F405116

General Info

Members Datasets Scaffolds Average Seq Length
319 223 319 288

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10378837|Ga0207700_103788371
Length 281
Sequence MSNEVLPSRWLVTTEWFAQHLAAPDTVVVDGSFYLPALQRDAGAEYLAGHIPGDIDAIADHTNPLPHMLPSADAFAREVGALGIADTETIVVYDGIGLGGAPRVWWTFRIFGAKNVFILDGGLPKWKAEGRPLQSGAVKREPRRFNAKFDAALVADVSAVRRALAEKTAQVVDARPADRFRGEAPEPRPGVRSGHMPGALNVPSTQLAEGGRLVAPERIRQIFAAGGVDLTKPIITSCGSGVTAATLWFALDAIGKPPQALYDGSWSEWGSRGDLPIEPIA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 16.3
Rhizosphere 78.37
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10202325 3300003323 Bacteria 1216
2 Ga0070683_100055001 3300005329 Bacteria 3691
3 Ga0070670_100100857 3300005331 Bacteria 2485
4 Ga0068869_100025858 3300005334 Bacteria 4080
5 Ga0070682_100245414 3300005337 Bacteria 1288
6 Ga0068868_100016122 3300005338 Bacteria 5543
7 Ga0070660_100077157 3300005339 Bacteria 2610
8 Ga0070689_100025425 3300005340 Bacteria 4448
9 Ga0070687_100066683 3300005343 Bacteria 1919
10 Ga0070692_10116041 3300005345 Bacteria 1487
11 Ga0070668_100150506 3300005347 Bacteria 1881
12 Ga0070671_100004428 3300005355 Bacteria 11112
13 Ga0070674_100097094 3300005356 Bacteria 2139
14 Ga0070673_100009813 3300005364 Bacteria 6448
15 Ga0070688_100013506 3300005365 Bacteria 4607
16 Ga0070688_100219558 3300005365 Bacteria 1339
17 Ga0070688_100237871 3300005365 Bacteria 1291
18 Ga0070667_100051439 3300005367 Bacteria 3473
19 Ga0070667_100258646 3300005367 Bacteria 1558
20 Ga0070713_100238023 3300005436 Bacteria 1657
21 Ga0070710_10126724 3300005437 Bacteria 1552
22 Ga0070711_100005538 3300005439 Bacteria 7561
23 Ga0070663_100044433 3300005455 Bacteria 3132
24 Ga0070662_100045725 3300005457 Bacteria 3142
25 Ga0070662_100070538 3300005457 Bacteria 2575
26 Ga0070697_100000548 3300005536 Bacteria 28232
27 Ga0070672_100074762 3300005543 Bacteria 2703
28 Ga0070686_100009747 3300005544 Bacteria 5397
29 Ga0070695_100075643 3300005545 Bacteria 2216
30 Ga0070695_100309121 3300005545 Bacteria 1171
31 Ga0070665_100154264 3300005548 Bacteria 2298
32 Ga0070665_100340080 3300005548 Bacteria 1505
33 Ga0070702_100061081 3300005615 Bacteria 2193
34 Ga0068864_100005554 3300005618 Bacteria 10340
35 Ga0068866_10189590 3300005718 Bacteria 1221
36 Ga0068861_100049567 3300005719 Bacteria 3180
37 Ga0068870_10004231 3300005840 Bacteria 6169
38 Ga0068863_100044870 3300005841 Bacteria 4195
39 Ga0068858_100044217 3300005842 Bacteria 4129
40 Ga0068858_100199407 3300005842 Bacteria 1892
41 Ga0068860_100061019 3300005843 Bacteria 3582
42 Ga0068860_100399460 3300005843 Bacteria 1359
43 Ga0068862_100050939 3300005844 Bacteria 3540
44 Ga0081455_10018235 3300005937 Bacteria 6696
45 Ga0081455_10039883 3300005937 Bacteria 4145
46 Ga0081538_10060587 3300005981 Bacteria 2175
47 Ga0081540_1000766 3300005983 Bacteria 29582
48 Ga0081540_1121374 3300005983 Bacteria 1084
49 Ga0081539_10045501 3300005985 Bacteria 2523
50 Ga0070717_10033537 3300006028 Bacteria 4143
51 Ga0070717_10194310 3300006028 Bacteria 1774
52 Ga0075365_10076550 3300006038 Bacteria 2259
53 Ga0075363_100004062 3300006048 Bacteria 6335
54 Ga0070712_100218366 3300006175 Bacteria 1508
55 Ga0075367_10084619 3300006178 Bacteria 1923
56 Ga0075366_10020715 3300006195 Bacteria 3818
57 Ga0068871_100032808 3300006358 Bacteria 4105
58 Ga0075428_100075012 3300006844 Bacteria 3694
59 Ga0075430_100313764 3300006846 Bacteria 1296
60 Ga0075431_100087511 3300006847 Bacteria 3214
61 Ga0075433_10023658 3300006852 Bacteria 5174
62 Ga0075429_100143178 3300006880 Bacteria 2093
63 Ga0075429_100364631 3300006880 Bacteria 1265
64 Ga0068865_100105027 3300006881 Bacteria 2074
65 Ga0075436_100001204 3300006914 Bacteria 17605
66 Ga0099795_10000284 3300007788 Bacteria 9080
67 Ga0111539_10172694 3300009094 Bacteria 2525
68 Ga0111539_10584099 3300009094 Bacteria 1301
69 Ga0105245_10244576 3300009098 Bacteria 1741
70 Ga0114129_10413590 3300009147 Bacteria 1775
71 Ga0105243_10042474 3300009148 Bacteria 3559
72 Ga0105243_10395545 3300009148 Bacteria 1282
73 Ga0105248_10036278 3300009177 Bacteria 5514
74 Ga0105248_10143738 3300009177 Bacteria 2692
75 Ga0105237_10083778 3300009545 Bacteria 3179
76 Ga0105249_10310959 3300009553 Bacteria 1584
77 Ga0105239_10088917 3300010375 Bacteria 3406
78 Ga0105239_10169927 3300010375 Bacteria 2437
79 Ga0157374_10092708 3300013296 Bacteria 2883
80 Ga0157374_10523930 3300013296 Bacteria 1191
81 Ga0163162_10144933 3300013306 Bacteria 2490
82 Ga0163162_10331131 3300013306 Bacteria 1655
83 Ga0163163_10341325 3300014325 Bacteria 1553
84 Ga0157380_10045169 3300014326 Bacteria 3456
85 Ga0182008_10023306 3300014497 Bacteria 3164
86 Ga0157379_10033786 3300014968 Bacteria 4562
