F404902

General Info

Members Datasets Scaffolds Average Seq Length
319 173 319 352

Family's Representative Sequence

Representative Sequence 3300002244|JGI24742J22300_10000092|JGI24742J22300_100000924
Length 422
Sequence MAKKVFVGMSGGVDSSVTAALLKEQGYDVTGVYMKNWSQDLPGFVCPWKEDYQDAKRVAVQLGIPFLMFDFEKEYRQKVVDYMIEEYKAGRTPNPDIMCNQEVKFKLFLETALAQGADMIATGHYARVDHGLAGGSPGGTPSARSFSEDNGGNWTDRTRQTDAAVRGPVASSAPKNEIGGAAPISFLGAAPRGATPQPVVSAKLLTGIDSNKDQSYFLYRVTEEALSKTLMPIGEYEKPAVRELAKKYGLATAEKKDSQGICFVGKVGIKEFLQQFVTTQPGNIVDRNGKVIGEHDGALFYTIGQRHGLDVGGGLPYYVIGKDMDKNEVYVTTDLQDEGLWNDALTLTDMHWINGAPKGTQTPGALKVRTRYRAPLVPVTNIEQNDDGTWRVELGEDVRALTPGQSAVVYDGERVAGGGIVV

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
59 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
154 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
155 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
159 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
160 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
161 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
162 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
163 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
164 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
165 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
166 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
167 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
168 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
171 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.45
Nodule 0
Rhizoplane 0
Rhizosphere 73.98
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000243 3300001915 Bacteria 16188
2 JGI24740J21852_10010102 3300001979 Bacteria 3653
3 JGI24737J22298_10000030 3300001990 Bacteria 42783
4 JGI24735J21928_10000102 3300002067 Bacteria 31648
5 JGI24742J22300_10000092 3300002244 Bacteria 13209
6 rootH1_10139466 3300003316 Bacteria 1741
7 rootH2_10000244 3300003320 Bacteria 697651
8 rootL2_10085637 3300003322 Bacteria 18017
9 rootH1_10313903 3300003323 Bacteria 2353
10 Ga0070658_10000015 3300005327 Bacteria 230579
11 Ga0070658_10000403 3300005327 Bacteria 37465
12 Ga0070658_10000447 3300005327 Bacteria 35694
13 Ga0070658_10030821 3300005327 Bacteria 4308
14 Ga0070658_10039903 3300005327 Bacteria 3788
15 Ga0070676_10002540 3300005328 Bacteria 9377
16 Ga0070683_100000172 3300005329 Bacteria 42675
17 Ga0070683_100192300 3300005329 Bacteria 1938
18 Ga0070683_100263909 3300005329 Bacteria 1638
19 Ga0070690_100013388 3300005330 Bacteria 4845
20 Ga0070666_10012806 3300005335 Bacteria 5302
21 Ga0070680_100010789 3300005336 Bacteria 7053
22 Ga0070680_100031056 3300005336 Bacteria 4293
23 Ga0070682_100113824 3300005337 Bacteria 1807
24 Ga0070660_100000121 3300005339 Bacteria 49401
25 Ga0070660_100000265 3300005339 Bacteria 34665
26 Ga0070660_100013589 3300005339 Bacteria 5847
27 Ga0070661_100226228 3300005344 Bacteria 1436
28 Ga0070668_100132000 3300005347 Unclassified 2005
29 Ga0070671_100000001 3300005355 Bacteria 1228151
30 Ga0070671_100003199 3300005355 Bacteria 12769
31 Ga0070674_100012361 3300005356 Bacteria 5242
32 Ga0070688_100065612 3300005365 Bacteria 2308
33 Ga0070659_100001232 3300005366 Bacteria 18565
34 Ga0070659_100209260 3300005366 Bacteria 1607
35 Ga0070659_100322632 3300005366 Bacteria 1291
36 Ga0070667_100000001 3300005367 Bacteria 1108638
37 Ga0070667_100011294 3300005367 Bacteria 7387
38 Ga0070667_100014006 3300005367 Bacteria 6629
39 Ga0070685_10001136 3300005466 Bacteria 14217
40 Ga0070679_100005916 3300005530 Bacteria 11365
41 Ga0070679_100007068 3300005530 Bacteria 10473
42 Ga0070679_100024071 3300005530 Bacteria 5965
43 Ga0070679_100054521 3300005530 Bacteria 3980
44 Ga0070684_100006688 3300005535 Bacteria 8936
45 Ga0068853_100108573 3300005539 Bacteria 2462
46 Ga0068853_100270941 3300005539 Bacteria 1563
47 Ga0070693_100027560 3300005547 Bacteria 3081
48 Ga0068855_100000001 3300005563 Bacteria 818777
49 Ga0068855_100000413 3300005563 Bacteria 52993
50 Ga0068855_100020439 3300005563 Bacteria 7939
51 Ga0068855_100089127 3300005563 Bacteria 3563
52 Ga0068855_100091030 3300005563 Bacteria 3519
53 Ga0068855_100564980 3300005563 Bacteria 1230
54 Ga0070664_100078676 3300005564 Bacteria 2836
55 Ga0068857_100001220 3300005577 Bacteria 20028
56 Ga0068857_100103571 3300005577 Bacteria 2555
57 Ga0068857_100165636 3300005577 Bacteria 2007
58 Ga0068856_100013462 3300005614 Bacteria 7916
59 Ga0068856_100018149 3300005614 Bacteria 6822
60 Ga0068856_100104963 3300005614 Bacteria 2820
61 Ga0068860_100042264 3300005843 Bacteria 4354
62 Ga0081455_10000008 3300005937 Bacteria 256558
63 Ga0081539_10040860 3300005985 Unclassified 2718
64 Ga0075365_10000137 3300006038 Bacteria 22743
65 Ga0075365_10000293 3300006038 Bacteria 17345
66 Ga0075368_10000643 3300006042 Bacteria 10620
67 Ga0075363_100000063 3300006048 Bacteria 21867
68 Ga0075364_10000236 3300006051 Bacteria 26316
69 Ga0075364_10063823 3300006051 Bacteria 2418
70 Ga0075364_10076923 3300006051 Bacteria 2203
71 Ga0075364_10079114 3300006051 Bacteria 2172
72 Ga0075362_10000153 3300006177 Bacteria 18652
73 Ga0075367_10000072 3300006178 Bacteria 25736
74 Ga0075367_10005271 3300006178 Bacteria 6394
75 Ga0075367_10044698 3300006178 Bacteria 2598
76 Ga0075369_10000001 3300006186 Bacteria 299616
