F405206

General Info

Members Datasets Scaffolds Average Seq Length
319 90 318 181

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_000656|Ga0495617_000656_14810_15403
Length 197
Sequence MLARRLSPLNILSQEAIRMTQFQLNGAMVAATMALFIAALALNEILFSYLAFAPGISWMYLPAGVRLLCTLLFGEAGALGLLLVSWLVCFTYFFPDDPVRSFAGGIMASAAPYLVYRGAQRFFGLTAALTNLSPQRLLGCAAAFSLASPLLHHLWFAIYEHKANLAHSFVVMAVGDFGGTLVVLYAAKFLLSRLPRR

Samples

Sample ID Description Type Environment
1 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
6 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
7 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
8 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
9 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
10 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
11 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
12 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
13 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
14 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
15 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
16 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
17 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
18 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
19 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
20 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
21 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
22 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
23 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
24 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
25 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
26 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
27 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
28 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
29 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
30 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
31 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
32 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
33 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
34 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
35 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
36 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
37 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
38 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
39 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
40 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
41 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
42 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
43 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
44 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
45 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
46 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
47 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
48 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
49 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
50 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
51 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
52 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
53 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
54 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
55 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
56 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
57 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
58 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
59 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
60 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
61 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
62 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
63 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
64 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
65 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
66 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
67 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
68 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
69 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
70 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
71 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
72 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
73 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
74 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
75 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
76 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
77 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
78 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
79 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
80 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
81 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
82 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
83 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
90 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 2.51
Rhizosphere 95.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1002460 3300003792 Bacteria 9751
2 Ga0055531_10000234 3300003794 Bacteria 60772
3 Ga0065714_10148715 3300005288 Bacteria 1120
4 Ga0209673_1037142 3300025273 Bacteria 1435
