F405253

General Info

Members Datasets Scaffolds Average Seq Length
319 197 638 746

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0018595|Ga0496108_0018595_1821_4535
Length 863
Sequence MVLGATHPFGGAMPQRAHRVGDGWQESGAVAVGEGGRARPRLDPALGEAGLGPVAGGTLPERRAHPRMTIRTAPGRTTTPVAPRRSAPDPLVVEPGTIAXXRARVAAPLRREGXAKLTGEAKYADDLVFPGAWYGATIRSTDAHARFDGFDLDPAFDWSKVAVVTASDIPGENIVSLISDDQPVLVPIGGEIQHHAEPLVLLAAADRQTLRHARRGVRLRTTPLPAVFDPVESEHVFAHYDIASGDLEAGFAAADLILEGTYRVGHQEQLYIENNAMIAVPREDGGVAVHGSLQCPYYIHKALKRALRLTDEQARVVQAETGGGFGGKEEYPSVIALHSALLSRKTGKPVRMIYDRHEDLAATTKRHPAVVTHRTGIKADGTLVAQEIEVVMDGGAYCTLTPVVLSRGAIHAGGPYRCPNVRIRARATRTNTPPNGAFRGFGAPQVEFAAEVQMGRLAEALKLSPLDIRRKNLYRIGDETPTGQILRESVAAEEVLERAAEAAEFEGVRARTERARARRDGSGHVPGSPLRTGPDRVASGIGVALAWHGAGFTGSGEVKLASVASLELAGDGRVRILTGSTEMGQGTKTIFPQLVAAELGLTAEDVEMAPQDTAIVPDSGPTVASRTAMVVGGLLIQAARRLRSTVEERNGGRPFADVRVADAAASGPLRIDEHFEPYPHVHFDDETYRGDAYPAFGWAACVATVGVDLDSGEVTVKDVVAADDVGRVIHPVLAEGQVEGGTLQAIGYATIEEIKLRDGRYLNDRLATYIIPTALDAPRITTVLVEAPFSGAPHGAKGVGELPMDVGAPAVVAAIHDATGAWVHELPASPERILTALGVTPARTERTPSPQVLRGPRDPGEPA

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
120 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
187 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
190 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
191 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
192 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 4.39
Rhizosphere 89.66
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0018595 3300048911 Bacteria 5692
2 Ga0070683_100004894 3300005329 Bacteria 11104
3 Ga0070683_100044029 3300005329 Bacteria 4115
4 Ga0070690_100020009 3300005330 Bacteria 4073
5 Ga0070670_100037382 3300005331 Bacteria 4177
6 Ga0068869_100039949 3300005334 Bacteria 3352
7 Ga0070680_100000002 3300005336 Bacteria 211003
8 Ga0070680_100025531 3300005336 Bacteria 4723
9 Ga0070682_100009388 3300005337 Bacteria 5536
10 Ga0070660_100014055 3300005339 Bacteria 5762
11 Ga0070689_100006178 3300005340 Bacteria 8260
12 Ga0070661_100002349 3300005344 Bacteria 12986
13 Ga0070669_100001394 3300005353 Bacteria 17440
14 Ga0070674_100011662 3300005356 Bacteria 5357
15 Ga0070688_100011217 3300005365 Bacteria 4976
16 Ga0070659_100028891 3300005366 Bacteria 4284
17 Ga0070659_100048810 3300005366 Bacteria 3326
18 Ga0070703_10002771 3300005406 Bacteria 5025
19 Ga0070703_10008228 3300005406 Bacteria 2933
20 Ga0070709_10000012 3300005434 Bacteria 163026
21 Ga0070701_10015327 3300005438 Bacteria 3537
22 Ga0070711_100000002 3300005439 Bacteria 263148
23 Ga0070694_100002190 3300005444 Bacteria 11580
24 Ga0070694_100042933 3300005444 Bacteria 3021
25 Ga0070708_100000072 3300005445 Bacteria 65220
26 Ga0070708_100000978 3300005445 Bacteria 21761
27 Ga0070708_100004168 3300005445 Bacteria 11355
28 Ga0070708_100007861 3300005445 Bacteria 8536
29 Ga0070663_100009977 3300005455 Bacteria 5904
30 Ga0070678_100005310 3300005456 Bacteria 7430