77 Ga0075369_10000008 3300006186 Bacteria 97558
78 Ga0075366_10000012 3300006195 Bacteria 75739
79 Ga0075366_10000059 3300006195 Bacteria 40344
80 Ga0075366_10000069 3300006195 Bacteria 39389
81 Ga0075366_10000132 3300006195 Bacteria 31135
82 Ga0075366_10000728 3300006195 Bacteria 15646
83 Ga0075366_10024451 3300006195 Bacteria 3524
84 Ga0097621_100001755 3300006237 Bacteria 14862
85 Ga0075370_10000628 3300006353 Bacteria 13663
86 Ga0075370_10004261 3300006353 Bacteria 6927
87 Ga0068871_100000038 3300006358 Bacteria 69723
88 Ga0075430_100007916 3300006846 Bacteria 8987
89 Ga0105240_10039628 3300009093 Bacteria 6031
90 Ga0111539_10012055 3300009094 Bacteria 10843
91 Ga0105245_10000044 3300009098 Bacteria 135878
92 Ga0105245_10434488 3300009098 Bacteria 1318
93 Ga0105245_10451142 3300009098 Bacteria 1295
94 Ga0105243_10005590 3300009148 Bacteria 9792
95 Ga0105241_10000003 3300009174 Bacteria 839043
96 Ga0105241_10200229 3300009174 Bacteria 1667
97 Ga0105242_10037993 3300009176 Bacteria 3870
98 Ga0105248_10074188 3300009177 Bacteria 3824
99 Ga0105238_10000721 3300009551 Bacteria 34481
100 Ga0105238_10141611 3300009551 Bacteria 2381
101 Ga0105249_10027495 3300009553 Bacteria 5133
102 Ga0105030_100204 3300009987 Bacteria 5087
103 Ga0105028_100017 3300009993 Bacteria 21566
104 Ga0105239_10059301 3300010375 Bacteria 4200
105 Ga0105239_10399516 3300010375 Bacteria 1555
106 Ga0157373_10000179 3300013100 Bacteria 52272
107 Ga0157371_10000105 3300013102 Bacteria 126728
108 Ga0157371_10007751 3300013102 Bacteria 8633
109 Ga0157370_10068473 3300013104 Bacteria 3354
110 Ga0157369_10000832 3300013105 Bacteria 39454
111 Ga0157369_10022274 3300013105 Bacteria 7074
112 Ga0157369_10157003 3300013105 Unclassified 2402
113 Ga0157374_10000058 3300013296 Bacteria 116810
114 Ga0157374_10000269 3300013296 Bacteria 48118
115 Ga0157374_10000898 3300013296 Bacteria 25934
116 Ga0157372_10000090 3300013307 Bacteria 93559
117 Ga0157372_10008226 3300013307 Bacteria 11085
118 Ga0163163_10011229 3300014325 Bacteria 8116
119 Ga0207680_10027485 3300025903 Bacteria 3169
120 Ga0207647_10001068 3300025904 Bacteria 21102
121 Ga0207645_10005423 3300025907 Bacteria 9247
122 Ga0207705_10000011 3300025909 Bacteria 517768
123 Ga0207705_10000202 3300025909 Bacteria 60086
124 Ga0207705_10031509 3300025909 Bacteria 3786
125 Ga0207654_10000002 3300025911 Bacteria 1460142
126 Ga0207654_10072241 3300025911 Bacteria 2053
127 Ga0207695_10035042 3300025913 Bacteria 5448
128 Ga0207660_10022269 3300025917 Bacteria 4269
129 Ga0207660_10028496 3300025917 Unclassified 3820
130 Ga0207660_10266486 3300025917 Bacteria 1356
131 Ga0207657_10001705 3300025919 Bacteria 23697
132 Ga0207657_10002714 3300025919 Bacteria 19067
133 Ga0207657_10003549 3300025919 Bacteria 16661
134 Ga0207652_10008668 3300025921 Bacteria 8187
135 Ga0207652_10019474 3300025921 Bacteria 5582
136 Ga0207694_10007085 3300025924 Bacteria 8516
137 Ga0207687_10000033 3300025927 Bacteria 135886
138 Ga0207687_10299216 3300025927 Bacteria 1295
139 Ga0207644_10000001 3300025931 Bacteria 1243214
140 Ga0207690_10000679 3300025932 Bacteria 21792
141 Ga0207690_10231091 3300025932 Bacteria 1420
142 Ga0207686_10044661 3300025934 Bacteria 2722
143 Ga0207709_10092294 3300025935 Bacteria 1982
144 Ga0207711_10441138 3300025941 Unclassified 1211
145 Ga0207661_10000110 3300025944 Bacteria 51908
146 Ga0207661_10009126 3300025944 Bacteria 7109
147 Ga0207667_10000003 3300025949 Bacteria 822935
148 Ga0207667_10000060 3300025949 Bacteria 192320
149 Ga0207667_10010079 3300025949 Bacteria 11079
150 Ga0207667_10096946 3300025949 Bacteria 3044
151 Ga0207712_10039665 3300025961 Bacteria 3228
152 Ga0207658_10000003 3300025986 Bacteria 1151934
153 Ga0207658_10011049 3300025986 Bacteria 6148
154 Ga0207703_10030108 3300026035 Bacteria 4288
155 Ga0207639_10068916 3300026041 Bacteria 2758
156 Ga0207702_10009254 3300026078 Bacteria 8280
157 Ga0207702_10012735 3300026078 Bacteria 6999
158 Ga0207702_10076353 3300026078 Bacteria 2896
159 Ga0207674_10000015 3300026116 Bacteria 183445
160 Ga0207674_10187544 3300026116 Bacteria 2018
161 Ga0209813_10000001 3300027866 Bacteria 280406
162 Ga0207428_10025294 3300027907 Bacteria 4968
163 Ga0268264_10011091 3300028381 Bacteria 7443
164 Ga0268264_10013049 3300028381 Bacteria 6828
165 Ga0265337_1001544 3300028556 Bacteria 11301
166 Ga0265337_1003999 3300028556 Bacteria 6237
167 Ga0265326_10000495 3300028558 Bacteria 15206
168 Ga0265326_10000564 3300028558 Bacteria 13844
169 Ga0265326_10008164 3300028558 Unclassified 3168
170 Ga0265326_10014260 3300028558 Unclassified 2315
171 Ga0265319_1006559 3300028563 Bacteria 5374
172 Ga0265319_1011838 3300028563 Unclassified 3551
173 Ga0265319_1069279 3300028563 Bacteria 1132
174 Ga0265334_10000059 3300028573 Bacteria 79953
175 Ga0265334_10008270 3300028573 Bacteria 4427
176 Ga0265322_10000981 3300028654 Bacteria 9915
177 Ga0265322_10004160 3300028654 Bacteria 4328
178 Ga0265336_10001232 3300028666 Bacteria 12144
179 Ga0265338_10000427 3300028800 Bacteria 75518
180 Ga0265338_10000504 3300028800 Bacteria 69708
181 Ga0265338_10000969 3300028800 Bacteria 48318
182 Ga0265338_10001475 3300028800 Bacteria 38085
183 Ga0265338_10009489 3300028800 Bacteria 11592
184 Ga0265338_10020994 3300028800 Bacteria 6832