87 Ga0157379_10202350 3300014968 Bacteria 1796
88 Ga0157376_10082169 3300014969 Bacteria 2768
89 Ga0157376_10395163 3300014969 Bacteria 1335
90 Ga0163161_10057300 3300017792 Bacteria 2831
91 Ga0207642_10080763 3300025899 Bacteria 1578
92 Ga0207688_10003146 3300025901 Bacteria 9002
93 Ga0207680_10087383 3300025903 Bacteria 1974
94 Ga0207699_10108624 3300025906 Bacteria 1774
95 Ga0207643_10013114 3300025908 Bacteria 4484
96 Ga0207671_10298768 3300025914 Bacteria 1272
97 Ga0207693_10256636 3300025915 Bacteria 1371
98 Ga0207693_10330835 3300025915 Bacteria 1193
99 Ga0207663_10056845 3300025916 Bacteria 2463
100 Ga0207662_10013455 3300025918 Bacteria 4577
101 Ga0207657_10047473 3300025919 Bacteria 3754
102 Ga0207681_10200022 3300025923 Bacteria 1534
103 Ga0207650_10093585 3300025925 Bacteria 2301
104 Ga0207659_10012080 3300025926 Bacteria 5476
105 Ga0207659_10194792 3300025926 Bacteria 1615
106 Ga0207687_10008252 3300025927 Bacteria 6813
107 Ga0207687_10179734 3300025927 Bacteria 1638
108 Ga0207700_10378837 3300025928 Bacteria 1237
109 Ga0207664_10024052 3300025929 Bacteria 4574
110 Ga0207644_10016447 3300025931 Bacteria 4977
111 Ga0207644_10024425 3300025931 Bacteria 4149
112 Ga0207709_10085562 3300025935 Bacteria 2045
113 Ga0207670_10103043 3300025936 Bacteria 2041
114 Ga0207670_10172243 3300025936 Bacteria 1624
115 Ga0207669_10036794 3300025937 Bacteria 2801
116 Ga0207691_10121820 3300025940 Bacteria 2311
117 Ga0207711_10025629 3300025941 Bacteria 4946
118 Ga0207711_10182985 3300025941 Bacteria 1907
119 Ga0207689_10008519 3300025942 Bacteria 8941
120 Ga0207651_10010000 3300025960 Bacteria 5230
121 Ga0207651_10084399 3300025960 Bacteria 2300
122 Ga0207712_10009565 3300025961 Bacteria 6137
123 Ga0207668_10013912 3300025972 Bacteria 4969
124 Ga0207640_10076067 3300025981 Bacteria 2277
125 Ga0207677_10012206 3300026023 Bacteria 4929
126 Ga0207703_10003716 3300026035 Bacteria 12702
127 Ga0207678_10027928 3300026067 Bacteria 4926
128 Ga0207708_10002015 3300026075 Bacteria 14967
129 Ga0207702_10172352 3300026078 Bacteria 1985
130 Ga0207702_10265753 3300026078 Bacteria 1617
131 Ga0207641_10031874 3300026088 Bacteria 4373
132 Ga0207648_10003124 3300026089 Bacteria 17485
133 Ga0207676_10031926 3300026095 Bacteria 3963
134 Ga0207674_10048193 3300026116 Bacteria 4361
135 Ga0207683_10044638 3300026121 Bacteria 3875
136 Ga0207428_10063820 3300027907 Bacteria 2909
137 Ga0268266_10133583 3300028379 Bacteria 2221
138 Ga0268265_10014611 3300028380 Bacteria 5353
139 Ga0268264_10005989 3300028381 Bacteria 10296
140 Ga0265328_10000068 3300031239 Bacteria 55710
141 Ga0265325_10000126 3300031241 Bacteria 52410
142 Ga0265331_10000663 3300031250 Bacteria 29709
143 Ga0265316_10000360 3300031344 Bacteria 51420
144 Ga0265316_10302586 3300031344 Bacteria 1165
145 Ga0316575_10023199 3300031665 Bacteria 2397
146 Ga0316583_10000161 3300032133 Bacteria 16491
147 Ga0373928_0018942 3300035084 Bacteria 1432
148 Ga0373936_0127887 3300035113 Bacteria 1090
149 Ga0373953_0024683 3300035117 Bacteria 2288
150 Ga0373954_0015158 3300035118 Bacteria 3444
151 Ga0373943_0089258 3300035170 Bacteria 1594
152 Ga0373943_0156340 3300035170 Bacteria 1238
153 Ga0373946_0084978 3300035171 Bacteria 1393
154 Ga0373955_0008342 3300035172 Bacteria 4809
155 Ga0373942_0020068 3300035207 Bacteria 1675
156 Ga0316574_0006573 3300035398 Bacteria 6295
157 Ga0373924_0016245 3300035410 Bacteria 2840
158 Ga0373931_0004468 3300035691 Bacteria 6393
159 Ga0373935_0106050 3300035692 Bacteria 1859
160 Ga0373927_0031224 3300035695 Bacteria 3473
161 Ga0373927_0061267 3300035695 Bacteria 2434
162 Ga0373927_0213735 3300035695 Bacteria 1267
163 Ga0373933_0004334 3300035724 Bacteria 7791
164 Ga0373937_0000536 3300036401 Bacteria 33682
165 Ga0316584_0023460 3300036712 Bacteria 4507
166 Ga0373925_0010949 3300037068 Bacteria 6583
167 Ga0373925_0464594 3300037068 Bacteria 1037
168 Ga0395898_0044004 3300037466 Bacteria 4398
169 Ga0395905_0397884 3300037471 Bacteria 1272
170 Ga0436364_0086911 3300037853 Bacteria 1583
171 Ga0436364_0934985 3300037853 Bacteria 2733
172 Ga0436365_1661817 3300039437 Bacteria 17480
173 Ga0451576_0011897 3300045051 Bacteria 9840
174 Ga0495592_0010281 3300046454 Bacteria 7055
175 Ga0495629_0004372 3300046459 Bacteria 10587
176 Ga0495629_0247111 3300046459 Bacteria 1228
177 Ga0495651_0000345 3300046462 Bacteria 35927
178 Ga0495653_0003080 3300046463 Bacteria 13372
179 Ga0495662_0110331 3300046476 Bacteria 1348
180 Ga0495664_0018103 3300046477 Bacteria 4030
181 Ga0495596_0133106 3300046500 Bacteria 965
182 Ga0495608_0002576 3300046511 Bacteria 13014
183 Ga0495630_0082027 3300046517 Bacteria 2434
184 Ga0495666_0084179 3300046526 Bacteria 1503
185 Ga0495652_0009652 3300046529 Bacteria 8762