31 Ga0070681_10033221 3300005458 Bacteria 5179
32 Ga0070681_10044771 3300005458 Bacteria 4431
33 Ga0070685_10000605 3300005466 Bacteria 19821
34 Ga0070706_100000061 3300005467 Bacteria 130709
35 Ga0070706_100000121 3300005467 Bacteria 95356
36 Ga0070706_100026371 3300005467 Bacteria 5347
37 Ga0070706_100033176 3300005467 Bacteria 4765
38 Ga0070706_100040217 3300005467 Bacteria 4316
39 Ga0070706_100085460 3300005467 Bacteria 2923
40 Ga0070706_100089793 3300005467 Bacteria 2849
41 Ga0070706_100099297 3300005467 Bacteria 2705
42 Ga0070707_100000015 3300005468 Bacteria 144611
43 Ga0070707_100012690 3300005468 Bacteria 7867
44 Ga0070707_100016612 3300005468 Bacteria 6908
45 Ga0070707_100033483 3300005468 Bacteria 4900
46 Ga0070707_100037732 3300005468 Bacteria 4613
47 Ga0070707_100041196 3300005468 Bacteria 4420
48 Ga0070698_100003553 3300005471 Bacteria 17128
49 Ga0070698_100012460 3300005471 Bacteria 8999
50 Ga0070698_100015821 3300005471 Bacteria 7968
51 Ga0070698_100020791 3300005471 Bacteria 6879
52 Ga0070699_100000144 3300005518 Bacteria 67083
53 Ga0070679_100004400 3300005530 Bacteria 13030
54 Ga0070679_100038283 3300005530 Bacteria 4767
55 Ga0070684_100133166 3300005535 Bacteria 2243
56 Ga0070697_100013756 3300005536 Bacteria 6347
57 Ga0070696_100000843 3300005546 Bacteria 19791
58 Ga0070696_100004445 3300005546 Bacteria 9356
59 Ga0070693_100015591 3300005547 Bacteria 3916
60 Ga0070665_100000351 3300005548 Bacteria 69230
61 Ga0070704_100007143 3300005549 Bacteria 6632
62 Ga0070704_100024027 3300005549 Bacteria 3993
63 Ga0070704_100057267 3300005549 Bacteria 2770
64 Ga0068856_100034807 3300005614 Bacteria 4934
65 Ga0070702_100004323 3300005615 Bacteria 6478
66 Ga0068859_100000028 3300005617 Bacteria 180121
67 Ga0068859_100012195 3300005617 Bacteria 8640
68 Ga0068859_100135479 3300005617 Bacteria 2535
69 Ga0068864_100009473 3300005618 Bacteria 8036
70 Ga0068864_100081190 3300005618 Bacteria 2842
71 Ga0068864_100086368 3300005618 Bacteria 2760
72 Ga0068863_100005240 3300005841 Bacteria 12793
73 Ga0068858_100056251 3300005842 Bacteria 3637
74 Ga0068860_100007107 3300005843 Bacteria 11199
75 Ga0068862_100014911 3300005844 Bacteria 6456
76 Ga0081455_10031476 3300005937 Unclassified 4799
77 Ga0081539_10003597 3300005985 Bacteria 18751
78 Ga0081539_10010283 3300005985 Bacteria 7633
79 Ga0070717_10029868 3300006028 Bacteria 4378
80 Ga0097621_100114267 3300006237 Bacteria 2284
81 Ga0075428_100001253 3300006844 Bacteria 27135
82 Ga0075428_100003030 3300006844 Bacteria 18347
83 Ga0075428_100047420 3300006844 Bacteria 4719
84 Ga0075431_100048163 3300006847 Bacteria 4396
85 Ga0075431_100118771 3300006847 Bacteria 2729
86 Ga0075434_100043989 3300006871 Bacteria 4430
87 Ga0075429_100015928 3300006880 Bacteria 6510
88 Ga0075436_100000128 3300006914 Bacteria 45083
89 Ga0075436_100011265 3300006914 Bacteria 6134
90 Ga0097620_100000028 3300006931 Bacteria 180121
91 Ga0097620_100012194 3300006931 Bacteria 8640