5 Ga0209051_1000025 3300025303 Bacteria 415397
6 Ga0209257_1000039 3300025304 Bacteria 591694
7 Ga0466957_0128045 3300044842 Bacteria 1624
8 Ga0466967_0654355 3300045976 Unclassified 1039
9 Ga0495617_000002 3300046452 Bacteria 710121
10 Ga0495617_000656 3300046452 Bacteria 17375
11 Ga0495617_016462 3300046452 Bacteria 2500
12 Ga0495617_097632 3300046452 Bacteria 956
13 Ga0495627_000174 3300046453 Bacteria 72709
14 Ga0495627_006740 3300046453 Bacteria 4470
15 Ga0495603_0005743 3300046455 Bacteria 7422
16 Ga0495603_0077115 3300046455 Bacteria 1955
17 Ga0495629_0015991 3300046459 Bacteria 5392
18 Ga0495638_0005095 3300046460 Bacteria 9845
19 Ga0495653_0167122 3300046463 Bacteria 1522
20 Ga0495650_0015295 3300046471 Bacteria 3941
21 Ga0495582_0009039 3300046473 Bacteria 5499
22 Ga0495582_0015553 3300046473 Bacteria 4178
23 Ga0495605_0000133 3300046474 Bacteria 97036
24 Ga0495605_0012360 3300046474 Bacteria 4739
25 Ga0495605_0021419 3300046474 Bacteria 3423
26 Ga0495605_0055380 3300046474 Bacteria 1916
27 Ga0495584_0000015 3300046491 Bacteria 169335
28 Ga0495584_0001068 3300046491 Bacteria 16997
29 Ga0495584_0003726 3300046491 Bacteria 8313
30 Ga0495584_0007106 3300046491 Bacteria 5849
31 Ga0495584_0007697 3300046491 Bacteria 5611
32 Ga0495584_0018042 3300046491 Bacteria 3587
33 Ga0495584_0047340 3300046491 Bacteria 2168
34 Ga0495584_0058291 3300046491 Bacteria 1942
35 Ga0495584_0059775 3300046491 Bacteria 1916
36 Ga0495584_0076054 3300046491 Bacteria 1688
37 Ga0495584_0156854 3300046491 Bacteria 1157
38 Ga0495585_0000055 3300046492 Bacteria 113899
39 Ga0495585_0000278 3300046492 Bacteria 51304
40 Ga0495585_0000434 3300046492 Bacteria 39978
41 Ga0495585_0000645 3300046492 Bacteria 32066
42 Ga0495585_0007274 3300046492 Bacteria 6795
43 Ga0495585_0009107 3300046492 Bacteria 5978
44 Ga0495585_0009879 3300046492 Bacteria 5704
45 Ga0495585_0011719 3300046492 Bacteria 5184
46 Ga0495585_0014563 3300046492 Bacteria 4579
47 Ga0495585_0033622 3300046492 Bacteria 2902
48 Ga0495585_0052289 3300046492 Bacteria 2261
49 Ga0495585_0068386 3300046492 Bacteria 1940
50 Ga0495585_0086594 3300046492 Bacteria 1692
51 Ga0495585_0120932 3300046492 Bacteria 1385
52 Ga0495594_0006217 3300046499 Bacteria 6140
53 Ga0495594_0082409 3300046499 Bacteria 1797
54 Ga0495594_0083869 3300046499 Bacteria 1781
55 Ga0495594_0134586 3300046499 Bacteria 1400
56 Ga0495596_0000384 3300046500 Bacteria 28244
57 Ga0495596_0001295 3300046500 Bacteria 14457
58 Ga0495596_0005135 3300046500 Bacteria 6232
59 Ga0495596_0007552 3300046500 Bacteria 4900
60 Ga0495596_0008516 3300046500 Bacteria 4560
61 Ga0495596_0009389 3300046500 Bacteria 4304
62 Ga0495596_0096214 3300046500 Bacteria 1149
63 Ga0495607_0003394 3300046501 Bacteria 12211
64 Ga0495607_0013723 3300046501 Bacteria 5295
65 Ga0495607_0016085 3300046501 Bacteria 4833
66 Ga0495607_0025638 3300046501 Bacteria 3665
67 Ga0495607_0086747 3300046501 Bacteria 1705
68 Ga0495607_0122384 3300046501 Bacteria 1364
69 Ga0495583_0000064 3300046506 Bacteria 192380
70 Ga0495583_0000337 3300046506 Bacteria 73928
71 Ga0495583_0000341 3300046506 Bacteria 73548
72 Ga0495583_0003060 3300046506 Bacteria 13280
73 Ga0495583_0010523 3300046506 Bacteria 5389
74 Ga0495583_0017732 3300046506 Bacteria 3771
75 Ga0495583_0020396 3300046506 Bacteria 3434
76 Ga0495583_0052036 3300046506 Bacteria 1864
77 Ga0495583_0145340 3300046506 Bacteria 985
78 Ga0495606_0006261 3300046507 Bacteria 11045
79 Ga0495606_0010934 3300046507 Bacteria 7466
80 Ga0495606_0013567 3300046507 Bacteria 6427
81 Ga0495606_0031333 3300046507 Bacteria 3699
82 Ga0495606_0111654 3300046507 Unclassified 1648
83 Ga0495616_0000139 3300046513 Bacteria 63327
84 Ga0495616_0002875 3300046513 Bacteria 11238
85 Ga0495616_0005261 3300046513 Bacteria 7986
86 Ga0495616_0007053 3300046513 Bacteria 6753
87 Ga0495616_0012658 3300046513 Bacteria 4780
88 Ga0495616_0019546 3300046513 Bacteria 3695
89 Ga0495616_0044739 3300046513 Bacteria 2244
90 Ga0495616_0152101 3300046513 Bacteria 1046
91 Ga0495620_0001276 3300046515 Bacteria 15358
92 Ga0495630_0039768 3300046517 Bacteria 3516
93 Ga0495631_0024354 3300046518 Bacteria 2794
94 Ga0495631_0029694 3300046518 Bacteria 2484
95 Ga0495631_0031587 3300046518 Bacteria 2393
96 Ga0495631_0040136 3300046518 Bacteria 2074
97 Ga0495631_0049681 3300046518 Bacteria 1835
98 Ga0495631_0054127 3300046518 Bacteria 1750
99 Ga0495632_0004588 3300046519 Bacteria 9359
100 Ga0495632_0017154 3300046519 Bacteria 4005
101 Ga0495637_0011441 3300046520 Bacteria 4265
102 Ga0495643_0001107 3300046522 Bacteria 26830
103 Ga0495643_0002104 3300046522 Bacteria 16470
104 Ga0495643_0011579 3300046522 Bacteria 5363
105 Ga0495643_0052594 3300046522 Unclassified 2186
106 Ga0495643_0066217 3300046522 Bacteria 1906
107 Ga0495643_0092882 3300046522 Bacteria 1554
108 Ga0495644_0008726 3300046523 Bacteria 3900
109 Ga0495644_0017342 3300046523 Bacteria 2753
110 Ga0495644_0032197 3300046523 Bacteria 1981
111 Ga0495644_0048631 3300046523 Bacteria 1593
112 Ga0495648_0000136 3300046524 Bacteria 87034
113 Ga0495648_0000646 3300046524 Bacteria 37146
114 Ga0495648_0025539 3300046524 Bacteria 3997
115 Ga0495648_0086229 3300046524 Bacteria 1771
116 Ga0495648_0320434 3300046524 Bacteria 719