185 Ga0265338_10051766 3300028800 Bacteria 3693
186 Ga0265338_10133342 3300028800 Bacteria 1957
187 Ga0265324_10003657 3300029957 Bacteria 7215
188 Ga0265324_10010382 3300029957 Bacteria 3592
189 Ga0265330_10000889 3300031235 Bacteria 18598
190 Ga0265330_10103096 3300031235 Bacteria 1220
191 Ga0265332_10013167 3300031238 Bacteria 3666
192 Ga0265328_10001432 3300031239 Bacteria 10982
193 Ga0265325_10019069 3300031241 Bacteria 3796
194 Ga0265325_10073149 3300031241 Bacteria 1716
195 Ga0265340_10006056 3300031247 Bacteria 6669
196 Ga0265339_10014878 3300031249 Bacteria 4678
197 Ga0265339_10133834 3300031249 Unclassified 1266
198 Ga0265331_10001265 3300031250 Bacteria 18908
199 Ga0265327_10000025 3300031251 Bacteria 380054
200 Ga0265327_10001867 3300031251 Bacteria 24387
201 Ga0265327_10002613 3300031251 Bacteria 18624
202 Ga0265327_10006268 3300031251 Bacteria 9582
203 Ga0265327_10107256 3300031251 Bacteria 1339
204 Ga0265327_10131397 3300031251 Bacteria 1178
205 Ga0265316_10012934 3300031344 Bacteria 7447
206 Ga0265316_10158192 3300031344 Bacteria 1695
207 Ga0265313_10008615 3300031595 Bacteria 6748
208 Ga0265314_10002204 3300031711 Bacteria 20331
209 Ga0265314_10033106 3300031711 Bacteria 3794
210 Ga0265314_10076336 3300031711 Bacteria 2226
211 Ga0265342_10004616 3300031712 Bacteria 10747
212 Ga0395900_0000305 3300037418 Bacteria 73205
213 Ga0395900_0005726 3300037418 Bacteria 12989
214 Ga0395900_0013339 3300037418 Bacteria 8401
215 Ga0395900_0026302 3300037418 Bacteria 5959
216 Ga0395900_0079215 3300037418 Bacteria 3376
217 Ga0395900_0187130 3300037418 Bacteria 2101
218 Ga0395898_0010622 3300037466 Bacteria 9618
219 Ga0395898_0018104 3300037466 Bacteria 7189
220 Ga0395898_0021818 3300037466 Bacteria 6487
221 Ga0395905_0316472 3300037471 Bacteria 1450
222 Ga0395905_0439376 3300037471 Unclassified 1202
223 Ga0395901_0047521 3300038443 Unclassified 4456
224 Ga0395901_0154189 3300038443 Bacteria 2413
225 Ga0395901_0552859 3300038443 Bacteria 1166
226 Ga0466963_0091071 3300044694 Bacteria 2077
227 Ga0495622_0000049 3300046557 Bacteria 108606
228 Ga0495588_0000264 3300046674 Bacteria 41659
229 Ga0495658_0002055 3300046683 Bacteria 10213
230 Ga0495658_0243924 3300046683 Bacteria 1129
231 Ga0495600_0003950 3300046809 Bacteria 8809
232 Ga0495672_0083301 3300047320 Bacteria 1777
233 Ga0495593_0022948 3300047673 Unclassified 3472
234 Ga0496125_0024835 3300048928 Bacteria 5500
235 Ga0501032_0003672 3300049569 Bacteria 11671
236 Ga0501034_0008883 3300049571 Bacteria 10565
237 Ga0501034_0023690 3300049571 Bacteria 6252
238 Ga0501034_0033508 3300049571 Bacteria 5211
239 Ga0501034_0085645 3300049571 Bacteria 3152
240 Ga0501034_0106059 3300049571 Unclassified 2803
241 Ga0501036_0002933 3300049572 Bacteria 13537
242 Ga0501037_0000031 3300049573 Bacteria 133137
243 Ga0501038_0022997 3300049574 Bacteria 5579
244 Ga0501039_0066760 3300049575 Bacteria 2793
245 Ga0501042_0055017 3300049578 Bacteria 2839
246 Ga0501042_0136280 3300049578 Bacteria 1770
247 Ga0501043_0000469 3300049579 Bacteria 36052
248 Ga0501046_0000189 3300049580 Bacteria 63296
249 Ga0501047_0000032 3300049581 Bacteria 208294
250 Ga0501047_0000057 3300049581 Bacteria 140059
251 Ga0501048_0000574 3300049582 Bacteria 26120
252 Ga0501048_0014164 3300049582 Bacteria 5910
253 Ga0501070_0015011 3300049586 Bacteria 6516
254 Ga0501070_0157671 3300049586 Bacteria 1872
255 Ga0501083_0010669 3300049744 Bacteria 6464
256 Ga0501083_0014800 3300049744 Bacteria 5457
257 Ga0501083_0114979 3300049744 Bacteria 1767
258 Ga0501083_0155504 3300049744 Unclassified 1497
259 Ga0501035_0000005 3300049822 Bacteria 392980
260 Ga0501035_0001029 3300049822 Bacteria 29304
261 Ga0501044_0037464 3300049823 Bacteria 5069
262 Ga0501044_0058507 3300049823 Bacteria 3952
263 nmdc:mga03683_49_c4 3300050489 Bacteria 19085
264 nmdc:mga03n38_72_c1 3300050490 Bacteria 21488
265 nmdc:mga00v17_12006_c1 3300050491 Bacteria 2435
266 nmdc:mga00v17_160_c1 3300050491 Bacteria 16634
267 nmdc:mga00v17_68478_c1 3300050491 Bacteria 2194
268 nmdc:mga00v17_6880_c1 3300050491 Bacteria 6044
269 nmdc:mga00v17_8000_c1 3300050491 Bacteria 5671
270 nmdc:mga0yw44_131_c1 3300050492 Bacteria 25689
271 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
272 nmdc:mga0k408_107_c1 3300050493 Bacteria 40466
273 nmdc:mga0k408_159_c1 3300050493 Bacteria 35027
274 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
275 nmdc:mga0k408_2987_c2 3300050493 Bacteria 7400
276 nmdc:mga0k408_46_c3 3300050493 Bacteria 36804
277 nmdc:mga0k408_645_c1 3300050493 Bacteria 19198
278 nmdc:mga0k408_6690_c1 3300050493 Bacteria 6143
279 nmdc:mga06z11_12_c1 3300050494 Bacteria 100611
280 nmdc:mga06z11_30854_c1 3300050494 Bacteria 2598
281 nmdc:mga06z11_99_c1 3300050494 Bacteria 36699
282 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
283 nmdc:mga07m45_4052_c1 3300050496 Bacteria 7139
284 nmdc:mga07m45_5280_c2 3300050496 Bacteria 5966
285 nmdc:mga0qj67_5880_c1 3300050509 Bacteria 8987
286 nmdc:mga08y16_10133_c1 3300050511 Bacteria 9893
287 nmdc:mga0sz30_2472_c3 3300050516 Bacteria 1578
288 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
289 nmdc:mga0sz30_3_c8 3300050516 Bacteria 110150
290 nmdc:mga0sz30_41774_c1 3300050516 Bacteria 1928
291 Ga0500610_0000103 3300053079 Bacteria 25503