92 Ga0097620_100135484 3300006931 Bacteria 2535
93 Ga0111539_10037568 3300009094 Bacteria 5847
94 Ga0111539_10065782 3300009094 Bacteria 4282
95 Ga0105245_10000136 3300009098 Bacteria 69874
96 Ga0105245_10023585 3300009098 Bacteria 5401
97 Ga0105247_10000988 3300009101 Bacteria 21435
98 Ga0114129_10001692 3300009147 Bacteria 30062
99 Ga0114129_10003675 3300009147 Bacteria 21582
100 Ga0114129_10005363 3300009147 Bacteria 18097
101 Ga0114129_10042648 3300009147 Bacteria 6386
102 Ga0105241_10005341 3300009174 Bacteria 9490
103 Ga0105242_10030342 3300009176 Bacteria 4316
104 Ga0105248_10005865 3300009177 Bacteria 13495
105 Ga0105238_10000923 3300009551 Bacteria 30084
106 Ga0105238_10044576 3300009551 Bacteria 4484
107 Ga0105239_10114161 3300010375 Bacteria 2996
108 Ga0157374_10019320 3300013296 Bacteria 6030
109 Ga0157378_10050385 3300013297 Bacteria 3706
110 Ga0157378_10062451 3300013297 Bacteria 3326
111 Ga0157378_10067888 3300013297 Bacteria 3196
112 Ga0163162_10091531 3300013306 Bacteria 3124
113 Ga0157375_10031076 3300013308 Bacteria 5041
114 Ga0163163_10016612 3300014325 Bacteria 6843
115 Ga0157377_10042874 3300014745 Bacteria 2515
116 Ga0157379_10018541 3300014968 Bacteria 6139
117 Ga0157376_10066945 3300014969 Bacteria 3037
118 Ga0163161_10012487 3300017792 Bacteria 5896
119 Ga0207653_10000015 3300025885 Bacteria 150553
120 Ga0207710_10003831 3300025900 Bacteria 6644
121 Ga0207699_10000087 3300025906 Bacteria 69697
122 Ga0207643_10012216 3300025908 Bacteria 4644
123 Ga0207684_10000138 3300025910 Bacteria 132416
124 Ga0207684_10027339 3300025910 Bacteria 4862
125 Ga0207684_10063908 3300025910 Bacteria 3124
126 Ga0207684_10067021 3300025910 Bacteria 3050
127 Ga0207707_10030574 3300025912 Bacteria 4712
128 Ga0207707_10051747 3300025912 Bacteria 3576
129 Ga0207663_10000022 3300025916 Bacteria 134855
130 Ga0207660_10000002 3300025917 Bacteria 883566
131 Ga0207660_10040293 3300025917 Bacteria 3270
132 Ga0207662_10000275 3300025918 Bacteria 23746
133 Ga0207662_10038594 3300025918 Bacteria 2799
134 Ga0207657_10022776 3300025919 Bacteria 5850
135 Ga0207652_10012381 3300025921 Bacteria 6892
136 Ga0207646_10000025 3300025922 Bacteria 248680
137 Ga0207646_10002325 3300025922 Bacteria 22515
138 Ga0207646_10004252 3300025922 Bacteria 15652
139 Ga0207646_10013908 3300025922 Bacteria 7673
140 Ga0207694_10000091 3300025924 Bacteria 101725
141 Ga0207650_10013284 3300025925 Bacteria 5699
142 Ga0207687_10000082 3300025927 Bacteria 69874
143 Ga0207687_10011078 3300025927 Bacteria 5895
144 Ga0207706_10026142 3300025933 Bacteria 5225
145 Ga0207670_10001223 3300025936 Bacteria 13568
146 Ga0207691_10095910 3300025940 Unclassified 2652
147 Ga0207711_10013117 3300025941 Bacteria 6881
148 Ga0207689_10013021 3300025942 Bacteria 7104
149 Ga0207689_10051383 3300025942 Bacteria 3398
150 Ga0207708_10002307 3300026075 Bacteria 14031
151 Ga0207641_10015603 3300026088 Bacteria 6226
