002859
325 Ga0055530_10003071
326 Ga0070670_100183136
327 Ga0070670_100726575
328 Ga0070677_10000061
329 Ga0070666_10002931
330 Ga0070666_10004791
331 Ga0070666_10196041
332 Ga0070680_100000408
333 Ga0068868_100017983
334 Ga0070660_100071705
335 Ga0070661_100013495
336 Ga0070668_100000833
337 Ga0070668_100013152
338 Ga0070668_100018772
339 Ga0070668_100022877
340 Ga0070668_100040551
341 Ga0070669_100045309
342 Ga0070675_100058278
343 Ga0070674_100150644
344 Ga0070674_100473358
345 Ga0070673_100008496
346 Ga0070667_100002819
347 Ga0070667_100173814
348 Ga0070713_100082981
349 Ga0070711_100717290
350 Ga0070678_100008665
351 Ga0070681_10000003
352 Ga0068867_100000066
353 Ga0068867_100010000
354 Ga0068867_100360161
355 Ga0070685_10073022
356 Ga0070679_100000541
357 Ga0068853_100001850
358 Ga0070672_100178726
359 Ga0070665_100007136
360 Ga0068855_100000006
361 Ga0070664_100063492
362 Ga0068852_100003619
363 Ga0068852_100026301
364 Ga0068852_100436259
365 Ga0068861_100752751
366 Ga0068870_10040415
367 Ga0068863_100009126
368 Ga0068863_100010404
369 Ga0068863_100388519
370 Ga0068858_100052740
371 Ga0068860_100000515
372 Ga0068860_100232962
373 Ga0068862_100012610
374 Ga0068862_100049316
375 Ga0068862_100111061
376 Ga0075366_10149426
377 Ga0097621_100058673
378 Ga0075431_100264185
379 Ga0105240_10000357
380 Ga0105243_10004551
381 Ga0105241_10132180
382 Ga0105242_10026325
383 Ga0105248_10000001
384 Ga0105248_10053687
385 Ga0105249_10056598
386 Ga0105239_10012041
387 Ga0105239_10062839
388 Ga0157373_10000082
389 Ga0157370_10314708
390 Ga0157369_10007279
391 Ga0157378_10742590
392 Ga0157375_10391479
393 Ga0157375_10915120
394 Ga0157377_10000035
395 Ga0157379_10005836
396 Ga0157379_10025371
397 Ga0163161_10080206
398 Ga0213876_10000629
399 Ga0213876_10159774
400 Ga0209565_1001478
401 Ga0209673_1001479
402 Ga0209676_1000119
403 Ga0209676_1000382
404 Ga0209564_1001331
405 Ga0209564_1026732
406 Ga0209758_1000643
407 Ga0209050_1000263
408 Ga0209256_1000690
409 Ga0209256_1003662
410 Ga0209256_1008757
411 Ga0209256_1026715
412 Ga0209051_1006240
413 Ga0209257_1000234
414 Ga0209257_1003609
415 Ga0207656_10001440
416 Ga0207682_10000979
417 Ga0207692_10122051
418 Ga0207680_10001990
419 Ga0207680_10032682
420 Ga0207680_10154923
421 Ga0207643_10016103
422 Ga0207654_10076319
423 Ga0207695_10000004
424 Ga0207663_10030378
425 Ga0207657_10093057
426 Ga0207652_10000736
427 Ga0207681_10030710
428 Ga0207681_10388448
429 Ga0207694_10000014
430 Ga0207659_10066529
431 Ga0207690_10082252
432 Ga0207686_10031357
433 Ga0207709_10000858
434 Ga0207669_10043007
435 Ga0207669_10048973
436 Ga0207704_10258481
437 Ga0207691_10000180
438 Ga0207691_10230136
439 Ga0207711_10000001
440 Ga0207711_10249757
441 Ga0207679_10045627
442 Ga0207667_10000051
443 Ga0207651_10035882
444 Ga0207668_10012941
445 Ga0207668_10014598
446 Ga0207668_10015611
447 Ga0207668_10024237
448 Ga0207668_10044401
449 Ga0207658_10081361
450 Ga0207658_10313925
451 Ga0207677_10033968
452 Ga0207703_10054968
453 Ga0207639_10009488
454 Ga0207639_10176509
455 Ga0207641_10317027
456 Ga0207648_10000040
457 Ga0207648_10002782
458 Ga0207683_10000146
459 Ga0207698_10001624
460 Ga0207698_10061675
461 Ga0207698_10312642
462 Ga0268265_10003922
463 Ga0268265_10005673
464 Ga0268264_10000021
465 Ga0265334_10002838
466 Ga0265318_10000107
467 Ga0307515_10029804
468 Ga0307515_10092741
469 Ga0265338_10000006
470 Ga0265338_10017709
471 Ga0265320_10000482
472 Ga0265325_10000003
473 Ga0265325_10000330
474 Ga0265325_10035497
475 Ga0265339_10001397
476 Ga0265339_10002187
477 Ga0265339_10012439
478 Ga0265331_10011769
479 Ga0265331_10182321
480 Ga0265327_10000178
481 Ga0265316_10012832
482 Ga0307408_100005260
483 Ga0265313_10003952
484 Ga0265313_10007731
485 Ga0265314_10007735
486 Ga0265314_10097048
487 Ga0265314_10101737
488 Ga0265342_10003917
489 Ga0265342_10149637
490 Ga0307516_10099257
491 Ga0307413_10002575
492 Ga0307410_10049533
493 Ga0307406_10003656
494 Ga0307406_10004209
495 Ga0307407_10009370
496 Ga0307412_10015052
497 Ga0307412_10043932
498 Ga0307409_100000331
499 Ga0307411_10026476
500 Ga0307415_100000986
501 Ga0373937_0007929
502 Ga0373937_0047088
503 Ga0373937_0483110