292 Ga0500610_0014146 3300053079 Bacteria 3737
293 Ga0500643_000022 3300053087 Bacteria 277519
294 Ga0500643_021741 3300053087 Bacteria 2076
295 Ga0500644_0000419 3300053088 Bacteria 19939
296 Ga0500644_0000867 3300053088 Bacteria 9895
297 Ga0500583_0000145 3300053092 Bacteria 30109
298 Ga0500651_0000017 3300053093 Bacteria 156318
299 Ga0500651_0004658 3300053093 Bacteria 7719
300 Ga0500566_0000001 3300053094 Bacteria 1101031
301 Ga0500555_000001 3300053103 Bacteria 1353713
302 Ga0500555_000002 3300053103 Bacteria 1314346
303 Ga0500556_0000475 3300053104 Bacteria 28131
304 Ga0500562_000001 3300053108 Bacteria 1178987
305 Ga0500562_000002 3300053108 Bacteria 977234
306 Ga0500594_0000295 3300053118 Bacteria 11353
307 Ga0500614_000001 3300053123 Bacteria 1274484
308 Ga0500614_000607 3300053123 Bacteria 9150
309 Ga0500621_026384 3300053126 Bacteria 2280
310 Ga0500628_000042 3300053129 Bacteria 46597
311 Ga0500652_000028 3300053131 Bacteria 92605
312 Ga0500655_000957 3300053133 Bacteria 5557
313 Ga0500561_0000001 3300053137 Bacteria 957685
314 Ga0500568_0008767 3300053139 Unclassified 4850
315 Ga0500577_0000100 3300053142 Bacteria 20548
316 Ga0500577_0000725 3300053142 Bacteria 8436
317 Ga0500589_000028 3300053147 Bacteria 63762
318 Ga0500616_0000005 3300053153 Bacteria 961725
319 Ga0500649_000011 3300053722 Bacteria 87970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0243924 Ga0495658_0243924_77_940 279
2 3300031250 Ga0265331_10001265 Ga0265331_1000126514 295
3 3300005985 Ga0081539_10040860 Ga0081539_100408602 303
4 3300038443 Ga0395901_0552859 Ga0395901_0552859_208_1143 309
5 3300028558 Ga0265326_10000495 Ga0265326_100004954 310
6 3300028654 Ga0265322_10000981 Ga0265322_100009819 310
7 3300031235 Ga0265330_10000889 Ga0265330_100008897 310
8 3300031239 Ga0265328_10001432 Ga0265328_100014329 310
9 3300031251 Ga0265327_10006268 Ga0265327_100062681 310
10 3300031712 Ga0265342_10004616 Ga0265342_100046164 310
11 3300025911 Ga0207654_10072241 Ga0207654_100722412 312
12 3300037418 Ga0395900_0026302 Ga0395900_0026302_4981_5931 315
13 3300049744 Ga0501083_0155504 Ga0501083_0155504_434_1417 317
14 3300005563 Ga0068855_100089127 Ga0068855_1000891273 330
15 3300031251 Ga0265327_10000025 Ga0265327_10000025358 334
16 3300037471 Ga0395905_0439376 Ga0395905_0439376_135_1172 334
17 3300031251 Ga0265327_10001867 Ga0265327_1000186716 336
18 3300049571 Ga0501034_0023690 Ga0501034_0023690_4390_5430 336
19 3300050493 nmdc:mga0k408_2987_c2 nmdc:mga0k408_2987_c2_28_1110 336
20 3300005367 Ga0070667_100000001 Ga0070667_100000001551 337
21 3300005843 Ga0068860_100042264 Ga0068860_1000422643 337
22 3300025986 Ga0207658_10000003 Ga0207658_10000003829 337
23 3300028381 Ga0268264_10013049 Ga0268264_100130492 337
24 3300025949 Ga0207667_10096946 Ga0207667_100969463 338
25 3300005339 Ga0070660_100000121 Ga0070660_10000012111 339
26 3300005355 Ga0070671_100003199 Ga0070671_10000319911 339
27 3300005356 Ga0070674_100012361 Ga0070674_1000123612 339
28 3300005365 Ga0070688_100065612 Ga0070688_1000656122 339
29 3300005366 Ga0070659_100322632 Ga0070659_1003226321 339
30 3300005367 Ga0070667_100014006 Ga0070667_1000140064 339
31 3300005466 Ga0070685_10001136 Ga0070685_1000113612 339
32 3300005614 Ga0068856_100104963 Ga0068856_1001049631 339
33 3300006237 Ga0097621_100001755 Ga0097621_1000017559 339
34 3300006358 Ga0068871_100000038 Ga0068871_1000000389 339
35 3300009098 Ga0105245_10000044 Ga0105245_1000004461 339
36 3300013296 Ga0157374_10000058 Ga0157374_1000005860 339
37 3300025919 Ga0207657_10003549 Ga0207657_100035495 339
38 3300025927 Ga0207687_10000033 Ga0207687_1000003360 339
39 3300025941 Ga0207711_10441138 Ga0207711_104411381 339
40 3300025986 Ga0207658_10011049 Ga0207658_100110494 339
41 3300026078 Ga0207702_10076353 Ga0207702_100763531 339
42 3300028381 Ga0268264_10011091 Ga0268264_100110917 339
43 3300028573 Ga0265334_10000059 Ga0265334_1000005934 339
44 3300028800 Ga0265338_10000504 Ga0265338_100005046 339
45 3300031247 Ga0265340_10006056 Ga0265340_100060565 339
46 3300003320 rootH2_10000244 rootH2_10000244618 340
47 3300005329 Ga0070683_100263909 Ga0070683_1002639091 340
48 3300009098 Ga0105245_10451142 Ga0105245_104511422 340
49 3300009993 Ga0105028_100017 Ga0105028_1000179 340
50 3300025927 Ga0207687_10299216 Ga0207687_102992161 340
51 3300031711 Ga0265314_10002204 Ga0265314_1000220413 340
52 3300048928 Ga0496125_0024835 Ga0496125_0024835_21_1058 340
53 3300049571 Ga0501034_0106059 Ga0501034_0106059_533_1615 340
54 3300049744 Ga0501083_0014800 Ga0501083_0014800_2499_3590 340
55 3300053118 Ga0500594_0000295 Ga0500594_0000295_7184_8212 340
56 3300053129 Ga0500628_000042 Ga0500628_000042_7160_8188 340
57 3300014325 Ga0163163_10011229 Ga0163163_100112298 341
58 3300025949 Ga0207667_10010079 Ga0207667_100100797 341
59 3300049571 Ga0501034_0033508 Ga0501034_0033508_3942_4970 341
60 3300049571 Ga0501034_0085645 Ga0501034_0085645_565_1593 341
61 3300049575 Ga0501039_0066760 Ga0501039_0066760_840_1868 341
62 3300049578 Ga0501042_0136280 Ga0501042_0136280_29_1057 341
63 3300049581 Ga0501047_0000057 Ga0501047_0000057_40658_41686 341
64 3300049582 Ga0501048_0014164 Ga0501048_0014164_2742_3770 341
65 3300049586 Ga0501070_0157671 Ga0501070_0157671_155_1183 341