152 Ga0207648_10006517 3300026089 Bacteria 11587
153 Ga0207676_10002930 3300026095 Bacteria 12156
154 Ga0207676_10067001 3300026095 Bacteria 2867
155 Ga0207676_10068019 3300026095 Bacteria 2847
156 Ga0207674_10001203 3300026116 Bacteria 33698
157 Ga0207675_100073898 3300026118 Bacteria 3190
158 Ga0207683_10009880 3300026121 Bacteria 8137
159 Ga0209998_10000068 3300027717 Bacteria 41101
160 Ga0209998_10002719 3300027717 Bacteria 3991
161 Ga0209974_10002079 3300027876 Bacteria 7323
162 Ga0209974_10004415 3300027876 Bacteria 5004
163 Ga0207428_10082170 3300027907 Bacteria 2514
164 Ga0268266_10000653 3300028379 Bacteria 46973
165 Ga0268265_10034399 3300028380 Bacteria 3693
166 Ga0268264_10012771 3300028381 Bacteria 6911
167 Ga0265319_1006576 3300028563 Bacteria 5367
168 Ga0265319_1008098 3300028563 Bacteria 4641
169 Ga0265334_10009945 3300028573 Bacteria 4022
170 Ga0307517_10043896 3300028786 Bacteria 4746
171 Ga0307515_10022187 3300028794 Bacteria 11203
172 Ga0265338_10024008 3300028800 Bacteria 6244
173 Ga0265320_10009540 3300031240 Bacteria 5847
174 Ga0265340_10019856 3300031247 Bacteria 3457
175 Ga0307513_10013164 3300031456 Bacteria 10164
176 Ga0307513_10052398 3300031456 Bacteria 4395
177 Ga0307509_10000035 3300031507 Bacteria 192339
178 Ga0307509_10012029 3300031507 Bacteria 10389
179 Ga0316576_10015129 3300031727 Bacteria 5170
180 Ga0307516_10013225 3300031730 Bacteria 8812
181 Ga0316577_10007193 3300031733 Bacteria 5924
182 Ga0307406_10010745 3300031901 Bacteria 5173
183 Ga0307415_100016063 3300032126 Bacteria 4450
184 Ga0373959_0000115 3300034820 Bacteria 17870
185 Ga0373929_0000002 3300035085 Bacteria 683932
186 Ga0373936_0000029 3300035113 Bacteria 116725
187 Ga0373943_0027740 3300035170 Bacteria 2663
188 Ga0373961_0000047 3300035241 Bacteria 72003
189 Ga0373961_0000214 3300035241 Bacteria 27320
190 Ga0373931_0011249 3300035691 Bacteria 4321
191 Ga0373935_0004204 3300035692 Bacteria 8435
192 Ga0373933_0001861 3300035724 Bacteria 12204
193 Ga0373925_0052545 3300037068 Bacteria 3045
194 Ga0395899_0001804 3300037312 Bacteria 17727
195 Ga0395899_0003646 3300037312 Bacteria 12195
196 Ga0395900_0037487 3300037418 Bacteria 4998
197 Ga0395900_0140120 3300037418 Bacteria 2477
198 Ga0395898_0095219 3300037466 Bacteria 2861
199 Ga0395905_0004533 3300037471 Bacteria 14386
200 Ga0436363_0919141 3300039450 Bacteria 5457
201 Ga0451577_0062160 3300042876 Bacteria 3330
202 Ga0453683_0027980 3300044673 Bacteria 3572
203 Ga0453684_0054978 3300044712 Bacteria 5179
204 Ga0453684_0105002 3300044712 Bacteria 3447
205 Ga0451576_0005452 3300045051 Bacteria 15954
206 Ga0495629_0004571 3300046459 Bacteria 10353
207 Ga0495638_0034079 3300046460 Bacteria 3252
208 Ga0495651_0038177 3300046462 Bacteria 3740
209 Ga0495582_0024573 3300046473 Bacteria 3298
210 Ga0495647_0001867 3300046681 Bacteria 6541
211 Ga0495672_0002520 3300047320 Bacteria 16725
212 Ga0495602_0063640 3300048088 Bacteria 3195