186 Ga0495640_0002133 3300046533 Bacteria 15793
187 Ga0495640_0005056 3300046533 Bacteria 10469
188 Ga0495587_0002815 3300046536 Bacteria 11642
189 Ga0495634_0055730 3300046642 Bacteria 2643
190 Ga0495635_0004267 3300046663 Bacteria 9898
191 Ga0495657_0076196 3300046675 Bacteria 2179
192 Ga0495599_0005518 3300046678 Bacteria 7576
193 Ga0495623_0005285 3300046679 Bacteria 8461
194 Ga0495613_0049136 3300046689 Bacteria 3114
195 Ga0495624_0186394 3300046690 Bacteria 1263
196 Ga0495600_0004628 3300046809 Bacteria 8244
197 Ga0495581_0034075 3300047315 Bacteria 2946
198 Ga0495604_0000290 3300047317 Bacteria 44834
199 Ga0495604_0194902 3300047317 Bacteria 1409
200 Ga0495674_0007413 3300047319 Bacteria 10482
201 Ga0495676_0122347 3300047321 Bacteria 1891
202 Ga0495680_0000891 3300047322 Bacteria 33200
203 Ga0495675_0009396 3300047444 Bacteria 6083
204 Ga0495685_097984 3300047447 Bacteria 969
205 Ga0495684_0074494 3300047471 Bacteria 2579
206 Ga0495602_0016399 3300048088 Bacteria 7450
207 Ga0496100_0001161 3300048903 Bacteria 12807
208 Ga0496100_0004954 3300048903 Bacteria 7118
209 Ga0496100_0068743 3300048903 Bacteria 2357
210 Ga0496101_0002673 3300048904 Bacteria 10941
211 Ga0496101_0050848 3300048904 Bacteria 2985
212 Ga0496101_0080423 3300048904 Bacteria 2407
213 Ga0496101_0321364 3300048904 Bacteria 1214
214 Ga0496102_0009278 3300048905 Bacteria 8442
215 Ga0496102_0017017 3300048905 Bacteria 6363
216 Ga0496103_0001608 3300048906 Bacteria 14839
217 Ga0496104_0003787 3300048907 Bacteria 13088
218 Ga0496104_0003981 3300048907 Bacteria 12794
219 Ga0496104_0124292 3300048907 Bacteria 2477
220 Ga0496104_0150718 3300048907 Bacteria 2232
221 Ga0496104_0274978 3300048907 Bacteria 1597
222 Ga0496104_0283403 3300048907 Bacteria 1570
223 Ga0496105_0008839 3300048908 Bacteria 7846
224 Ga0496106_0004342 3300048909 Bacteria 10529
225 Ga0496106_0011796 3300048909 Bacteria 6450
226 Ga0496106_0183837 3300048909 Bacteria 1660
227 Ga0496106_0343158 3300048909 Bacteria 1199
228 Ga0496107_0000646 3300048910 Bacteria 19609
229 Ga0496107_0006231 3300048910 Bacteria 8201
230 Ga0496108_0006940 3300048911 Bacteria 9168
231 Ga0496108_0010675 3300048911 Bacteria 7452
232 Ga0496108_0143881 3300048911 Bacteria 2055
233 Ga0496109_0024181 3300048912 Bacteria 5398
234 Ga0496109_0159504 3300048912 Bacteria 2113
235 Ga0496109_0255483 3300048912 Bacteria 1650
236 Ga0496109_0268758 3300048912 Bacteria 1606
237 Ga0496110_0009571 3300048913 Bacteria 7840
238 Ga0496110_0010675 3300048913 Bacteria 7479
239 Ga0496110_0206259 3300048913 Bacteria 1786
240 Ga0496111_0005191 3300048914 Bacteria 8304
241 Ga0496111_0010028 3300048914 Bacteria 6338
242 Ga0496111_0190248 3300048914 Bacteria 1526
243 Ga0496112_0002515 3300048915 Bacteria 14801
244 Ga0496112_0004013 3300048915 Bacteria 12340
245 Ga0496112_0030863 3300048915 Bacteria 5192
246 Ga0496112_0059656 3300048915 Bacteria 3760
247 Ga0496112_0600167 3300048915 Bacteria 1033
248 Ga0496113_0000682 3300048916 Bacteria 17292
249 Ga0496113_0036499 3300048916 Bacteria 3602
250 Ga0496114_0002405 3300048917 Bacteria 14267
251 Ga0496114_0022492 3300048917 Bacteria 5139
252 Ga0496114_0153478 3300048917 Bacteria 1998
253 Ga0496114_0183341 3300048917 Bacteria 1828
254 Ga0496114_0431269 3300048917 Bacteria 1168
255 Ga0496115_0001413 3300048918 Bacteria 17185
256 Ga0496115_0005844 3300048918 Bacteria 8963
257 Ga0496115_0171904 3300048918 Bacteria 1792
258 Ga0496115_0444287 3300048918 Bacteria 1048
259 Ga0496122_0002111 3300048925 Bacteria 29441
260 Ga0496123_0000686 3300048926 Bacteria 55793
261 Ga0501034_0085139 3300049571 Bacteria 3163
262 Ga0501034_0254056 3300049571 Bacteria 1702
263 Ga0501034_0343246 3300049571 Bacteria 1423
264 Ga0501038_0037029 3300049574 Bacteria 4280
265 Ga0501046_0288697 3300049580 Bacteria 1200
266 Ga0501046_0359512 3300049580 Bacteria 1056
267 Ga0501047_0025977 3300049581 Bacteria 5631
268 Ga0501070_0022772 3300049586 Bacteria 5244
269 Ga0501071_0069233 3300049587 Bacteria 2569
270 Ga0501075_0029576 3300049591 Bacteria 4052
271 Ga0501075_0142426 3300049591 Bacteria 1827
272 Ga0501075_0379242 3300049591 Bacteria 1078
273 Ga0501076_0018369 3300049592 Bacteria 5330
274 Ga0501077_0045914 3300049593 Bacteria 2775
275 Ga0501079_0004859 3300049741 Bacteria 9957
276 Ga0501080_0038410 3300049742 Bacteria 4470
277 Ga0501081_0022148 3300049743 Bacteria 4249
278 Ga0501081_0223598 3300049743 Bacteria 1369
279 Ga0501081_0263436 3300049743 Bacteria 1260
280 Ga0501083_0145392 3300049744 Bacteria 1552
281 Ga0501044_0016036 3300049823 Bacteria 8058
282 Ga0501045_0191078 3300049824 Bacteria 1526
283 Ga0501045_0321581 3300049824 Bacteria 1151
284 nmdc:mga03n38_69411_c1 3300050490 Bacteria 1627