66 3300049822 Ga0501035_0000005 Ga0501035_0000005_344416_345444 341
67 3300049823 Ga0501044_0058507 Ga0501044_0058507_2056_3084 341
68 3300005327 Ga0070658_10000015 Ga0070658_10000015252 342
69 3300005336 Ga0070680_100010789 Ga0070680_1000107896 342
70 3300005530 Ga0070679_100054521 Ga0070679_1000545212 342
71 3300005563 Ga0068855_100020439 Ga0068855_1000204396 342
72 3300005563 Ga0068855_100091030 Ga0068855_1000910303 342
73 3300025909 Ga0207705_10000011 Ga0207705_1000001193 342
74 3300025917 Ga0207660_10028496 Ga0207660_100284962 342
75 3300028563 Ga0265319_1069279 Ga0265319_10692791 342
76 3300028800 Ga0265338_10051766 Ga0265338_100517663 342
77 3300031251 Ga0265327_10002613 Ga0265327_100026136 342
78 3300037418 Ga0395900_0000305 Ga0395900_0000305_61191_62225 342
79 3300037418 Ga0395900_0005726 Ga0395900_0005726_10492_11547 342
80 3300037418 Ga0395900_0013339 Ga0395900_0013339_4462_5514 342
81 3300037418 Ga0395900_0187130 Ga0395900_0187130_697_1737 342
82 3300037466 Ga0395898_0010622 Ga0395898_0010622_61_1116 342
83 3300037466 Ga0395898_0018104 Ga0395898_0018104_1256_2296 342
84 3300037471 Ga0395905_0316472 Ga0395905_0316472_174_1208 342
85 3300038443 Ga0395901_0047521 Ga0395901_0047521_1259_2314 342
86 3300049569 Ga0501032_0003672 Ga0501032_0003672_8129_9160 342
87 3300049571 Ga0501034_0008883 Ga0501034_0008883_17_1048 342
88 3300049572 Ga0501036_0002933 Ga0501036_0002933_1486_2517 342
89 3300049573 Ga0501037_0000031 Ga0501037_0000031_57409_58440 342
90 3300049574 Ga0501038_0022997 Ga0501038_0022997_16_1047 342
91 3300049578 Ga0501042_0055017 Ga0501042_0055017_1233_2264 342
92 3300049579 Ga0501043_0000469 Ga0501043_0000469_2657_3688 342
93 3300049580 Ga0501046_0000189 Ga0501046_0000189_39570_40601 342
94 3300049581 Ga0501047_0000032 Ga0501047_0000032_91983_93014 342
95 3300049582 Ga0501048_0000574 Ga0501048_0000574_2941_3972 342
96 3300049586 Ga0501070_0015011 Ga0501070_0015011_4595_5638 342
97 3300049744 Ga0501083_0010669 Ga0501083_0010669_2261_3292 342
98 3300049744 Ga0501083_0114979 Ga0501083_0114979_123_1166 342
99 3300049822 Ga0501035_0001029 Ga0501035_0001029_4396_5427 342
100 3300049823 Ga0501044_0037464 Ga0501044_0037464_2069_3100 342
101 3300050492 nmdc:mga0yw44_131_c1 nmdc:mga0yw44_131_c1_15_1241 342
102 3300053104 Ga0500556_0000475 Ga0500556_0000475_8344_9375 342
103 3300025924 Ga0207694_10007085 Ga0207694_100070857 343
104 3300044694 Ga0466963_0091071 Ga0466963_0091071_376_1416 343
105 3300013307 Ga0157372_10000090 Ga0157372_1000009051 344
106 3300037466 Ga0395898_0021818 Ga0395898_0021818_4567_5619 344
107 3300053108 Ga0500562_000001 Ga0500562_000001_23393_24433 344
108 3300053133 Ga0500655_000957 Ga0500655_000957_1203_2243 344
109 3300028556 Ga0265337_1003999 Ga0265337_10039994 345
110 3300028558 Ga0265326_10008164 Ga0265326_100081643 345
111 3300028654 Ga0265322_10004160 Ga0265322_100041603 345
112 3300028800 Ga0265338_10001475 Ga0265338_1000147534 345
113 3300028800 Ga0265338_10020994 Ga0265338_100209944 345
114 3300029957 Ga0265324_10003657 Ga0265324_100036572 345
115 3300031249 Ga0265339_10133834 Ga0265339_101338341 345
116 3300031344 Ga0265316_10012934 Ga0265316_100129342 345
117 3300038443 Ga0395901_0154189 Ga0395901_0154189_1136_2215 345
118 3300003323 rootH1_10313903 rootH1_103139032 346
119 3300005327 Ga0070658_10000447 Ga0070658_1000044712 346
120 3300005329 Ga0070683_100192300 Ga0070683_1001923002 346
121 3300005335 Ga0070666_10012806 Ga0070666_100128063 346
122 3300005336 Ga0070680_100031056 Ga0070680_1000310563 346
123 3300005339 Ga0070660_100000265 Ga0070660_10000026536 346
124 3300005339 Ga0070660_100013589 Ga0070660_1000135893 346
125 3300005347 Ga0070668_100132000 Ga0070668_1001320002 346
126 3300005355 Ga0070671_100000001 Ga0070671_100000001726 346
127 3300005366 Ga0070659_100001232 Ga0070659_10000123211 346
128 3300005366 Ga0070659_100209260 Ga0070659_1002092602 346
129 3300005530 Ga0070679_100005916 Ga0070679_1000059165 346
130 3300005530 Ga0070679_100007068 Ga0070679_1000070686 346
131 3300005539 Ga0068853_100108573 Ga0068853_1001085732 346
132 3300005539 Ga0068853_100270941 Ga0068853_1002709412 346
133 3300005547 Ga0070693_100027560 Ga0070693_1000275602 346
134 3300005563 Ga0068855_100000413 Ga0068855_1000004135 346
135 3300005577 Ga0068857_100001220 Ga0068857_10000122010 346
136 3300005614 Ga0068856_100013462 Ga0068856_1000134627 346
137 3300005937 Ga0081455_10000008 Ga0081455_1000000873 346
138 3300006051 Ga0075364_10063823 Ga0075364_100638233 346
139 3300009098 Ga0105245_10434488 Ga0105245_104344881 346
140 3300009174 Ga0105241_10200229 Ga0105241_102002292 346
141 3300009176 Ga0105242_10037993 Ga0105242_100379933 346
142 3300009551 Ga0105238_10000721 Ga0105238_1000072130 346
143 3300010375 Ga0105239_10059301 Ga0105239_100593014 346
144 3300010375 Ga0105239_10399516 Ga0105239_103995162 346
145 3300013105 Ga0157369_10022274 Ga0157369_100222742 346
146 3300013105 Ga0157369_10157003 Ga0157369_101570033 346
147 3300013296 Ga0157374_10000269 Ga0157374_1000026935 346
148 3300013296 Ga0157374_10000898 Ga0157374_100008982 346
149 3300013307 Ga0157372_10008226 Ga0157372_1000822611 346
150 3300025904 Ga0207647_10001068 Ga0207647_1000106810 346
151 3300025917 Ga0207660_10022269 Ga0207660_100222696 346