213 Ga0496103_0020950 3300048906 Bacteria 3931
214 Ga0496104_0023658 3300048907 Bacteria 5649
215 Ga0496110_0007780 3300048913 Bacteria 8586
216 Ga0496110_0097048 3300048913 Bacteria 2641
217 Ga0496111_0008830 3300048914 Bacteria 6697
218 Ga0496111_0052527 3300048914 Bacteria 2943
219 Ga0496111_0055795 3300048914 Bacteria 2857
220 Ga0496112_0000001 3300048915 Bacteria 1346031
221 Ga0496112_0005026 3300048915 Bacteria 11357
222 Ga0496112_0052044 3300048915 Bacteria 4018
223 Ga0496113_0013483 3300048916 Bacteria 5541
224 Ga0496113_0018239 3300048916 Bacteria 4886
225 Ga0496114_0000028 3300048917 Bacteria 177603
226 Ga0501031_0004111 3300049568 Bacteria 9400
227 Ga0501031_0030769 3300049568 Bacteria 3501
228 Ga0501034_0025036 3300049571 Bacteria 6072
229 Ga0501034_0056852 3300049571 Bacteria 3935
230 Ga0501036_0026631 3300049572 Bacteria 4884
231 Ga0501036_0032897 3300049572 Bacteria 4384
232 Ga0501036_0036161 3300049572 Bacteria 4178
233 Ga0501036_0045932 3300049572 Bacteria 3699
234 Ga0501038_0007040 3300049574 Bacteria 10388
235 Ga0501039_0003304 3300049575 Bacteria 12058
236 Ga0501039_0018374 3300049575 Bacteria 5366
237 Ga0501039_0049569 3300049575 Bacteria 3246
238 Ga0501040_0027249 3300049576 Bacteria 3846
239 Ga0501040_0031348 3300049576 Bacteria 3592
240 Ga0501041_0013812 3300049577 Bacteria 4787
241 Ga0501042_0005360 3300049578 Bacteria 8249
242 Ga0501046_0004613 3300049580 Bacteria 12446
243 Ga0501046_0048400 3300049580 Bacteria 3366
244 Ga0501048_0003436 3300049582 Bacteria 12031
245 Ga0501048_0019466 3300049582 Bacteria 4979
246 Ga0501067_0011464 3300049583 Bacteria 4909
247 Ga0501067_0029802 3300049583 Bacteria 3025
248 Ga0501068_0015846 3300049584 Bacteria 4339
249 Ga0501070_0016302 3300049586 Bacteria 6241
250 Ga0501070_0043597 3300049586 Bacteria 3733
251 Ga0501071_0002208 3300049587 Bacteria 11713
252 Ga0501071_0003576 3300049587 Bacteria 9729
253 Ga0501072_0002287 3300049588 Bacteria 14332
254 Ga0501072_0006678 3300049588 Bacteria 8773
255 Ga0501072_0017465 3300049588 Bacteria 5513
256 Ga0501072_0096926 3300049588 Unclassified 2344
257 Ga0501074_0032915 3300049590 Bacteria 3756
258 Ga0501074_0050631 3300049590 Bacteria 2998
259 Ga0501075_0004124 3300049591 Bacteria 9815
260 Ga0501076_0000838 3300049592 Bacteria 19981
261 Ga0501076_0006829 3300049592 Bacteria 8282
262 Ga0501076_0008909 3300049592 Bacteria 7383
263 Ga0501076_0020759 3300049592 Bacteria 5030
264 Ga0501076_0043996 3300049592 Bacteria 3521
265 Ga0501077_0000043 3300049593 Bacteria 64691
266 Ga0501077_0010470 3300049593 Bacteria 5772
267 Ga0501079_0001002 3300049741 Bacteria 19530
268 Ga0501079_0003882 3300049741 Bacteria 11023
269 Ga0501079_0025710 3300049741 Bacteria 4514
270 Ga0501080_0002363 3300049742 Bacteria 16454
271 Ga0501080_0018229 3300049742 Bacteria 6497
272 Ga0501080_0054734 3300049742 Bacteria 3715
273 Ga0501081_0000965 3300049743 Bacteria 17093
274 Ga0501081_0066839 3300049743 Bacteria 2500