285 nmdc:mga00v17_87957_c1 3300050491 Bacteria 1947
286 nmdc:mga0yw44_13887_c1 3300050492 Bacteria 4257
287 nmdc:mga0yw44_142599_c1 3300050492 Bacteria 1558
288 nmdc:mga0yw44_26235_c1 3300050492 Bacteria 3326
289 nmdc:mga04h51_15391_c1 3300050495 Bacteria 2203
290 nmdc:mga05p37_96432_c1 3300050507 Bacteria 3644
291 nmdc:mga09592_222944_c1 3300050508 Bacteria 1633
292 nmdc:mga09592_393998_c1 3300050508 Bacteria 1197
293 nmdc:mga0qj67_104381_c1 3300050509 Bacteria 2286
294 nmdc:mga0qj67_275760_c1 3300050509 Bacteria 1363
295 nmdc:mga06r32_114137_c1 3300050510 Bacteria 2659
296 nmdc:mga06r32_88292_c1 3300050510 Bacteria 3026
297 nmdc:mga08y16_361509_c1 3300050511 Bacteria 1490
298 nmdc:mga08y16_51194_c1 3300050511 Bacteria 4320
299 nmdc:mga0n895_32029_c1 3300050512 Bacteria 5041
300 nmdc:mga0rr50_20117_c1 3300050513 Bacteria 4523
301 nmdc:mga0rr50_458728_c1 3300050513 Bacteria 1081
302 nmdc:mga08x19_4_c1 3300050514 Bacteria 335979
303 nmdc:mga0a205_4522_c1 3300050515 Bacteria 12484
304 Ga0495601_0008707 3300053077 Bacteria 5989
305 Ga0495601_0106433 3300053077 Bacteria 1814
306 Ga0495612_0008324 3300053078 Bacteria 4209
307 Ga0495595_0000485 3300053084 Bacteria 15138
308 Ga0495619_0002882 3300053085 Bacteria 11180
309 Ga0495619_0131598 3300053085 Bacteria 1719
310 Ga0500627_0008201 3300053158 Bacteria 3695
311 Ga0501084_0005290 3300054114 Bacteria 10562
312 Ga0501084_0015408 3300054114 Bacteria 6338
313 Ga0501084_0179012 3300054114 Bacteria 1790
314 Ga0501084_0305309 3300054114 Bacteria 1344
315 Ga0501082_0025629 3300060353 Bacteria 5081
316 Ga0501082_0165613 3300060353 Bacteria 1921
317 Ga0501082_0313535 3300060353 Bacteria 1366
318 Ga0501082_0374777 3300060353 Bacteria 1242
319 Ga0530510_0183192 3300061734 Bacteria 1553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025928 Ga0207700_10378837 Ga0207700_103788371 278
2 3300048907 Ga0496104_0274978 Ga0496104_0274978_575_1426 278
3 3300006847 Ga0075431_100087511 Ga0075431_1000875114 279
4 3300050509 nmdc:mga0qj67_275760_c1 nmdc:mga0qj67_275760_c1_297_1151 279
5 3300005843 Ga0068860_100399460 Ga0068860_1003994602 280
6 3300006846 Ga0075430_100313764 Ga0075430_1003137642 280
7 3300014497 Ga0182008_10023306 Ga0182008_100233063 280
8 3300031241 Ga0265325_10000126 Ga0265325_1000012614 280
9 3300005340 Ga0070689_100025425 Ga0070689_1000254253 281
10 3300005355 Ga0070671_100004428 Ga0070671_1000044289 281
11 3300005364 Ga0070673_100009813 Ga0070673_1000098135 281
12 3300005367 Ga0070667_100258646 Ga0070667_1002586462 281
13 3300005436 Ga0070713_100238023 Ga0070713_1002380232 281
14 3300005439 Ga0070711_100005538 Ga0070711_1000055388 281
15 3300005457 Ga0070662_100070538 Ga0070662_1000705383 281
16 3300005545 Ga0070695_100309121 Ga0070695_1003091211 281
17 3300005842 Ga0068858_100199407 Ga0068858_1001994072 281
18 3300005983 Ga0081540_1121374 Ga0081540_11213741 281
19 3300006028 Ga0070717_10194310 Ga0070717_101943102 281
20 3300006852 Ga0075433_10023658 Ga0075433_100236582 281
21 3300009094 Ga0111539_10172694 Ga0111539_101726942 281
22 3300009098 Ga0105245_10244576 Ga0105245_102445762 281
23 3300009148 Ga0105243_10395545 Ga0105243_103955452 281
24 3300010375 Ga0105239_10169927 Ga0105239_101699272 281
25 3300014968 Ga0157379_10202350 Ga0157379_102023502 281
26 3300025906 Ga0207699_10108624 Ga0207699_101086242 281
27 3300025915 Ga0207693_10330835 Ga0207693_103308352 281
28 3300025923 Ga0207681_10200022 Ga0207681_102000222 281
29 3300025925 Ga0207650_10093585 Ga0207650_100935852 281
30 3300025926 Ga0207659_10194792 Ga0207659_101947922 281
31 3300025927 Ga0207687_10179734 Ga0207687_101797342 281
32 3300025931 Ga0207644_10016447 Ga0207644_100164476 281
33 3300025936 Ga0207670_10172243 Ga0207670_101722432 281
34 3300025960 Ga0207651_10084399 Ga0207651_100843993 281
35 3300026078 Ga0207702_10265753 Ga0207702_102657532 281
36 3300032133 Ga0316583_10000161 Ga0316583_100001614 281
37 3300035695 Ga0373927_0213735 Ga0373927_0213735_182_1051 281
38 3300037853 Ga0436364_0086911 Ga0436364_0086911_140_991 281
39 3300048907 Ga0496104_0283403 Ga0496104_0283403_267_1139 281
40 3300048909 Ga0496106_0183837 Ga0496106_0183837_498_1391 281
41 3300048911 Ga0496108_0143881 Ga0496108_0143881_724_1617 281
42 3300048912 Ga0496109_0159504 Ga0496109_0159504_685_1578 281
43 3300048913 Ga0496110_0206259 Ga0496110_0206259_373_1266 281
44 3300048914 Ga0496111_0190248 Ga0496111_0190248_442_1335 281
45 3300048915 Ga0496112_0002515 Ga0496112_0002515_8144_9037 281
46 3300048915 Ga0496112_0059656 Ga0496112_0059656_316_1188 281
47 3300048916 Ga0496113_0036499 Ga0496113_0036499_2073_2966 281
48 3300048918 Ga0496115_0171904 Ga0496115_0171904_216_1088 281
49 3300048925 Ga0496122_0002111 Ga0496122_0002111_1872_2723 281