117 Ga0495663_0001532 3300046525 Bacteria 7265
118 Ga0495663_0006683 3300046525 Bacteria 3183
119 Ga0495663_0025016 3300046525 Bacteria 1739
120 Ga0495666_0000520 3300046526 Bacteria 17135
121 Ga0495666_0002678 3300046526 Bacteria 8882
122 Ga0495666_0055803 3300046526 Bacteria 1892
123 Ga0495666_0085109 3300046526 Bacteria 1493
124 Ga0495666_0093028 3300046526 Bacteria 1422
125 Ga0495666_0377373 3300046526 Bacteria 638
126 Ga0495642_0000166 3300046528 Bacteria 38365
127 Ga0495642_0006472 3300046528 Bacteria 4493
128 Ga0495642_0008844 3300046528 Bacteria 3851
129 Ga0495642_0012776 3300046528 Bacteria 3241
130 Ga0495642_0014683 3300046528 Bacteria 3037
131 Ga0495642_0016005 3300046528 Bacteria 2920
132 Ga0495642_0074811 3300046528 Bacteria 1420
133 Ga0495642_0075905 3300046528 Bacteria 1410
134 Ga0495642_0161828 3300046528 Bacteria 970
135 Ga0495642_0217793 3300046528 Unclassified 833
136 Ga0495652_0109029 3300046529 Bacteria 2230
137 Ga0495654_0005753 3300046530 Bacteria 7140
138 Ga0495654_0086713 3300046530 Unclassified 1458
139 Ga0495665_0034937 3300046531 Bacteria 2687
140 Ga0495665_0054449 3300046531 Bacteria 2114
141 Ga0495665_0236330 3300046531 Bacteria 943
142 Ga0495586_0033588 3300046535 Bacteria 2753
143 Ga0495587_0033765 3300046536 Bacteria 3086
144 Ga0495587_0040395 3300046536 Bacteria 2789
145 Ga0495609_0008185 3300046538 Bacteria 5134
146 Ga0495609_0008862 3300046538 Bacteria 4895
147 Ga0495609_0029606 3300046538 Unclassified 2493
148 Ga0495609_0030201 3300046538 Bacteria 2466
149 Ga0495609_0330641 3300046538 Bacteria 617
150 Ga0495597_0000094 3300046542 Bacteria 78516
151 Ga0495597_0002943 3300046542 Bacteria 10335
152 Ga0495597_0003438 3300046542 Bacteria 9244
153 Ga0495597_0076327 3300046542 Bacteria 1437
154 Ga0495597_0111149 3300046542 Bacteria 1149
155 Ga0495597_0140091 3300046542 Bacteria 998
156 Ga0495645_0354144 3300046543 Unclassified 945
157 Ga0495622_0011051 3300046557 Bacteria 4167
158 Ga0495622_0063369 3300046557 Bacteria 1710
159 Ga0495633_0002861 3300046558 Bacteria 11842
160 Ga0495633_0007632 3300046558 Bacteria 6191
161 Ga0495633_0017560 3300046558 Bacteria 3655
162 Ga0495633_0017880 3300046558 Bacteria 3610
163 Ga0495633_0023720 3300046558 Bacteria 3037
164 Ga0495633_0120583 3300046558 Bacteria 1215
165 Ga0495633_0161379 3300046558 Bacteria 1034
166 Ga0495656_0002708 3300046615 Bacteria 5917
167 Ga0495656_0005687 3300046615 Bacteria 4318
168 Ga0495656_0011358 3300046615 Bacteria 3268
169 Ga0495656_0014985 3300046615 Bacteria 2917
170 Ga0495656_0183375 3300046615 Bacteria 1030
171 Ga0495656_0211699 3300046615 Bacteria 966
172 Ga0495668_0000835 3300046616 Bacteria 34975
173 Ga0495668_0004943 3300046616 Bacteria 9236
174 Ga0495668_0014053 3300046616 Bacteria 4704
175 Ga0495668_0045889 3300046616 Bacteria 2428
176 Ga0495668_0072097 3300046616 Bacteria 1898
177 Ga0495668_0086196 3300046616 Bacteria 1722
178 Ga0495668_0091131 3300046616 Bacteria 1670
179 Ga0495668_0105458 3300046616 Bacteria 1541
180 Ga0495668_0210146 3300046616 Bacteria 1065
181 Ga0495611_0006221 3300046648 Bacteria 5095
182 Ga0495611_0008602 3300046648 Bacteria 4317
183 Ga0495611_0009547 3300046648 Bacteria 4098
184 Ga0495611_0015863 3300046648 Bacteria 3219
185 Ga0495611_0063334 3300046648 Bacteria 1683
186 Ga0495611_0083811 3300046648 Bacteria 1469
187 Ga0495611_0107184 3300046648 Bacteria 1299
188 Ga0495625_0128820 3300046660 Bacteria 1715
189 Ga0495635_0304472 3300046663 Bacteria 1068
190 Ga0495635_0404608 3300046663 Bacteria 906
191 Ga0495661_0002129 3300046665 Bacteria 15518
192 Ga0495661_0011723 3300046665 Bacteria 5938
193 Ga0495661_0012225 3300046665 Bacteria 5798
194 Ga0495661_0020700 3300046665 Bacteria 4291
195 Ga0495661_0024979 3300046665 Bacteria 3866
196 Ga0495661_0026833 3300046665 Bacteria 3704
197 Ga0495661_0034058 3300046665 Bacteria 3208
198 Ga0495661_0042909 3300046665 Plasmid 2785
199 Ga0495661_0182876 3300046665 Unclassified 1109
200 Ga0495661_0281477 3300046665 Bacteria 838
201 Ga0495661_0338321 3300046665 Bacteria 744
202 Ga0495661_0407081 3300046665 Bacteria 660
203 Ga0495588_0002053 3300046674 Bacteria 8610
204 Ga0495588_0003927 3300046674 Bacteria 6521
205 Ga0495588_0009589 3300046674 Bacteria 4479
206 Ga0495588_0022905 3300046674 Bacteria 3088
207 Ga0495588_0035555 3300046674 Bacteria 2525
208 Ga0495588_0203968 3300046674 Bacteria 1044
209 Ga0495623_0010495 3300046679 Bacteria 5995
210 Ga0495669_0000077 3300046684 Bacteria 65061
211 Ga0495669_0012046 3300046684 Bacteria 3676
212 Ga0495669_0013438 3300046684 Bacteria 3488
213 Ga0495669_0048626 3300046684 Bacteria 1897
214 Ga0495669_0054714 3300046684 Bacteria 1797
215 Ga0495669_0244307 3300046684 Bacteria 862
216 Ga0495613_0036159 3300046689 Bacteria 3662
217 Ga0495613_0104043 3300046689 Bacteria 2050
218 Ga0495624_0253820 3300046690 Bacteria 1063
219 Ga0495670_0001573 3300046691 Bacteria 11157
220 Ga0495670_0006323 3300046691 Bacteria 5817
221 Ga0495670_0026415 3300046691 Bacteria 2874
222 Ga0495670_0030311 3300046691 Bacteria 2687
223 Ga0495670_0065014 3300046691 Bacteria 1838
224 Ga0495670_0082690 3300046691 Bacteria 1637
225 Ga0495670_0102278 3300046691 Bacteria 1476
226 Ga0495670_0102389 3300046691 Bacteria 1475
227 Ga0495670_0224692 3300046691 Bacteria 998