275 Ga0501035_0004529 3300049822 Bacteria 13191
276 Ga0501035_0059998 3300049822 Bacteria 3387
277 Ga0501045_0001583 3300049824 Bacteria 15178
278 Ga0501045_0006580 3300049824 Bacteria 8049
279 Ga0501045_0012848 3300049824 Bacteria 5902
280 nmdc:mga00v17_39447_c1 3300050491 Bacteria 2828
281 nmdc:mga05p37_104846_c1 3300050507 Bacteria 3478
282 nmdc:mga05p37_237_c1 3300050507 Bacteria 56213
283 nmdc:mga05p37_34732_c1 3300050507 Bacteria 6176
284 nmdc:mga05p37_4949_c1 3300050507 Bacteria 15610
285 nmdc:mga05p37_657_c1 3300050507 Bacteria 38229
286 nmdc:mga09592_27017_c1 3300050508 Bacteria 4759
287 nmdc:mga06r32_37831_c1 3300050510 Bacteria 4566
288 nmdc:mga08y16_526_c1 3300050511 Bacteria 35368
289 nmdc:mga08y16_56498_c1 3300050511 Bacteria 4101
290 nmdc:mga0n895_36145_c1 3300050512 Bacteria 4768
291 nmdc:mga0n895_99418_c1 3300050512 Bacteria 2917
292 nmdc:mga0rr50_89450_c1 3300050513 Bacteria 2394
293 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
294 nmdc:mga0a205_24314_c1 3300050515 Bacteria 5759
295 Ga0495612_0000572 3300053078 Bacteria 14815
296 Ga0495619_0069098 3300053085 Unclassified 2360
297 Ga0500566_0001235 3300053094 Bacteria 14960
298 Ga0500566_0032470 3300053094 Bacteria 3045
299 Ga0500640_000291 3300053095 Bacteria 11290
300 Ga0500641_0003780 3300053096 Bacteria 5352
301 Ga0500554_000033 3300053102 Bacteria 23156
302 Ga0500555_000818 3300053103 Bacteria 11167
303 Ga0500595_000429 3300053119 Bacteria 26482
304 Ga0500614_000091 3300053123 Bacteria 20831
305 Ga0500559_0002717 3300053136 Bacteria 8981
306 Ga0500616_0000549 3300053153 Bacteria 46665
307 Ga0501084_0002142 3300054114 Bacteria 15780
308 Ga0501084_0006642 3300054114 Bacteria 9517
309 Ga0501084_0010401 3300054114 Bacteria 7693
310 Ga0501084_0014638 3300054114 Bacteria 6503
311 Ga0501084_0025229 3300054114 Bacteria 4958
312 Ga0501084_0032681 3300054114 Bacteria 4353
313 Ga0501082_0001525 3300060353 Bacteria 20369
314 Ga0501082_0006396 3300060353 Bacteria 10219
315 Ga0501082_0026039 3300060353 Bacteria 5042
316 Ga0501082_0054109 3300060353 Bacteria 3460
317 Ga0530510_0011912 3300061734 Bacteria 6102
318 Ga0530510_0017417 3300061734 Bacteria 5092
319 Ga0530510_0043067 3300061734 Bacteria 3260
320 Ga0496108_0018595
321 Ga0070683_100004894
322 Ga0070683_100044029
323 Ga0070690_100020009
324 Ga0070670_100037382
325 Ga0068869_100039949
326 Ga0070680_100000002
327 Ga0070680_100025531
328 Ga0070682_100009388
329 Ga0070660_100014055
330 Ga0070689_100006178
331 Ga0070661_100002349
332 Ga0070669_100001394
333 Ga0070674_100011662
334 Ga0070688_100011217
335 Ga0070659_100028891
336 Ga0070659_100048810
337 Ga0070703_10002771
338 Ga0070703_10008228
339 Ga0070709_10000012
340 Ga0070701_10015327
341 Ga0070711_100000002
342 Ga0070694_100002190
343 Ga0070694_100042933
344 Ga0070708_100000072
345 Ga0070708_100000978
346 Ga0070708_100004168
347 Ga0070708_100007861
348 Ga0070663_100009977
349 Ga0070678_100005310