50 3300048926 Ga0496123_0000686 Ga0496123_0000686_27405_28256 281
51 3300049571 Ga0501034_0085139 Ga0501034_0085139_351_1208 281
52 3300049571 Ga0501034_0254056 Ga0501034_0254056_492_1352 281
53 3300049571 Ga0501034_0343246 Ga0501034_0343246_12_872 281
54 3300049574 Ga0501038_0037029 Ga0501038_0037029_981_1841 281
55 3300049581 Ga0501047_0025977 Ga0501047_0025977_1206_2066 281
56 3300049586 Ga0501070_0022772 Ga0501070_0022772_3832_4692 281
57 3300049742 Ga0501080_0038410 Ga0501080_0038410_1231_2091 281
58 3300049744 Ga0501083_0145392 Ga0501083_0145392_333_1193 281
59 3300049823 Ga0501044_0016036 Ga0501044_0016036_5241_6101 281
60 3300049824 Ga0501045_0321581 Ga0501045_0321581_236_1096 281
61 3300050509 nmdc:mga0qj67_104381_c1 nmdc:mga0qj67_104381_c1_68_922 281
62 3300050510 nmdc:mga06r32_114137_c1 nmdc:mga06r32_114137_c1_188_1051 281
63 3300050513 nmdc:mga0rr50_458728_c1 nmdc:mga0rr50_458728_c1_17_874 281
64 3300050515 nmdc:mga0a205_4522_c1 nmdc:mga0a205_4522_c1_10672_11727 281
65 3300054114 Ga0501084_0179012 Ga0501084_0179012_68_928 281
66 3300060353 Ga0501082_0313535 Ga0501082_0313535_318_1184 281
67 3300003323 rootH1_10202325 rootH1_102023252 282
68 3300005329 Ga0070683_100055001 Ga0070683_1000550014 282
69 3300005331 Ga0070670_100100857 Ga0070670_1001008571 282
70 3300005334 Ga0068869_100025858 Ga0068869_1000258584 282
71 3300005337 Ga0070682_100245414 Ga0070682_1002454142 282
72 3300005338 Ga0068868_100016122 Ga0068868_1000161226 282
73 3300005339 Ga0070660_100077157 Ga0070660_1000771572 282
74 3300005343 Ga0070687_100066683 Ga0070687_1000666832 282
75 3300005345 Ga0070692_10116041 Ga0070692_101160412 282
76 3300005347 Ga0070668_100150506 Ga0070668_1001505062 282
77 3300005356 Ga0070674_100097094 Ga0070674_1000970941 282
78 3300005365 Ga0070688_100013506 Ga0070688_1000135064 282
79 3300005365 Ga0070688_100219558 Ga0070688_1002195581 282
80 3300005365 Ga0070688_100237871 Ga0070688_1002378711 282
81 3300005367 Ga0070667_100051439 Ga0070667_1000514392 282
82 3300005437 Ga0070710_10126724 Ga0070710_101267242 282
83 3300005455 Ga0070663_100044433 Ga0070663_1000444332 282
84 3300005457 Ga0070662_100045725 Ga0070662_1000457252 282
85 3300005536 Ga0070697_100000548 Ga0070697_10000054822 282
86 3300005543 Ga0070672_100074762 Ga0070672_1000747623 282
87 3300005544 Ga0070686_100009747 Ga0070686_1000097473 282
88 3300005545 Ga0070695_100075643 Ga0070695_1000756431 282
89 3300005548 Ga0070665_100154264 Ga0070665_1001542643 282
90 3300005548 Ga0070665_100340080 Ga0070665_1003400802 282
91 3300005615 Ga0070702_100061081 Ga0070702_1000610812 282
92 3300005618 Ga0068864_100005554 Ga0068864_1000055548 282
93 3300005718 Ga0068866_10189590 Ga0068866_101895902 282
94 3300005719 Ga0068861_100049567 Ga0068861_1000495672 282
95 3300005840 Ga0068870_10004231 Ga0068870_100042313 282
96 3300005841 Ga0068863_100044870 Ga0068863_1000448704 282
97 3300005842 Ga0068858_100044217 Ga0068858_1000442174 282
98 3300005843 Ga0068860_100061019 Ga0068860_1000610193 282
99 3300005844 Ga0068862_100050939 Ga0068862_1000509392 282
100 3300005937 Ga0081455_10018235 Ga0081455_100182356 282
101 3300005937 Ga0081455_10039883 Ga0081455_100398832 282
102 3300005981 Ga0081538_10060587 Ga0081538_100605873 282
103 3300005983 Ga0081540_1000766 Ga0081540_100076621 282
104 3300005985 Ga0081539_10045501 Ga0081539_100455012 282
105 3300006028 Ga0070717_10033537 Ga0070717_100335373 282
106 3300006038 Ga0075365_10076550 Ga0075365_100765502 282
107 3300006048 Ga0075363_100004062 Ga0075363_1000040624 282
108 3300006175 Ga0070712_100218366 Ga0070712_1002183662 282
109 3300006178 Ga0075367_10084619 Ga0075367_100846192 282
110 3300006195 Ga0075366_10020715 Ga0075366_100207153 282
111 3300006358 Ga0068871_100032808 Ga0068871_1000328083 282
112 3300006844 Ga0075428_100075012 Ga0075428_1000750123 282
113 3300006880 Ga0075429_100143178 Ga0075429_1001431782 282
114 3300006880 Ga0075429_100364631 Ga0075429_1003646312 282
115 3300006881 Ga0068865_100105027 Ga0068865_1001050272 282
116 3300006914 Ga0075436_100001204 Ga0075436_1000012047 282
117 3300007788 Ga0099795_10000284 Ga0099795_100002847 282
118 3300009094 Ga0111539_10584099 Ga0111539_105840992 282
119 3300009147 Ga0114129_10413590 Ga0114129_104135902 282
120 3300009148 Ga0105243_10042474 Ga0105243_100424743 282
121 3300009177 Ga0105248_10036278 Ga0105248_100362786 282
122 3300009177 Ga0105248_10143738 Ga0105248_101437382 282
123 3300009545 Ga0105237_10083778 Ga0105237_100837782 282
124 3300009553 Ga0105249_10310959 Ga0105249_103109592 282
125 3300010375 Ga0105239_10088917 Ga0105239_100889173 282
126 3300013296 Ga0157374_10092708 Ga0157374_100927083 282
127 3300013296 Ga0157374_10523930 Ga0157374_105239302 282