152 3300025917 Ga0207660_10266486 Ga0207660_102664861 346
153 3300025919 Ga0207657_10001705 Ga0207657_1000170525 346
154 3300025919 Ga0207657_10002714 Ga0207657_100027144 346
155 3300025921 Ga0207652_10008668 Ga0207652_100086685 346
156 3300025921 Ga0207652_10019474 Ga0207652_100194746 346
157 3300025932 Ga0207690_10000679 Ga0207690_100006793 346
158 3300025932 Ga0207690_10231091 Ga0207690_102310911 346
159 3300025934 Ga0207686_10044661 Ga0207686_100446612 346
160 3300025949 Ga0207667_10000060 Ga0207667_1000006053 346
161 3300026035 Ga0207703_10030108 Ga0207703_100301082 346
162 3300026041 Ga0207639_10068916 Ga0207639_100689163 346
163 3300026078 Ga0207702_10012735 Ga0207702_100127351 346
164 3300026116 Ga0207674_10000015 Ga0207674_1000001515 346
165 3300028556 Ga0265337_1001544 Ga0265337_10015448 346
166 3300028558 Ga0265326_10000564 Ga0265326_1000056413 346
167 3300028558 Ga0265326_10014260 Ga0265326_100142602 346
168 3300028563 Ga0265319_1011838 Ga0265319_10118383 346
169 3300028573 Ga0265334_10008270 Ga0265334_100082703 346
170 3300028666 Ga0265336_10001232 Ga0265336_1000123211 346
171 3300028800 Ga0265338_10000427 Ga0265338_1000042733 346
172 3300028800 Ga0265338_10000969 Ga0265338_1000096919 346
173 3300028800 Ga0265338_10009489 Ga0265338_100094898 346
174 3300028800 Ga0265338_10133342 Ga0265338_101333422 346
175 3300031344 Ga0265316_10158192 Ga0265316_101581922 346
176 3300050491 nmdc:mga00v17_12006_c1 nmdc:mga00v17_12006_c1_806_1861 346
177 3300050491 nmdc:mga00v17_6880_c1 nmdc:mga00v17_6880_c1_480_1523 346
178 3300053087 Ga0500643_000022 Ga0500643_000022_180513_181556 346
179 3300053093 Ga0500651_0000017 Ga0500651_0000017_31808_32872 346
180 3300053093 Ga0500651_0004658 Ga0500651_0004658_5888_6952 346
181 3300053123 Ga0500614_000607 Ga0500614_000607_6567_7631 346
182 3300053139 Ga0500568_0008767 Ga0500568_0008767_107_1150 346
183 3300005327 Ga0070658_10030821 Ga0070658_100308213 347
184 3300005327 Ga0070658_10039903 Ga0070658_100399032 347
185 3300005337 Ga0070682_100113824 Ga0070682_1001138242 347
186 3300005530 Ga0070679_100024071 Ga0070679_1000240715 347
187 3300005563 Ga0068855_100564980 Ga0068855_1005649802 347
188 3300005577 Ga0068857_100103571 Ga0068857_1001035712 347
189 3300005577 Ga0068857_100165636 Ga0068857_1001656362 347
190 3300009094 Ga0111539_10012055 Ga0111539_100120555 347
191 3300009148 Ga0105243_10005590 Ga0105243_100055905 347
192 3300009177 Ga0105248_10074188 Ga0105248_100741883 347
193 3300009551 Ga0105238_10141611 Ga0105238_101416112 347
194 3300013102 Ga0157371_10000105 Ga0157371_1000010556 347
195 3300025903 Ga0207680_10027485 Ga0207680_100274852 347
196 3300025909 Ga0207705_10031509 Ga0207705_100315094 347
197 3300025931 Ga0207644_10000001 Ga0207644_10000001709 347
198 3300025935 Ga0207709_10092294 Ga0207709_100922942 347
199 3300026116 Ga0207674_10187544 Ga0207674_101875442 347
200 3300027907 Ga0207428_10025294 Ga0207428_100252943 347
201 3300037418 Ga0395900_0079215 Ga0395900_0079215_526_1638 347
202 3300046674 Ga0495588_0000264 Ga0495588_0000264_36159_37202 347
203 3300050511 nmdc:mga08y16_10133_c1 nmdc:mga08y16_10133_c1_5543_6592 347
204 3300053103 Ga0500555_000001 Ga0500555_000001_501999_503042 347
205 3300053123 Ga0500614_000001 Ga0500614_000001_557257_558300 347
206 3300053722 Ga0500649_000011 Ga0500649_000011_45885_46928 347
207 3300001990 JGI24737J22298_10000030 JGI24737J22298_1000003014 348
208 3300002067 JGI24735J21928_10000102 JGI24735J21928_100001026 348
209 3300005327 Ga0070658_10000403 Ga0070658_1000040310 348
210 3300005329 Ga0070683_100000172 Ga0070683_10000017228 348
211 3300005330 Ga0070690_100013388 Ga0070690_1000133882 348
212 3300005344 Ga0070661_100226228 Ga0070661_1002262282 348
213 3300005367 Ga0070667_100011294 Ga0070667_1000112942 348
214 3300005535 Ga0070684_100006688 Ga0070684_1000066885 348
215 3300005564 Ga0070664_100078676 Ga0070664_1000786762 348
216 3300005614 Ga0068856_100018149 Ga0068856_1000181493 348
217 3300006038 Ga0075365_10000137 Ga0075365_1000013715 348
218 3300006042 Ga0075368_10000643 Ga0075368_100006439 348
219 3300006048 Ga0075363_100000063 Ga0075363_10000006311 348
220 3300006051 Ga0075364_10079114 Ga0075364_100791142 348
221 3300006177 Ga0075362_10000153 Ga0075362_1000015316 348
222 3300006178 Ga0075367_10000072 Ga0075367_1000007214 348
223 3300006178 Ga0075367_10005271 Ga0075367_100052713 348
224 3300006186 Ga0075369_10000001 Ga0075369_1000000190 348
225 3300006186 Ga0075369_10000008 Ga0075369_10000008119 348
226 3300006195 Ga0075366_10000012 Ga0075366_100000122 348
227 3300006195 Ga0075366_10000059 Ga0075366_1000005932 348
228 3300006195 Ga0075366_10000069 Ga0075366_1000006914 348
229 3300006195 Ga0075366_10000132 Ga0075366_1000013212 348
230 3300006195 Ga0075366_10000728 Ga0075366_1000072810 348
231 3300006353 Ga0075370_10000628 Ga0075370_100006283 348
232 3300006353 Ga0075370_10004261 Ga0075370_100042614 348
233 3300009093 Ga0105240_10039628 Ga0105240_100396284 348
234 3300009553 Ga0105249_10027495 Ga0105249_100274952 348
235 3300009987 Ga0105030_100204 Ga0105030_1002045 348
236 3300013100 Ga0157373_10000179 Ga0157373_1000017925 348
237 3300013104 Ga0157370_10068473 Ga0157370_100684732 348
238 3300025909 Ga0207705_10000202 Ga0207705_1000020223 348