350 Ga0070681_10033221
351 Ga0070681_10044771
352 Ga0070685_10000605
353 Ga0070706_100000061
354 Ga0070706_100000121
355 Ga0070706_100026371
356 Ga0070706_100033176
357 Ga0070706_100040217
358 Ga0070706_100085460
359 Ga0070706_100089793
360 Ga0070706_100099297
361 Ga0070707_100000015
362 Ga0070707_100012690
363 Ga0070707_100016612
364 Ga0070707_100033483
365 Ga0070707_100037732
366 Ga0070707_100041196
367 Ga0070698_100003553
368 Ga0070698_100012460
369 Ga0070698_100015821
370 Ga0070698_100020791
371 Ga0070699_100000144
372 Ga0070679_100004400
373 Ga0070679_100038283
374 Ga0070684_100133166
375 Ga0070697_100013756
376 Ga0070696_100000843
377 Ga0070696_100004445
378 Ga0070693_100015591
379 Ga0070665_100000351
380 Ga0070704_100007143
381 Ga0070704_100024027
382 Ga0070704_100057267
383 Ga0068856_100034807
384 Ga0070702_100004323
385 Ga0068859_100000028
386 Ga0068859_100012195
387 Ga0068859_100135479
388 Ga0068864_100009473
389 Ga0068864_100081190
390 Ga0068864_100086368
391 Ga0068863_100005240
392 Ga0068858_100056251
393 Ga0068860_100007107
394 Ga0068862_100014911
395 Ga0081455_10031476
396 Ga0081539_10003597
397 Ga0081539_10010283
398 Ga0070717_10029868
399 Ga0097621_100114267
400 Ga0075428_100001253
401 Ga0075428_100003030
402 Ga0075428_100047420
403 Ga0075431_100048163
404 Ga0075431_100118771
405 Ga0075434_100043989
406 Ga0075429_100015928
407 Ga0075436_100000128
408 Ga0075436_100011265
409 Ga0097620_100000028
410 Ga0097620_100012194
411 Ga0097620_100135484
412 Ga0111539_10037568
413 Ga0111539_10065782
414 Ga0105245_10000136
415 Ga0105245_10023585
416 Ga0105247_10000988
417 Ga0114129_10001692
418 Ga0114129_10003675
419 Ga0114129_10005363
420 Ga0114129_10042648
421 Ga0105241_10005341
422 Ga0105242_10030342
423 Ga0105248_10005865
424 Ga0105238_10000923
425 Ga0105238_10044576
426 Ga0105239_10114161
427 Ga0157374_10019320
428 Ga0157378_10050385
429 Ga0157378_10062451
430 Ga0157378_10067888
431 Ga0163162_10091531
432 Ga0157375_10031076
433 Ga0163163_10016612
434 Ga0157377_10042874
435 Ga0157379_10018541
436 Ga0157376_10066945
437 Ga0163161_10012487
438 Ga0207653_10000015
439 Ga0207710_10003831
440 Ga0207699_10000087
441 Ga0207643_10012216
442 Ga0207684_10000138
443 Ga0207684_10027339
444 Ga0207684_10063908
445 Ga0207684_10067021
446 Ga0207707_10030574
447 Ga0207707_10051747
448 Ga0207663_10000022
449 Ga0207660_10000002
450 Ga0207660_10040293
451 Ga0207662_10000275
452 Ga0207662_10038594
453 Ga0207657_10022776
454 Ga0207652_10012381
455 Ga0207646_10000025
456 Ga0207646_10002325
457 Ga0207646_10004252
458 Ga0207646_10013908
459 Ga0207694_10000091
460 Ga0207650_10013284
461 Ga0207687_10000082
462 Ga0207687_10011078
463 Ga0207706_10026142
464 Ga0207670_10001223
465 Ga0207691_10095910
466 Ga0207711_10013117
467 Ga0207689_10013021
468 Ga0207689_10051383
469 Ga0207708_10002307
470 Ga0207641_10015603
471 Ga0207648_10006517
472 Ga0207676_10002930
473 Ga0207676_10067001
474 Ga0207676_10068019