228 Ga0495670_0374657 3300046691 Unclassified 768
229 Ga0495670_0637459 3300046691 Bacteria 581
230 Ga0495671_0000192 3300046692 Bacteria 53483
231 Ga0495649_0013400 3300046694 Plasmid 4729
232 Ga0495649_0014435 3300046694 Bacteria 4528
233 Ga0495649_0017411 3300046694 Bacteria 4053
234 Ga0495649_0086030 3300046694 Unclassified 1678
235 Ga0495649_0101378 3300046694 Bacteria 1530
236 Ga0495649_0104142 3300046694 Bacteria 1507
237 Ga0495589_0003440 3300046794 Bacteria 8568
238 Ga0495589_0013430 3300046794 Bacteria 4226
239 Ga0495589_0060622 3300046794 Bacteria 1858
240 Ga0495600_0142343 3300046809 Bacteria 1555
241 Ga0495660_0000735 3300046810 Bacteria 24883
242 Ga0495660_0011659 3300046810 Bacteria 5098
243 Ga0495660_0038464 3300046810 Bacteria 2660
244 Ga0495660_0056292 3300046810 Unclassified 2125
245 Ga0495660_0458698 3300046810 Unclassified 550
246 Ga0495581_0057657 3300047315 Bacteria 2241
247 Ga0495581_0063001 3300047315 Bacteria 2142
248 Ga0495581_0118951 3300047315 Bacteria 1537
249 Ga0495604_0063227 3300047317 Bacteria 2824
250 Ga0495604_0066965 3300047317 Bacteria 2730
251 Ga0495604_0127319 3300047317 Bacteria 1834
252 Ga0495604_0316916 3300047317 Bacteria 1043
253 Ga0495636_0092899 3300047318 Bacteria 1311
254 Ga0495636_0453405 3300047318 Bacteria 616
255 Ga0495674_0105458 3300047319 Bacteria 2395
256 Ga0495672_0011378 3300047320 Bacteria 6286
257 Ga0495672_0047290 3300047320 Bacteria 2559
258 Ga0495676_0000093 3300047321 Bacteria 66312
259 Ga0495676_0011634 3300047321 Bacteria 7940
260 Ga0495676_0081127 3300047321 Bacteria 2460
261 Ga0495680_0033654 3300047322 Bacteria 4147
262 Ga0495683_0000145 3300047323 Bacteria 69835
263 Ga0495683_0023697 3300047323 Bacteria 3154
264 Ga0495683_0029044 3300047323 Bacteria 2826
265 Ga0495683_0040108 3300047323 Bacteria 2366
266 Ga0495683_0172981 3300047323 Bacteria 991
267 Ga0495687_053139 3300047443 Bacteria 1708
268 Ga0495675_0146150 3300047444 Bacteria 1463
269 Ga0495675_0186598 3300047444 Bacteria 1267
270 Ga0495677_0000897 3300047445 Bacteria 11998
271 Ga0495677_0001439 3300047445 Bacteria 9555
272 Ga0495677_0009526 3300047445 Bacteria 3586
273 Ga0495677_0009694 3300047445 Bacteria 3550
274 Ga0495677_0010657 3300047445 Bacteria 3368
275 Ga0495677_0017744 3300047445 Bacteria 2579
276 Ga0495677_0022261 3300047445 Bacteria 2299
277 Ga0495677_0040027 3300047445 Bacteria 1714
278 Ga0495677_0340497 3300047445 Bacteria 591
279 Ga0495685_010404 3300047447 Bacteria 3119
280 Ga0495685_014006 3300047447 Bacteria 2722
281 Ga0495685_219840 3300047447 Bacteria 606
282 Ga0495673_0000037 3300047469 Bacteria 307717
283 Ga0495673_0091642 3300047469 Bacteria 1241
284 Ga0495681_0000073 3300047470 Bacteria 92561
285 Ga0495681_0011120 3300047470 Bacteria 5394
286 Ga0495681_0013458 3300047470 Bacteria 4743
287 Ga0495681_0035662 3300047470 Bacteria 2468
288 Ga0495681_0065702 3300047470 Bacteria 1657
289 Ga0495681_0107581 3300047470 Bacteria 1211
290 Ga0495681_0257890 3300047470 Bacteria 686
291 Ga0495686_0000926 3300047472 Bacteria 36586
292 Ga0495686_0048920 3300047472 Plasmid 2663
293 Ga0495686_0290538 3300047472 Bacteria 905
294 Ga0495593_0029396 3300047673 Bacteria 3013
295 Ga0495593_0097431 3300047673 Bacteria 1510
296 Ga0495602_0021506 3300048088 Bacteria 6347
297 Ga0495614_0008378 3300048089 Bacteria 4598
298 Ga0495626_0001245 3300048091 Bacteria 20900
299 Ga0495626_0007353 3300048091 Bacteria 6137
300 Ga0495626_0009015 3300048091 Bacteria 5409
301 Ga0495626_0009258 3300048091 Bacteria 5329
302 Ga0495626_0025280 3300048091 Bacteria 2906
303 Ga0495626_0035175 3300048091 Bacteria 2391
304 Ga0495626_0042268 3300048091 Bacteria 2141
305 Ga0495626_0043208 3300048091 Bacteria 2115
306 Ga0495626_0063743 3300048091 Bacteria 1671
307 Ga0495626_0107416 3300048091 Bacteria 1211
308 Ga0495626_0140661 3300048091 Bacteria 1024
309 Ga0496102_0041369 3300048905 Bacteria 4172
310 Ga0496102_0304301 3300048905 Bacteria 1502
311 Ga0496102_0663418 3300048905 Bacteria 966
312 Ga0496103_0059060 3300048906 Bacteria 2383
313 Ga0496104_0851927 3300048907 Unclassified 817
314 Ga0496109_0284328 3300048912 Unclassified 1559
315 Ga0496115_0172874 3300048918 Bacteria 1786
316 Ga0496115_0364802 3300048918 Bacteria 1176
317 Ga0495682_0000718 3300049460 Bacteria 21602
318 Ga0501238_003739 3300049671 Bacteria 1880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0004943 Ga0495668_0004943_3589_4128 149
2 3300046491 Ga0495584_0001068 Ga0495584_0001068_13611_14150 150
3 3300046492 Ga0495585_0000645 Ga0495585_0000645_23365_23904 150
4 3300046513 Ga0495616_0019546 Ga0495616_0019546_1633_2172 150
5 3300046558 Ga0495633_0002861 Ga0495633_0002861_8380_8919 150
6 3300047323 Ga0495683_0000145 Ga0495683_0000145_55286_55825 150
7 3300046492 Ga0495585_0000055 Ga0495585_0000055_61167_61766 155
8 3300046691 Ga0495670_0637459 Ga0495670_0637459_73_564 161
9 3300049671 Ga0501238_003739 Ga0501238_003739_1085_1627 162
10 3300047323 Ga0495683_0172981 Ga0495683_0172981_482_979 164
11 3300046543 Ga0495645_0354144 Ga0495645_0354144_355_909 166
12 3300046507 Ga0495606_0111654 Ga0495606_0111654_873_1424 167
13 3300046810 Ga0495660_0000735 Ga0495660_0000735_18609_19160 167
14 3300047472 Ga0495686_0048920 Ga0495686_0048920_2065_2616 167