239 3300025913 Ga0207695_10035042 Ga0207695_100350423 348
240 3300025944 Ga0207661_10000110 Ga0207661_1000011028 348
241 3300025944 Ga0207661_10009126 Ga0207661_100091263 348
242 3300025961 Ga0207712_10039665 Ga0207712_100396653 348
243 3300026078 Ga0207702_10009254 Ga0207702_100092547 348
244 3300027866 Ga0209813_10000001 Ga0209813_10000001188 348
245 3300050489 nmdc:mga03683_49_c4 nmdc:mga03683_49_c4_3601_4659 348
246 3300050490 nmdc:mga03n38_72_c1 nmdc:mga03n38_72_c1_3483_4544 348
247 3300050491 nmdc:mga00v17_68478_c1 nmdc:mga00v17_68478_c1_1006_2055 348
248 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_5531_6577 348
249 3300050493 nmdc:mga0k408_107_c1 nmdc:mga0k408_107_c1_29317_30363 348
250 3300050493 nmdc:mga0k408_159_c1 nmdc:mga0k408_159_c1_9570_10619 348
251 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_476948_478003 348
252 3300050493 nmdc:mga0k408_46_c3 nmdc:mga0k408_46_c3_3002_4048 348
253 3300050493 nmdc:mga0k408_645_c1 nmdc:mga0k408_645_c1_12396_13451 348
254 3300050493 nmdc:mga0k408_6690_c1 nmdc:mga0k408_6690_c1_3952_4998 348
255 3300050494 nmdc:mga06z11_12_c1 nmdc:mga06z11_12_c1_14780_15841 348
256 3300050494 nmdc:mga06z11_99_c1 nmdc:mga06z11_99_c1_24041_25096 348
257 3300050495 nmdc:mga04h51_1_c1 nmdc:mga04h51_1_c1_168059_169120 348
258 3300050496 nmdc:mga07m45_4052_c1 nmdc:mga07m45_4052_c1_2876_3922 348
259 3300050496 nmdc:mga07m45_5280_c2 nmdc:mga07m45_5280_c2_1957_3018 348
260 3300050516 nmdc:mga0sz30_2472_c3 nmdc:mga0sz30_2472_c3_20_1066 348
261 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_622660_623706 348
262 3300050516 nmdc:mga0sz30_3_c8 nmdc:mga0sz30_3_c8_95600_96655 348
263 3300050516 nmdc:mga0sz30_41774_c1 nmdc:mga0sz30_41774_c1_86_1132 348
264 3300053079 Ga0500610_0000103 Ga0500610_0000103_14145_15197 348
265 3300053079 Ga0500610_0014146 Ga0500610_0014146_1448_2494 348
266 3300053087 Ga0500643_021741 Ga0500643_021741_574_1635 348
267 3300053088 Ga0500644_0000419 Ga0500644_0000419_18390_19436 348
268 3300053088 Ga0500644_0000867 Ga0500644_0000867_5829_6881 348
269 3300053092 Ga0500583_0000145 Ga0500583_0000145_7521_8567 348
270 3300053103 Ga0500555_000002 Ga0500555_000002_784213_785274 348
271 3300053108 Ga0500562_000002 Ga0500562_000002_705285_706334 348
272 3300053126 Ga0500621_026384 Ga0500621_026384_511_1557 348
273 3300053131 Ga0500652_000028 Ga0500652_000028_7481_8542 348
274 3300053137 Ga0500561_0000001 Ga0500561_0000001_806099_807145 348
275 3300053142 Ga0500577_0000725 Ga0500577_0000725_2938_3984 348
276 3300053147 Ga0500589_000028 Ga0500589_000028_32569_33615 348
277 3300031251 Ga0265327_10131397 Ga0265327_101313971 349
278 3300046557 Ga0495622_0000049 Ga0495622_0000049_88004_89161 349
279 3300046683 Ga0495658_0002055 Ga0495658_0002055_784_1923 349
280 3300046809 Ga0495600_0003950 Ga0495600_0003950_7650_8789 349
281 3300047673 Ga0495593_0022948 Ga0495593_0022948_1226_2365 349
282 3300053094 Ga0500566_0000001 Ga0500566_0000001_433995_435134 349
283 3300053153 Ga0500616_0000005 Ga0500616_0000005_195859_196980 349
284 3300003316 rootH1_10139466 rootH1_101394662 350
285 3300006038 Ga0075365_10000293 Ga0075365_1000029316 350
286 3300006051 Ga0075364_10000236 Ga0075364_1000023626 350
287 3300006178 Ga0075367_10044698 Ga0075367_100446982 350
288 3300009174 Ga0105241_10000003 Ga0105241_10000003428 350
289 3300025911 Ga0207654_10000002 Ga0207654_10000002778 350
290 3300050491 nmdc:mga00v17_160_c1 nmdc:mga00v17_160_c1_12709_13968 350
291 3300050494 nmdc:mga06z11_30854_c1 nmdc:mga06z11_30854_c1_557_1726 350
292 3300003322 rootL2_10085637 rootL2_1008563728 351
293 3300013102 Ga0157371_10007751 Ga0157371_1000775111 351
294 3300047320 Ga0495672_0083301 Ga0495672_0083301_406_1650 351
295 3300053142 Ga0500577_0000100 Ga0500577_0000100_2581_3831 351
296 3300006051 Ga0075364_10076923 Ga0075364_100769232 352
297 3300028563 Ga0265319_1006559 Ga0265319_10065592 352
298 3300029957 Ga0265324_10010382 Ga0265324_100103821 352
299 3300031235 Ga0265330_10103096 Ga0265330_101030961 352
300 3300031238 Ga0265332_10013167 Ga0265332_100131673 352
301 3300031241 Ga0265325_10019069 Ga0265325_100190691 352
302 3300031241 Ga0265325_10073149 Ga0265325_100731491 352
303 3300031249 Ga0265339_10014878 Ga0265339_100148781 352
304 3300031251 Ga0265327_10107256 Ga0265327_101072561 352
305 3300031595 Ga0265313_10008615 Ga0265313_100086151 352
306 3300031711 Ga0265314_10033106 Ga0265314_100331061 352
307 3300031711 Ga0265314_10076336 Ga0265314_100763363 352
308 3300050491 nmdc:mga00v17_8000_c1 nmdc:mga00v17_8000_c1_1306_2364 352
309 3300006846 Ga0075430_100007916 Ga0075430_1000079162 353
310 3300050509 nmdc:mga0qj67_5880_c1 nmdc:mga0qj67_5880_c1_503_1690 353
311 3300006195 Ga0075366_10024451 Ga0075366_100244512 356
312 3300005563 Ga0068855_100000001 Ga0068855_100000001137 359
313 3300013105 Ga0157369_10000832 Ga0157369_1000083215 359
314 3300025949 Ga0207667_10000003 Ga0207667_10000003131 359
315 3300001915 JGI24741J21665_1000243 JGI24741J21665_10002432 360
316 3300001979 JGI24740J21852_10010102 JGI24740J21852_100101021 360
317 3300002244 JGI24742J22300_10000092 JGI24742J22300_100000924 360
318 3300005328 Ga0070676_10002540 Ga0070676_100025405 360
319 3300025907 Ga0207645_10005423 Ga0207645_100054235 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20259