128 3300013306 Ga0163162_10144933 Ga0163162_101449332 282
129 3300013306 Ga0163162_10331131 Ga0163162_103311312 282
130 3300014325 Ga0163163_10341325 Ga0163163_103413253 282
131 3300014326 Ga0157380_10045169 Ga0157380_100451694 282
132 3300014968 Ga0157379_10033786 Ga0157379_100337861 282
133 3300014969 Ga0157376_10082169 Ga0157376_100821692 282
134 3300014969 Ga0157376_10395163 Ga0157376_103951632 282
135 3300017792 Ga0163161_10057300 Ga0163161_100573002 282
136 3300025899 Ga0207642_10080763 Ga0207642_100807633 282
137 3300025901 Ga0207688_10003146 Ga0207688_100031469 282
138 3300025903 Ga0207680_10087383 Ga0207680_100873832 282
139 3300025908 Ga0207643_10013114 Ga0207643_100131143 282
140 3300025914 Ga0207671_10298768 Ga0207671_102987681 282
141 3300025915 Ga0207693_10256636 Ga0207693_102566362 282
142 3300025916 Ga0207663_10056845 Ga0207663_100568452 282
143 3300025918 Ga0207662_10013455 Ga0207662_100134553 282
144 3300025919 Ga0207657_10047473 Ga0207657_100474734 282
145 3300025926 Ga0207659_10012080 Ga0207659_100120802 282
146 3300025927 Ga0207687_10008252 Ga0207687_100082525 282
147 3300025929 Ga0207664_10024052 Ga0207664_100240524 282
148 3300025931 Ga0207644_10024425 Ga0207644_100244252 282
149 3300025935 Ga0207709_10085562 Ga0207709_100855622 282
150 3300025936 Ga0207670_10103043 Ga0207670_101030432 282
151 3300025937 Ga0207669_10036794 Ga0207669_100367943 282
152 3300025940 Ga0207691_10121820 Ga0207691_101218202 282
153 3300025941 Ga0207711_10025629 Ga0207711_100256293 282
154 3300025941 Ga0207711_10182985 Ga0207711_101829852 282
155 3300025942 Ga0207689_10008519 Ga0207689_100085192 282
156 3300025960 Ga0207651_10010000 Ga0207651_100100002 282
157 3300025961 Ga0207712_10009565 Ga0207712_100095653 282
158 3300025972 Ga0207668_10013912 Ga0207668_100139123 282
159 3300025981 Ga0207640_10076067 Ga0207640_100760673 282
160 3300026023 Ga0207677_10012206 Ga0207677_100122064 282
161 3300026035 Ga0207703_10003716 Ga0207703_100037169 282
162 3300026067 Ga0207678_10027928 Ga0207678_100279284 282
163 3300026075 Ga0207708_10002015 Ga0207708_100020156 282
164 3300026078 Ga0207702_10172352 Ga0207702_101723523 282
165 3300026088 Ga0207641_10031874 Ga0207641_100318744 282
166 3300026089 Ga0207648_10003124 Ga0207648_100031246 282
167 3300026095 Ga0207676_10031926 Ga0207676_100319261 282
168 3300026116 Ga0207674_10048193 Ga0207674_100481933 282
169 3300026121 Ga0207683_10044638 Ga0207683_100446384 282
170 3300027907 Ga0207428_10063820 Ga0207428_100638201 282
171 3300028379 Ga0268266_10133583 Ga0268266_101335832 282
172 3300028380 Ga0268265_10014611 Ga0268265_100146116 282
173 3300028381 Ga0268264_10005989 Ga0268264_100059899 282
174 3300031239 Ga0265328_10000068 Ga0265328_1000006836 282
175 3300031250 Ga0265331_10000663 Ga0265331_100006639 282
176 3300031344 Ga0265316_10000360 Ga0265316_1000036023 282
177 3300031344 Ga0265316_10302586 Ga0265316_103025862 282
178 3300031665 Ga0316575_10023199 Ga0316575_100231992 282
179 3300035084 Ga0373928_0018942 Ga0373928_0018942_444_1313 282
180 3300035113 Ga0373936_0127887 Ga0373936_0127887_82_960 282
181 3300035117 Ga0373953_0024683 Ga0373953_0024683_991_1869 282
182 3300035118 Ga0373954_0015158 Ga0373954_0015158_2422_3300 282
183 3300035170 Ga0373943_0089258 Ga0373943_0089258_702_1580 282
184 3300035170 Ga0373943_0156340 Ga0373943_0156340_242_1108 282
185 3300035171 Ga0373946_0084978 Ga0373946_0084978_286_1161 282
186 3300035172 Ga0373955_0008342 Ga0373955_0008342_2111_2989 282
187 3300035207 Ga0373942_0020068 Ga0373942_0020068_573_1433 282
188 3300035398 Ga0316574_0006573 Ga0316574_0006573_4125_5105 282
189 3300035410 Ga0373924_0016245 Ga0373924_0016245_226_1104 282
190 3300035691 Ga0373931_0004468 Ga0373931_0004468_3639_4499 282
191 3300035692 Ga0373935_0106050 Ga0373935_0106050_162_1040 282
192 3300035695 Ga0373927_0031224 Ga0373927_0031224_2572_3450 282
193 3300035695 Ga0373927_0061267 Ga0373927_0061267_970_1836 282
194 3300035724 Ga0373933_0004334 Ga0373933_0004334_2245_3123 282
195 3300036401 Ga0373937_0000536 Ga0373937_0000536_7368_8246 282
196 3300036712 Ga0316584_0023460 Ga0316584_0023460_3210_4190 282
197 3300037068 Ga0373925_0010949 Ga0373925_0010949_435_1310 282
198 3300037068 Ga0373925_0464594 Ga0373925_0464594_49_909 282
199 3300037466 Ga0395898_0044004 Ga0395898_0044004_2246_3103 282
200 3300037471 Ga0395905_0397884 Ga0395905_0397884_390_1247 282
201 3300037853 Ga0436364_0934985 Ga0436364_0934985_1113_1985 282
202 3300039437 Ga0436365_1661817 Ga0436365_1661817_9446_10363 282
203 3300045051 Ga0451576_0011897 Ga0451576_0011897_1646_2503 282
204 3300046454 Ga0495592_0010281 Ga0495592_0010281_1757_2635 282
205 3300046459 Ga0495629_0004372 Ga0495629_0004372_1228_2106 282