15 3300046452 Ga0495617_016462 Ga0495617_016462_1100_1660 168
16 3300047321 Ga0495676_0081127 Ga0495676_0081127_18_557 168
17 3300046452 Ga0495617_000002 Ga0495617_000002_361147_361698 169
18 3300046452 Ga0495617_000656 Ga0495617_000656_14810_15403 169
19 3300046452 Ga0495617_097632 Ga0495617_097632_365_904 169
20 3300046453 Ga0495627_000174 Ga0495627_000174_13624_14175 169
21 3300046453 Ga0495627_006740 Ga0495627_006740_3239_3802 169
22 3300046455 Ga0495603_0005743 Ga0495603_0005743_5861_6400 169
23 3300046459 Ga0495629_0015991 Ga0495629_0015991_3665_4204 169
24 3300046460 Ga0495638_0005095 Ga0495638_0005095_2670_3209 169
25 3300046471 Ga0495650_0015295 Ga0495650_0015295_1591_2148 169
26 3300046473 Ga0495582_0015553 Ga0495582_0015553_1168_1707 169
27 3300046474 Ga0495605_0000133 Ga0495605_0000133_20009_20560 169
28 3300046474 Ga0495605_0012360 Ga0495605_0012360_224_763 169
29 3300046474 Ga0495605_0021419 Ga0495605_0021419_1055_1594 169
30 3300046491 Ga0495584_0000015 Ga0495584_0000015_155942_156535 169
31 3300046491 Ga0495584_0003726 Ga0495584_0003726_1378_1929 169
32 3300046491 Ga0495584_0007697 Ga0495584_0007697_4617_5156 169
33 3300046491 Ga0495584_0018042 Ga0495584_0018042_637_1200 169
34 3300046491 Ga0495584_0076054 Ga0495584_0076054_302_841 169
35 3300046492 Ga0495585_0000278 Ga0495585_0000278_1973_2566 169
36 3300046492 Ga0495585_0007274 Ga0495585_0007274_3884_4423 169
37 3300046492 Ga0495585_0009879 Ga0495585_0009879_1791_2330 169
38 3300046492 Ga0495585_0011719 Ga0495585_0011719_3008_3547 169
39 3300046492 Ga0495585_0014563 Ga0495585_0014563_1030_1569 169
40 3300046492 Ga0495585_0033622 Ga0495585_0033622_1938_2477 169
41 3300046492 Ga0495585_0052289 Ga0495585_0052289_673_1212 169
42 3300046492 Ga0495585_0068386 Ga0495585_0068386_170_709 169
43 3300046499 Ga0495594_0006217 Ga0495594_0006217_4923_5462 169
44 3300046499 Ga0495594_0083869 Ga0495594_0083869_1001_1540 169
45 3300046500 Ga0495596_0000384 Ga0495596_0000384_10265_10804 169
46 3300046500 Ga0495596_0005135 Ga0495596_0005135_1367_1918 169
47 3300046500 Ga0495596_0008516 Ga0495596_0008516_1953_2492 169
48 3300046500 Ga0495596_0096214 Ga0495596_0096214_181_720 169
49 3300046501 Ga0495607_0003394 Ga0495607_0003394_1467_2003 169
50 3300046501 Ga0495607_0013723 Ga0495607_0013723_1696_2247 169
51 3300046501 Ga0495607_0016085 Ga0495607_0016085_3453_3992 169
52 3300046501 Ga0495607_0025638 Ga0495607_0025638_2380_2919 169
53 3300046501 Ga0495607_0086747 Ga0495607_0086747_224_763 169
54 3300046501 Ga0495607_0122384 Ga0495607_0122384_181_774 169
55 3300046506 Ga0495583_0000064 Ga0495583_0000064_102590_103183 169
56 3300046506 Ga0495583_0017732 Ga0495583_0017732_555_1124 169
57 3300046506 Ga0495583_0020396 Ga0495583_0020396_649_1200 169
58 3300046506 Ga0495583_0052036 Ga0495583_0052036_896_1435 169
59 3300046507 Ga0495606_0006261 Ga0495606_0006261_5723_6262 169
60 3300046507 Ga0495606_0010934 Ga0495606_0010934_5554_6093 169
61 3300046507 Ga0495606_0013567 Ga0495606_0013567_3908_4501 169
62 3300046507 Ga0495606_0031333 Ga0495606_0031333_198_749 169
63 3300046513 Ga0495616_0002875 Ga0495616_0002875_5079_5630 169
64 3300046513 Ga0495616_0005261 Ga0495616_0005261_4676_5269 169
65 3300046513 Ga0495616_0007053 Ga0495616_0007053_3813_4352 169
66 3300046513 Ga0495616_0012658 Ga0495616_0012658_2786_3325 169
67 3300046513 Ga0495616_0044739 Ga0495616_0044739_1693_2229 169
68 3300046515 Ga0495620_0001276 Ga0495620_0001276_3140_3679 169
69 3300046518 Ga0495631_0031587 Ga0495631_0031587_1042_1581 169
70 3300046518 Ga0495631_0049681 Ga0495631_0049681_140_703 169
71 3300046518 Ga0495631_0054127 Ga0495631_0054127_181_720 169
72 3300046519 Ga0495632_0004588 Ga0495632_0004588_3180_3716 169
73 3300046519 Ga0495632_0017154 Ga0495632_0017154_726_1265 169
74 3300046522 Ga0495643_0002104 Ga0495643_0002104_10428_10979 169
75 3300046522 Ga0495643_0092882 Ga0495643_0092882_586_1125 169
76 3300046523 Ga0495644_0008726 Ga0495644_0008726_2089_2628 169
77 3300046523 Ga0495644_0032197 Ga0495644_0032197_585_1148 169
78 3300046524 Ga0495648_0000136 Ga0495648_0000136_83786_84379 169
79 3300046524 Ga0495648_0000646 Ga0495648_0000646_24088_24639 169
80 3300046524 Ga0495648_0086229 Ga0495648_0086229_406_999 169
81 3300046524 Ga0495648_0320434 Ga0495648_0320434_76_615 169
82 3300046525 Ga0495663_0001532 Ga0495663_0001532_1915_2478 169
83 3300046525 Ga0495663_0025016 Ga0495663_0025016_608_1147 169
84 3300046526 Ga0495666_0002678 Ga0495666_0002678_2422_2937 169
85 3300046526 Ga0495666_0377373 Ga0495666_0377373_65_604 169
86 3300046528 Ga0495642_0000166 Ga0495642_0000166_22107_22658 169
87 3300046528 Ga0495642_0006472 Ga0495642_0006472_720_1283 169
88 3300046528 Ga0495642_0008844 Ga0495642_0008844_924_1463 169
89 3300046528 Ga0495642_0014683 Ga0495642_0014683_1136_1675 169
90 3300046528 Ga0495642_0016005 Ga0495642_0016005_154_693 169
91 3300046528 Ga0495642_0075905 Ga0495642_0075905_337_876 169
92 3300046528 Ga0495642_0161828 Ga0495642_0161828_98_637 169
93 3300046528 Ga0495642_0217793 Ga0495642_0217793_239_778 169
94 3300046530 Ga0495654_0005753 Ga0495654_0005753_834_1385 169
95 3300046531 Ga0495665_0034937 Ga0495665_0034937_1692_2231 169
96 3300046531 Ga0495665_0054449 Ga0495665_0054449_947_1462 169