504 Ga0373925_0040140
505 Ga0395905_1088903
506 Ga0436365_1094327
507 Ga0436365_1168772
508 Ga0436363_0082837
509 Ga0439436_0000295
510 Ga0439449_0048931
511 Ga0439455_0021035
512 Ga0450898_028076
513 Ga0439458_0003335
514 Ga0451577_0034963
515 Ga0466972_0003012
516 Ga0466965_0016500
517 Ga0466961_0014711
518 Ga0466963_0074446
519 Ga0466968_0062309
520 Ga0466957_0150909
521 Ga0466960_0005830
522 Ga0466959_0006625
523 Ga0466967_0022903
524 Ga0495627_000806
525 Ga0495590_0002974
526 Ga0495638_0000320
527 Ga0495638_0000513
528 Ga0495638_0001360
529 Ga0495650_0000030
530 Ga0495580_0381920
531 Ga0495664_0044813
532 Ga0495664_0149589
533 Ga0495606_0021737
534 Ga0495610_0000046
535 Ga0495610_0003426
536 Ga0495637_0006315
537 Ga0495643_0204846
538 Ga0495648_0000334
539 Ga0495654_0002689
540 Ga0495597_0045093
541 Ga0495645_0281116
542 Ga0495668_0005349
543 Ga0495668_0101956
544 Ga0495625_0000068
545 Ga0495625_0001259
546 Ga0495625_0006512
547 Ga0495625_0006871
548 Ga0495625_0048075
549 Ga0495599_0382638
550 Ga0495589_0004298
551 Ga0495672_0004077
552 Ga0495673_0000091
553 Ga0495673_0002690
554 Ga0495684_0349342
555 Ga0495686_0001810
556 Ga0495686_0002204
557 Ga0496102_0000074
558 Ga0496103_0010492
559 Ga0496104_0258129
560 Ga0496115_0009719
561 Ga0496115_0020327
562 Ga0496122_0335787
563 Ga0501031_0254416
564 Ga0501032_0130615
565 Ga0501034_0069022
566 Ga0501036_0086889
567 Ga0501037_0154393
568 Ga0501038_0018101
569 Ga0501038_0068700
570 Ga0501039_0126579
571 Ga0501043_0238758
572 Ga0501047_0075495
573 Ga0501047_0116536
574 Ga0501048_0020709
575 Ga0501067_0031552
576 Ga0501068_0260721
577 Ga0501069_0012736
578 Ga0501070_0068543
579 Ga0501072_0494921
580 Ga0501073_0460064
581 Ga0501074_0044071
582 Ga0501076_0121359
583 Ga0501077_0022036
584 Ga0501238_006061
585 Ga0501079_0004909
586 Ga0501079_0071416
587 Ga0501080_0364925
588 Ga0501081_0008418
589 Ga0501083_0132919
590 Ga0501035_0002718
591 Ga0501044_0135155
592 Ga0501045_0087048
593 Ga0500578_0000082
594 Ga0500644_0000650
595 Ga0500644_0002330
596 Ga0500651_0008709
597 Ga0500556_0002699
598 Ga0500556_0123185
599 Ga0500562_001145
600 Ga0500594_0000213
601 Ga0500608_037461
602 Ga0500618_000626
603 Ga0500655_004365
604 Ga0500655_008454
605 Ga0500658_0009237
606 Ga0500559_0000031
607 Ga0500559_0001712
608 Ga0500559_0026746
609 Ga0500564_002811
610 Ga0500619_029660
611 Ga0500622_0004461
612 Ga0500622_0052792
613 Ga0500645_003369
614 Ga0501084_0000347
615 Ga0501084_0052916
616 Ga0501084_0072524
617 Ga0500661_014751
618 Ga0501082_0050459
619 Ga0466962_0001731
620 Ga0466962_0043889
621 Ga0530510_0029284
622 2585147578
623 2587917324
624 2643926001
625 2644227189
626 2644233344
627 2644508681
628 2792460275
629 2843746846
630 2849560920
631 2849576649
632 2851154126
633 2857508291
634 2885270789
635 2898333260
636 2928535891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

30

229

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

36

274

0.96

PF08659

KR

KR domain

31

218

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9613 18 225
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9598 18 224
4ure-assembly1.cif.gz_A molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 0.9525 18 225
7v1r-assembly1.cif.gz_B leifsonia alcohol dehydrogenases lnadh 0.9489 18 225
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9478 17 227
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9613 18 225 3.40.50.720
4weoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9418 17 225 3.40.50.720
af_C7FZY1_11_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9342 36 174 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9337 59 225 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9277 65 170 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0J7XK50-F1-model_v4 Short-chain dehydrogenase 0.9894 18 227 GO:0006633
GO:0016616
GO:0048038
AF-A0A7Y8MG52-F1-model_v4 SDR family oxidoreductase 0.9851 31 227 GO:0016616
GO:0030497
AF-A0A087NBQ7-F1-model_v4 SDR-family protein 0.9836 36 227 GO:0006633
GO:0016616
GO:0048038
AF-A0A2M7LHT5-F1-model_v4 deleted 0.9816 112 227
AF-A0A7Y8MG52-F1-model_v4 SDR family oxidoreductase 0.9801 31 227 GO:0016616
GO:0030497

Map