tRNA_Me_trans_M

tRNA methyl transferase PRC-barrel domain

270

333

0.97

PF03054

tRNA_Me_trans

tRNA methyl transferase HUP domain

192

266

0.96

PF03054

tRNA_Me_trans

tRNA methyl transferase HUP domain

3

142

0.95

PF20258

tRNA_Me_trans_C

Aminomethyltransferase beta-barrel domain

342

421

0.95

PF02540

NAD_synthase

NAD synthase

1

95

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hma-assembly1.cif.gz_A-2 the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae 0.9476 3 359
2deu-assembly2.cif.gz_B cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state 0.935 2 359
2der-assembly1.cif.gz_A cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state 0.9281 2 359
2deu-assembly2.cif.gz_B cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state 0.9224 2 359
2hma-assembly1.cif.gz_A-2 the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae 0.9093 3 359
ID Description Score Start End Superfamily
2hmaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9528 3 215 3.40.50.620
af_Q54I63_53_281_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9307 3 216 3.40.50.620
2derA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9251 2 196 3.40.50.620
2hmaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.921 3 215 3.40.50.620
af_Q503J2_4_234_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9192 3 214 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A4Q0AG09-F1-model_v4 tRNA 2-thiouridine(34) synthase MnmA 0.9921 1 129 GO:0002143
AF-A0A2G6C5K5-F1-model_v4 tRNA 2-thiouridine(34) synthase MnmA 0.9892 3 94 GO:0002143
AF-A0A4P5ULS7-F1-model_v4 tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) 0.9856 4 360 GO:0000049
GO:0002143
GO:0005524
GO:0005737
GO:0103016
AF-A0A4P5ULS7-F1-model_v4 tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) 0.9799 4 360 GO:0000049
GO:0002143
GO:0005524
GO:0005737
GO:0103016
AF-A0A288DFM5-F1-model_v4 tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) 0.9765 4 360 GO:0000049
GO:0002143
GO:0005524
GO:0005737
GO:0103016

Feature Viewer

pLDDT pTM Quality
92.64 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map