97 3300046538 Ga0495609_0008185 Ga0495609_0008185_3565_4116 169
98 3300046538 Ga0495609_0029606 Ga0495609_0029606_996_1535 169
99 3300046538 Ga0495609_0030201 Ga0495609_0030201_1401_1952 169
100 3300046542 Ga0495597_0000094 Ga0495597_0000094_61369_61920 169
101 3300046542 Ga0495597_0003438 Ga0495597_0003438_1706_2269 169
102 3300046542 Ga0495597_0076327 Ga0495597_0076327_619_1170 169
103 3300046542 Ga0495597_0111149 Ga0495597_0111149_348_887 169
104 3300046542 Ga0495597_0140091 Ga0495597_0140091_368_907 169
105 3300046557 Ga0495622_0011051 Ga0495622_0011051_960_1499 169
106 3300046558 Ga0495633_0007632 Ga0495633_0007632_1602_2141 169
107 3300046558 Ga0495633_0017560 Ga0495633_0017560_350_889 169
108 3300046558 Ga0495633_0017880 Ga0495633_0017880_2489_3028 169
109 3300046558 Ga0495633_0023720 Ga0495633_0023720_835_1398 169
110 3300046558 Ga0495633_0120583 Ga0495633_0120583_90_629 169
111 3300046558 Ga0495633_0161379 Ga0495633_0161379_36_575 169
112 3300046615 Ga0495656_0002708 Ga0495656_0002708_2522_3073 169
113 3300046615 Ga0495656_0005687 Ga0495656_0005687_551_1114 169
114 3300046615 Ga0495656_0211699 Ga0495656_0211699_87_626 169
115 3300046616 Ga0495668_0000835 Ga0495668_0000835_21972_22523 169
116 3300046616 Ga0495668_0045889 Ga0495668_0045889_908_1447 169
117 3300046616 Ga0495668_0072097 Ga0495668_0072097_1130_1669 169
118 3300046616 Ga0495668_0086196 Ga0495668_0086196_110_649 169
119 3300046616 Ga0495668_0105458 Ga0495668_0105458_586_1125 169
120 3300046616 Ga0495668_0210146 Ga0495668_0210146_539_1051 169
121 3300046648 Ga0495611_0008602 Ga0495611_0008602_1881_2420 169
122 3300046648 Ga0495611_0009547 Ga0495611_0009547_155_694 169
123 3300046648 Ga0495611_0063334 Ga0495611_0063334_686_1279 169
124 3300046648 Ga0495611_0083811 Ga0495611_0083811_876_1445 169
125 3300046648 Ga0495611_0107184 Ga0495611_0107184_220_759 169
126 3300046663 Ga0495635_0304472 Ga0495635_0304472_99_638 169
127 3300046663 Ga0495635_0404608 Ga0495635_0404608_160_675 169
128 3300046665 Ga0495661_0002129 Ga0495661_0002129_10310_10846 169
129 3300046665 Ga0495661_0020700 Ga0495661_0020700_2062_2613 169
130 3300046665 Ga0495661_0024979 Ga0495661_0024979_2472_3011 169
131 3300046665 Ga0495661_0026833 Ga0495661_0026833_2728_3291 169
132 3300046665 Ga0495661_0034058 Ga0495661_0034058_290_829 169
133 3300046665 Ga0495661_0182876 Ga0495661_0182876_312_851 169
134 3300046665 Ga0495661_0338321 Ga0495661_0338321_60_629 169
135 3300046665 Ga0495661_0407081 Ga0495661_0407081_92_631 169
136 3300046674 Ga0495588_0009589 Ga0495588_0009589_21_578 169
137 3300046674 Ga0495588_0022905 Ga0495588_0022905_1353_1892 169
138 3300046674 Ga0495588_0203968 Ga0495588_0203968_141_680 169
139 3300046679 Ga0495623_0010495 Ga0495623_0010495_3422_3979 169
140 3300046684 Ga0495669_0000077 Ga0495669_0000077_2215_2754 169
141 3300046684 Ga0495669_0013438 Ga0495669_0013438_1265_1804 169
142 3300046684 Ga0495669_0048626 Ga0495669_0048626_204_755 169
143 3300046684 Ga0495669_0054714 Ga0495669_0054714_1015_1554 169
144 3300046684 Ga0495669_0244307 Ga0495669_0244307_10_522 169
145 3300046689 Ga0495613_0036159 Ga0495613_0036159_752_1291 169
146 3300046691 Ga0495670_0001573 Ga0495670_0001573_176_715 169
147 3300046691 Ga0495670_0006323 Ga0495670_0006323_478_1017 169
148 3300046691 Ga0495670_0026415 Ga0495670_0026415_1406_1945 169
149 3300046691 Ga0495670_0030311 Ga0495670_0030311_1342_1881 169
150 3300046691 Ga0495670_0065014 Ga0495670_0065014_141_680 169
151 3300046691 Ga0495670_0082690 Ga0495670_0082690_662_1201 169
152 3300046691 Ga0495670_0224692 Ga0495670_0224692_65_604 169
153 3300046692 Ga0495671_0000192 Ga0495671_0000192_10286_10837 169
154 3300046694 Ga0495649_0013400 Ga0495649_0013400_2569_3084 169
155 3300046694 Ga0495649_0014435 Ga0495649_0014435_3811_4350 169
156 3300046694 Ga0495649_0104142 Ga0495649_0104142_942_1481 169
157 3300046794 Ga0495589_0003440 Ga0495589_0003440_2543_3094 169
158 3300046794 Ga0495589_0013430 Ga0495589_0013430_2586_3125 169
159 3300046810 Ga0495660_0011659 Ga0495660_0011659_1139_1678 169
160 3300046810 Ga0495660_0056292 Ga0495660_0056292_148_702 169
161 3300046810 Ga0495660_0458698 Ga0495660_0458698_13_525 169
162 3300047315 Ga0495581_0063001 Ga0495581_0063001_974_1513 169
163 3300047315 Ga0495581_0118951 Ga0495581_0118951_436_975 169
164 3300047317 Ga0495604_0063227 Ga0495604_0063227_967_1482 169
165 3300047317 Ga0495604_0066965 Ga0495604_0066965_2031_2570 169
166 3300047317 Ga0495604_0316916 Ga0495604_0316916_283_798 169
167 3300047323 Ga0495683_0023697 Ga0495683_0023697_1647_2186 169
168 3300047323 Ga0495683_0040108 Ga0495683_0040108_1348_1887 169
169 3300047443 Ga0495687_053139 Ga0495687_053139_846_1439 169
170 3300047444 Ga0495675_0146150 Ga0495675_0146150_436_951 169
171 3300047445 Ga0495677_0000897 Ga0495677_0000897_7022_7573 169
172 3300047445 Ga0495677_0001439 Ga0495677_0001439_3417_3980 169
173 3300047445 Ga0495677_0009694 Ga0495677_0009694_2078_2617 169
174 3300047445 Ga0495677_0010657 Ga0495677_0010657_1060_1599 169
175 3300047445 Ga0495677_0017744 Ga0495677_0017744_294_830 169
176 3300047445 Ga0495677_0340497 Ga0495677_0340497_10_549 169
177 3300047447 Ga0495685_010404 Ga0495685_010404_480_1019 169
178 3300047447 Ga0495685_219840 Ga0495685_219840_10_522 169