206 3300046459 Ga0495629_0247111 Ga0495629_0247111_335_1210 282
207 3300046462 Ga0495651_0000345 Ga0495651_0000345_34307_35185 282
208 3300046463 Ga0495653_0003080 Ga0495653_0003080_514_1392 282
209 3300046476 Ga0495662_0110331 Ga0495662_0110331_226_1104 282
210 3300046477 Ga0495664_0018103 Ga0495664_0018103_2000_2878 282
211 3300046500 Ga0495596_0133106 Ga0495596_0133106_79_936 282
212 3300046511 Ga0495608_0002576 Ga0495608_0002576_5791_6669 282
213 3300046517 Ga0495630_0082027 Ga0495630_0082027_941_1819 282
214 3300046526 Ga0495666_0084179 Ga0495666_0084179_489_1346 282
215 3300046529 Ga0495652_0009652 Ga0495652_0009652_6514_7392 282
216 3300046533 Ga0495640_0002133 Ga0495640_0002133_1011_1889 282
217 3300046533 Ga0495640_0005056 Ga0495640_0005056_5341_6216 282
218 3300046536 Ga0495587_0002815 Ga0495587_0002815_3424_4302 282
219 3300046642 Ga0495634_0055730 Ga0495634_0055730_1451_2308 282
220 3300046663 Ga0495635_0004267 Ga0495635_0004267_2389_3267 282
221 3300046675 Ga0495657_0076196 Ga0495657_0076196_742_1620 282
222 3300046678 Ga0495599_0005518 Ga0495599_0005518_6347_7225 282
223 3300046679 Ga0495623_0005285 Ga0495623_0005285_2274_3152 282
224 3300046689 Ga0495613_0049136 Ga0495613_0049136_226_1104 282
225 3300046690 Ga0495624_0186394 Ga0495624_0186394_196_1071 282
226 3300046809 Ga0495600_0004628 Ga0495600_0004628_6230_7108 282
227 3300047315 Ga0495581_0034075 Ga0495581_0034075_665_1543 282
228 3300047317 Ga0495604_0000290 Ga0495604_0000290_6513_7391 282
229 3300047317 Ga0495604_0194902 Ga0495604_0194902_412_1272 282
230 3300047319 Ga0495674_0007413 Ga0495674_0007413_2708_3586 282
231 3300047321 Ga0495676_0122347 Ga0495676_0122347_984_1862 282
232 3300047322 Ga0495680_0000891 Ga0495680_0000891_6331_7209 282
233 3300047444 Ga0495675_0009396 Ga0495675_0009396_3916_4794 282
234 3300047447 Ga0495685_097984 Ga0495685_097984_25_882 282
235 3300047471 Ga0495684_0074494 Ga0495684_0074494_420_1298 282
236 3300048088 Ga0495602_0016399 Ga0495602_0016399_60_938 282
237 3300048903 Ga0496100_0001161 Ga0496100_0001161_10951_11808 282
238 3300048903 Ga0496100_0004954 Ga0496100_0004954_3659_4519 282
239 3300048903 Ga0496100_0068743 Ga0496100_0068743_1381_2238 282
240 3300048904 Ga0496101_0002673 Ga0496101_0002673_6066_6926 282
241 3300048904 Ga0496101_0050848 Ga0496101_0050848_1522_2391 282
242 3300048904 Ga0496101_0080423 Ga0496101_0080423_1088_1945 282
243 3300048904 Ga0496101_0321364 Ga0496101_0321364_37_894 282
244 3300048905 Ga0496102_0009278 Ga0496102_0009278_3278_4135 282
245 3300048905 Ga0496102_0017017 Ga0496102_0017017_1454_2314 282
246 3300048906 Ga0496103_0001608 Ga0496103_0001608_3796_4653 282
247 3300048907 Ga0496104_0003787 Ga0496104_0003787_7004_7864 282
248 3300048907 Ga0496104_0003981 Ga0496104_0003981_5500_6357 282
249 3300048907 Ga0496104_0124292 Ga0496104_0124292_1099_1968 282
250 3300048907 Ga0496104_0150718 Ga0496104_0150718_232_1089 282
251 3300048908 Ga0496105_0008839 Ga0496105_0008839_2752_3609 282
252 3300048909 Ga0496106_0004342 Ga0496106_0004342_9195_10052 282
253 3300048909 Ga0496106_0011796 Ga0496106_0011796_3131_3991 282
254 3300048909 Ga0496106_0343158 Ga0496106_0343158_301_1158 282
255 3300048910 Ga0496107_0000646 Ga0496107_0000646_4319_5176 282
256 3300048910 Ga0496107_0006231 Ga0496107_0006231_3239_4099 282
257 3300048911 Ga0496108_0006940 Ga0496108_0006940_478_1335 282
258 3300048911 Ga0496108_0010675 Ga0496108_0010675_2048_2908 282
259 3300048912 Ga0496109_0024181 Ga0496109_0024181_3121_3981 282
260 3300048912 Ga0496109_0255483 Ga0496109_0255483_545_1402 282
261 3300048912 Ga0496109_0268758 Ga0496109_0268758_249_1106 282
262 3300048913 Ga0496110_0009571 Ga0496110_0009571_6625_7485 282
263 3300048913 Ga0496110_0010675 Ga0496110_0010675_3687_4544 282
264 3300048914 Ga0496111_0005191 Ga0496111_0005191_3994_4854 282
265 3300048914 Ga0496111_0010028 Ga0496111_0010028_3936_4793 282
266 3300048915 Ga0496112_0004013 Ga0496112_0004013_8092_8949 282
267 3300048915 Ga0496112_0030863 Ga0496112_0030863_4252_5112 282
268 3300048915 Ga0496112_0600167 Ga0496112_0600167_137_994 282
269 3300048916 Ga0496113_0000682 Ga0496113_0000682_12531_13388 282
270 3300048917 Ga0496114_0002405 Ga0496114_0002405_4126_4986 282
271 3300048917 Ga0496114_0022492 Ga0496114_0022492_2752_3609 282
272 3300048917 Ga0496114_0153478 Ga0496114_0153478_705_1562 282
273 3300048917 Ga0496114_0183341 Ga0496114_0183341_692_1561 282
274 3300048917 Ga0496114_0431269 Ga0496114_0431269_14_880 282
275 3300048918 Ga0496115_0001413 Ga0496115_0001413_4365_5222 282
276 3300048918 Ga0496115_0005844 Ga0496115_0005844_3730_4590 282
277 3300048918 Ga0496115_0444287 Ga0496115_0444287_96_965 282
278 3300049580 Ga0501046_0288697 Ga0501046_0288697_267_1136 282