179 3300047469 Ga0495673_0000037 Ga0495673_0000037_24008_24565 169
180 3300047470 Ga0495681_0000073 Ga0495681_0000073_42179_42733 169
181 3300047470 Ga0495681_0011120 Ga0495681_0011120_1316_1879 169
182 3300047470 Ga0495681_0013458 Ga0495681_0013458_3558_4097 169
183 3300047470 Ga0495681_0065702 Ga0495681_0065702_347_886 169
184 3300047470 Ga0495681_0107581 Ga0495681_0107581_188_727 169
185 3300047470 Ga0495681_0257890 Ga0495681_0257890_61_600 169
186 3300047472 Ga0495686_0290538 Ga0495686_0290538_209_760 169
187 3300047673 Ga0495593_0029396 Ga0495593_0029396_2318_2857 169
188 3300048089 Ga0495614_0008378 Ga0495614_0008378_614_1153 169
189 3300048091 Ga0495626_0009015 Ga0495626_0009015_2441_2992 169
190 3300048091 Ga0495626_0025280 Ga0495626_0025280_182_721 169
191 3300048091 Ga0495626_0042268 Ga0495626_0042268_1497_2036 169
192 3300048091 Ga0495626_0063743 Ga0495626_0063743_731_1273 169
193 3300048091 Ga0495626_0107416 Ga0495626_0107416_614_1153 169
194 3300048091 Ga0495626_0140661 Ga0495626_0140661_13_552 169
195 3300048905 Ga0496102_0304301 Ga0496102_0304301_931_1488 169
196 3300048905 Ga0496102_0663418 Ga0496102_0663418_389_922 169
197 3300048907 Ga0496104_0851927 Ga0496104_0851927_173_730 169
198 3300048912 Ga0496109_0284328 Ga0496109_0284328_186_740 169
199 3300048918 Ga0496115_0172874 Ga0496115_0172874_307_864 169
200 3300048918 Ga0496115_0364802 Ga0496115_0364802_24_569 169
201 3300005288 Ga0065714_10148715 Ga0065714_101487152 170
202 3300046491 Ga0495584_0047340 Ga0495584_0047340_609_1154 170
203 3300046491 Ga0495584_0059775 Ga0495584_0059775_1213_1755 170
204 3300046492 Ga0495585_0009107 Ga0495585_0009107_4386_4931 170
205 3300046492 Ga0495585_0120932 Ga0495585_0120932_292_861 170
206 3300046500 Ga0495596_0007552 Ga0495596_0007552_773_1318 170
207 3300046500 Ga0495596_0009389 Ga0495596_0009389_2480_3025 170
208 3300046506 Ga0495583_0000337 Ga0495583_0000337_3667_4218 170
209 3300046506 Ga0495583_0003060 Ga0495583_0003060_6853_7395 170
210 3300046506 Ga0495583_0010523 Ga0495583_0010523_1238_1789 170
211 3300046513 Ga0495616_0152101 Ga0495616_0152101_51_596 170
212 3300046518 Ga0495631_0024354 Ga0495631_0024354_393_938 170
213 3300046522 Ga0495643_0066217 Ga0495643_0066217_646_1191 170
214 3300046524 Ga0495648_0025539 Ga0495648_0025539_2132_2683 170
215 3300046525 Ga0495663_0006683 Ga0495663_0006683_649_1185 170
216 3300046526 Ga0495666_0000520 Ga0495666_0000520_8599_9183 170
217 3300046528 Ga0495642_0012776 Ga0495642_0012776_2519_3061 170
218 3300046528 Ga0495642_0074811 Ga0495642_0074811_204_722 170
219 3300046530 Ga0495654_0086713 Ga0495654_0086713_250_792 170
220 3300046531 Ga0495665_0236330 Ga0495665_0236330_331_915 170
221 3300046538 Ga0495609_0330641 Ga0495609_0330641_57_575 170
222 3300046542 Ga0495597_0002943 Ga0495597_0002943_1700_2242 170
223 3300046615 Ga0495656_0011358 Ga0495656_0011358_1864_2406 170
224 3300046615 Ga0495656_0014985 Ga0495656_0014985_1847_2383 170
225 3300046616 Ga0495668_0091131 Ga0495668_0091131_349_891 170
226 3300046648 Ga0495611_0006221 Ga0495611_0006221_834_1352 170
227 3300046660 Ga0495625_0128820 Ga0495625_0128820_201_743 170
228 3300046665 Ga0495661_0012225 Ga0495661_0012225_1800_2345 170
229 3300046665 Ga0495661_0042909 Ga0495661_0042909_1848_2417 170
230 3300046665 Ga0495661_0281477 Ga0495661_0281477_10_573 170
231 3300046674 Ga0495588_0035555 Ga0495588_0035555_393_935 170
232 3300046684 Ga0495669_0012046 Ga0495669_0012046_937_1455 170
233 3300046694 Ga0495649_0017411 Ga0495649_0017411_1843_2388 170
234 3300046694 Ga0495649_0086030 Ga0495649_0086030_276_845 170
235 3300046694 Ga0495649_0101378 Ga0495649_0101378_941_1483 170
236 3300046794 Ga0495589_0060622 Ga0495589_0060622_144_689 170
237 3300046810 Ga0495660_0038464 Ga0495660_0038464_1632_2177 170
238 3300047318 Ga0495636_0092899 Ga0495636_0092899_74_625 170
239 3300047318 Ga0495636_0453405 Ga0495636_0453405_32_556 170
240 3300047320 Ga0495672_0011378 Ga0495672_0011378_26_568 170
241 3300047323 Ga0495683_0029044 Ga0495683_0029044_1787_2332 170
242 3300047445 Ga0495677_0022261 Ga0495677_0022261_620_1165 170
243 3300047445 Ga0495677_0040027 Ga0495677_0040027_474_1016 170
244 3300047447 Ga0495685_014006 Ga0495685_014006_1196_1738 170
245 3300047470 Ga0495681_0035662 Ga0495681_0035662_573_1118 170
246 3300047472 Ga0495686_0000926 Ga0495686_0000926_26649_27194 170
247 3300048091 Ga0495626_0007353 Ga0495626_0007353_2121_2639 170
248 3300048091 Ga0495626_0009258 Ga0495626_0009258_2153_2698 170
249 3300048905 Ga0496102_0041369 Ga0496102_0041369_3285_3836 170
250 3300048906 Ga0496103_0059060 Ga0496103_0059060_1774_2325 170
251 3300049460 Ga0495682_0000718 Ga0495682_0000718_17198_17743 170
252 iso_pu_bacteria 2881101125 2881104476 170
253 3300025273 Ga0209673_1037142 Ga0209673_10371423 171
254 3300046455 Ga0495603_0077115 Ga0495603_0077115_751_1311 171
255 3300046463 Ga0495653_0167122 Ga0495653_0167122_67_612 171
256 3300046473 Ga0495582_0009039 Ga0495582_0009039_4632_5189 171
257 3300046474 Ga0495605_0055380 Ga0495605_0055380_1102_1650 171
258 3300046491 Ga0495584_0007106 Ga0495584_0007106_3567_4115 171
259 3300046491 Ga0495584_0058291 Ga0495584_0058291_1343_1891 171
260 3300046491 Ga0495584_0156854 Ga0495584_0156854_157_705 171