279 3300049580 Ga0501046_0359512 Ga0501046_0359512_79_936 282
280 3300049587 Ga0501071_0069233 Ga0501071_0069233_99_968 282
281 3300049591 Ga0501075_0029576 Ga0501075_0029576_301_1155 282
282 3300049591 Ga0501075_0142426 Ga0501075_0142426_922_1791 282
283 3300049591 Ga0501075_0379242 Ga0501075_0379242_17_874 282
284 3300049592 Ga0501076_0018369 Ga0501076_0018369_958_1827 282
285 3300049593 Ga0501077_0045914 Ga0501077_0045914_281_1135 282
286 3300049741 Ga0501079_0004859 Ga0501079_0004859_6257_7111 282
287 3300049743 Ga0501081_0022148 Ga0501081_0022148_293_1147 282
288 3300049743 Ga0501081_0223598 Ga0501081_0223598_298_1155 282
289 3300049743 Ga0501081_0263436 Ga0501081_0263436_28_894 282
290 3300049824 Ga0501045_0191078 Ga0501045_0191078_413_1270 282
291 3300050490 nmdc:mga03n38_69411_c1 nmdc:mga03n38_69411_c1_242_1099 282
292 3300050491 nmdc:mga00v17_87957_c1 nmdc:mga00v17_87957_c1_905_1762 282
293 3300050492 nmdc:mga0yw44_13887_c1 nmdc:mga0yw44_13887_c1_2099_2956 282
294 3300050492 nmdc:mga0yw44_142599_c1 nmdc:mga0yw44_142599_c1_510_1367 282
295 3300050492 nmdc:mga0yw44_26235_c1 nmdc:mga0yw44_26235_c1_1142_1999 282
296 3300050495 nmdc:mga04h51_15391_c1 nmdc:mga04h51_15391_c1_1121_2014 282
297 3300050507 nmdc:mga05p37_96432_c1 nmdc:mga05p37_96432_c1_401_1258 282
298 3300050508 nmdc:mga09592_222944_c1 nmdc:mga09592_222944_c1_205_1062 282
299 3300050508 nmdc:mga09592_393998_c1 nmdc:mga09592_393998_c1_44_901 282
300 3300050510 nmdc:mga06r32_88292_c1 nmdc:mga06r32_88292_c1_510_1367 282
301 3300050511 nmdc:mga08y16_361509_c1 nmdc:mga08y16_361509_c1_348_1232 282
302 3300050511 nmdc:mga08y16_51194_c1 nmdc:mga08y16_51194_c1_182_1039 282
303 3300050512 nmdc:mga0n895_32029_c1 nmdc:mga0n895_32029_c1_1279_2142 282
304 3300050513 nmdc:mga0rr50_20117_c1 nmdc:mga0rr50_20117_c1_705_1568 282
305 3300050514 nmdc:mga08x19_4_c1 nmdc:mga08x19_4_c1_184117_184980 282
306 3300053077 Ga0495601_0008707 Ga0495601_0008707_4361_5218 282
307 3300053077 Ga0495601_0106433 Ga0495601_0106433_373_1242 282
308 3300053078 Ga0495612_0008324 Ga0495612_0008324_1147_2025 282
309 3300053084 Ga0495595_0000485 Ga0495595_0000485_7976_8854 282
310 3300053085 Ga0495619_0002882 Ga0495619_0002882_6202_7080 282
311 3300053085 Ga0495619_0131598 Ga0495619_0131598_343_1212 282
312 3300053158 Ga0500627_0008201 Ga0500627_0008201_2742_3605 282
313 3300054114 Ga0501084_0005290 Ga0501084_0005290_5553_6407 282
314 3300054114 Ga0501084_0015408 Ga0501084_0015408_3999_4868 282
315 3300054114 Ga0501084_0305309 Ga0501084_0305309_263_1120 282
316 3300060353 Ga0501082_0025629 Ga0501082_0025629_3417_4271 282
317 3300060353 Ga0501082_0165613 Ga0501082_0165613_758_1615 282
318 3300060353 Ga0501082_0374777 Ga0501082_0374777_296_1165 282
319 3300061734 Ga0530510_0183192 Ga0530510_0183192_571_1425 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

13

129

0.89

PF00581

Rhodanese

Rhodanese-like domain

156

272

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3olh-assembly1.cif.gz_A human 3-mercaptopyruvate sulfurtransferase 0.9478 8 275
5wqj-assembly1.cif.gz_A crystal structure of 3-mercaptopyruvate sulfurtransferase(3mst) in complex with compound1 0.9437 8 282
4jgt-assembly2.cif.gz_B structure and kinetic analysis of h2s production by human mercaptopyruvate sulfurtransferase 0.9437 8 277
5wqk-assembly2.cif.gz_B crystal structure of 3-mercaptopyruvate sulfurtransferase(3mst) in complex with compound1 0.9435 8 282
4jgt-assembly1.cif.gz_A structure and kinetic analysis of h2s production by human mercaptopyruvate sulfurtransferase 0.9409 9 276
ID Description Score Start End Superfamily
af_P31142_150_281_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9696 154 278 3.40.250.10
af_Q24JL3_210_336_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9669 154 277 3.40.250.10
5wqjB01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9628 8 149 3.40.250.10
af_A0A1D6KFY9_106_247_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9593 1 137 3.40.250.10
af_Q54E40_194_325_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.957 154 271 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A127EX42-F1-model_v4 Thiosulfate sulfurtransferase, A33Mdanese 0.995 4 282 GO:0004792
AF-A0A847WZY8-F1-model_v4 Sulfurtransferase 0.9914 8 187 GO:0004792
AF-A0A5P9JVS1-F1-model_v4 3-mercaptopyruvate sulfurtransferase (EC 2.8.1.2) 0.9911 7 281 GO:0004792
GO:0016784
AF-A0A537NFD8-F1-model_v4 Sulfurtransferase 0.9895 54 282 GO:0004792
AF-A0A6I1JAM3-F1-model_v4 Sulfurtransferase 0.9892 4 282 GO:0003676
GO:0004792
GO:0004813
GO:0005524
GO:0006419
GO:0006535
GO:0016765
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.99 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map