261 3300046492 Ga0495585_0000434 Ga0495585_0000434_22855_23403 171
262 3300046492 Ga0495585_0086594 Ga0495585_0086594_466_1026 171
263 3300046499 Ga0495594_0082409 Ga0495594_0082409_326_883 171
264 3300046499 Ga0495594_0134586 Ga0495594_0134586_203_763 171
265 3300046500 Ga0495596_0001295 Ga0495596_0001295_6130_6678 171
266 3300046506 Ga0495583_0000341 Ga0495583_0000341_2009_2557 171
267 3300046506 Ga0495583_0145340 Ga0495583_0145340_384_929 171
268 3300046513 Ga0495616_0000139 Ga0495616_0000139_17805_18350 171
269 3300046517 Ga0495630_0039768 Ga0495630_0039768_1228_1785 171
270 3300046518 Ga0495631_0029694 Ga0495631_0029694_333_890 171
271 3300046518 Ga0495631_0040136 Ga0495631_0040136_45_593 171
272 3300046520 Ga0495637_0011441 Ga0495637_0011441_2017_2562 171
273 3300046522 Ga0495643_0001107 Ga0495643_0001107_19804_20352 171
274 3300046522 Ga0495643_0011579 Ga0495643_0011579_4226_4774 171
275 3300046523 Ga0495644_0017342 Ga0495644_0017342_636_1157 171
276 3300046523 Ga0495644_0048631 Ga0495644_0048631_526_1077 171
277 3300046526 Ga0495666_0055803 Ga0495666_0055803_706_1263 171
278 3300046526 Ga0495666_0085109 Ga0495666_0085109_331_876 171
279 3300046526 Ga0495666_0093028 Ga0495666_0093028_601_1161 171
280 3300046529 Ga0495652_0109029 Ga0495652_0109029_764_1321 171
281 3300046535 Ga0495586_0033588 Ga0495586_0033588_2111_2668 171
282 3300046536 Ga0495587_0033765 Ga0495587_0033765_2123_2680 171
283 3300046536 Ga0495587_0040395 Ga0495587_0040395_2093_2638 171
284 3300046538 Ga0495609_0008862 Ga0495609_0008862_2682_3230 171
285 3300046557 Ga0495622_0063369 Ga0495622_0063369_180_737 171
286 3300046615 Ga0495656_0183375 Ga0495656_0183375_88_606 171
287 3300046616 Ga0495668_0014053 Ga0495668_0014053_729_1277 171
288 3300046648 Ga0495611_0015863 Ga0495611_0015863_2368_2916 171
289 3300046665 Ga0495661_0011723 Ga0495661_0011723_265_816 171
290 3300046674 Ga0495588_0002053 Ga0495588_0002053_4749_5324 171
291 3300046674 Ga0495588_0003927 Ga0495588_0003927_2950_3498 171
292 3300046689 Ga0495613_0104043 Ga0495613_0104043_277_834 171
293 3300046690 Ga0495624_0253820 Ga0495624_0253820_130_687 171
294 3300046691 Ga0495670_0102278 Ga0495670_0102278_417_968 171
295 3300046691 Ga0495670_0102389 Ga0495670_0102389_904_1464 171
296 3300046691 Ga0495670_0374657 Ga0495670_0374657_200_748 171
297 3300046809 Ga0495600_0142343 Ga0495600_0142343_49_606 171
298 3300047315 Ga0495581_0057657 Ga0495581_0057657_457_1014 171
299 3300047317 Ga0495604_0127319 Ga0495604_0127319_50_607 171
300 3300047319 Ga0495674_0105458 Ga0495674_0105458_295_852 171
301 3300047320 Ga0495672_0047290 Ga0495672_0047290_1413_1961 171
302 3300047321 Ga0495676_0000093 Ga0495676_0000093_6903_7478 171
303 3300047321 Ga0495676_0011634 Ga0495676_0011634_346_867 171
304 3300047322 Ga0495680_0033654 Ga0495680_0033654_3226_3771 171
305 3300047444 Ga0495675_0186598 Ga0495675_0186598_62_607 171
306 3300047445 Ga0495677_0009526 Ga0495677_0009526_1234_1782 171
307 3300047469 Ga0495673_0091642 Ga0495673_0091642_257_805 171
308 3300047673 Ga0495593_0097431 Ga0495593_0097431_180_737 171
309 3300048088 Ga0495602_0021506 Ga0495602_0021506_491_1048 171
310 3300048091 Ga0495626_0001245 Ga0495626_0001245_16763_17311 171
311 3300048091 Ga0495626_0035175 Ga0495626_0035175_1277_1822 171
312 3300048091 Ga0495626_0043208 Ga0495626_0043208_720_1268 171
313 3300003792 Ga0055540_1002460 Ga0055540_100246010 174
314 3300003794 Ga0055531_10000234 Ga0055531_100002347 174
315 3300025303 Ga0209051_1000025 Ga0209051_1000025135 174
316 3300025304 Ga0209257_1000039 Ga0209257_1000039473 174
317 3300044842 Ga0466957_0128045 Ga0466957_0128045_663_1223 174
318 3300045976 Ga0466967_0654355 Ga0466967_0654355_249_809 174
319 3300046522 Ga0495643_0052594 Ga0495643_0052594_199_732 174

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.6365 3 171
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.6042 3 171
7tut-assembly1.cif.gz_6 structure of the rabbit 80s ribosome stalled on a 4-tmd rhodopsin intermediate in complex with the multipass translocon 0.4234 2 162
4fbs-assembly1.cif.gz_A structure of monomeric nt from euprosthenops australis major ampullate spidroin 1 (masp1) 0.4167 43 158
4rfs-assembly1.cif.gz_S structure of a pantothenate energy coupling factor transporter 0.4025 6 169
ID Description Score Start End Superfamily
4hzuS00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6365 3 171 1.10.1760.20
4hzuS00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6042 3 171 1.10.1760.20
af_Q2FUT1_1_180_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4923 4 174 1.10.1760.20
af_Q2FUT1_1_180_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4855 4 174 1.10.1760.20
af_P95210_10_113_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4846 51 158 1.10.287.1260
ID Description Score Start End GO Terms
AF-A0A6N8INH4-F1-model_v4 Uncharacterized protein 0.9611 2 169 GO:0016020
AF-A0A225SS85-F1-model_v4 MASE1 domain-containing protein 0.9521 2 169 GO:0016020
AF-A0A7X6I5K2-F1-model_v4 MASE1 domain-containing protein 0.9449 2 169 GO:0016020
AF-A0A1G6WWM8-F1-model_v4 deleted 0.9438 2 164
AF-A0A6B1J545-F1-model_v4 deleted 0.9434 1 172

Feature Viewer

pLDDT pTM Quality
90.23 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map