475 Ga0207674_10001203
476 Ga0207675_100073898
477 Ga0207683_10009880
478 Ga0209998_10000068
479 Ga0209998_10002719
480 Ga0209974_10002079
481 Ga0209974_10004415
482 Ga0207428_10082170
483 Ga0268266_10000653
484 Ga0268265_10034399
485 Ga0268264_10012771
486 Ga0265319_1006576
487 Ga0265319_1008098
488 Ga0265334_10009945
489 Ga0307517_10043896
490 Ga0307515_10022187
491 Ga0265338_10024008
492 Ga0265320_10009540
493 Ga0265340_10019856
494 Ga0307513_10013164
495 Ga0307513_10052398
496 Ga0307509_10000035
497 Ga0307509_10012029
498 Ga0316576_10015129
499 Ga0307516_10013225
500 Ga0316577_10007193
501 Ga0307406_10010745
502 Ga0307415_100016063
503 Ga0373959_0000115
504 Ga0373929_0000002
505 Ga0373936_0000029
506 Ga0373943_0027740
507 Ga0373961_0000047
508 Ga0373961_0000214
509 Ga0373931_0011249
510 Ga0373935_0004204
511 Ga0373933_0001861
512 Ga0373925_0052545
513 Ga0395899_0001804
514 Ga0395899_0003646
515 Ga0395900_0037487
516 Ga0395900_0140120
517 Ga0395898_0095219
518 Ga0395905_0004533
519 Ga0436363_0919141
520 Ga0451577_0062160
521 Ga0453683_0027980
522 Ga0453684_0054978
523 Ga0453684_0105002
524 Ga0451576_0005452
525 Ga0495629_0004571
526 Ga0495638_0034079
527 Ga0495651_0038177
528 Ga0495582_0024573
529 Ga0495647_0001867
530 Ga0495672_0002520
531 Ga0495602_0063640
532 Ga0496103_0020950
533 Ga0496104_0023658
534 Ga0496110_0007780
535 Ga0496110_0097048
536 Ga0496111_0008830
537 Ga0496111_0052527
538 Ga0496111_0055795
539 Ga0496112_0000001
540 Ga0496112_0005026
541 Ga0496112_0052044
542 Ga0496113_0013483
543 Ga0496113_0018239
544 Ga0496114_0000028
545 Ga0501031_0004111
546 Ga0501031_0030769
547 Ga0501034_0025036
548 Ga0501034_0056852
549 Ga0501036_0026631
550 Ga0501036_0032897
551 Ga0501036_0036161
552 Ga0501036_0045932
553 Ga0501038_0007040
554 Ga0501039_0003304
555 Ga0501039_0018374
556 Ga0501039_0049569
557 Ga0501040_0027249
558 Ga0501040_0031348
559 Ga0501041_0013812
560 Ga0501042_0005360
561 Ga0501046_0004613
562 Ga0501046_0048400
563 Ga0501048_0003436
564 Ga0501048_0019466
565 Ga0501067_0011464
566 Ga0501067_0029802
567 Ga0501068_0015846
568 Ga0501070_0016302
569 Ga0501070_0043597
570 Ga0501071_0002208
571 Ga0501071_0003576
572 Ga0501072_0002287
573 Ga0501072_0006678
574 Ga0501072_0017465
575 Ga0501072_0096926
576 Ga0501074_0032915
577 Ga0501074_0050631
578 Ga0501075_0004124
579 Ga0501076_0000838
580 Ga0501076_0006829
581 Ga0501076_0008909
582 Ga0501076_0020759
583 Ga0501076_0043996
584 Ga0501077_0000043
585 Ga0501077_0010470
586 Ga0501079_0001002
587 Ga0501079_0003882
588 Ga0501079_0025710
589 Ga0501080_0002363
590 Ga0501080_0018229
591 Ga0501080_0054734
592 Ga0501081_0000965
593 Ga0501081_0066839
594 Ga0501035_0004529
595 Ga0501035_0059998
596 Ga0501045_0001583
597 Ga0501045_0006580
598 Ga0501045_0012848
599 nmdc:mga00v17_39447_c1
600 nmdc:mga05p37_104846_c1
601 nmdc:mga05p37_237_c1
602 nmdc:mga05p37_34732_c1
603 nmdc:mga05p37_4949_c1
604 nmdc:mga05p37_657_c1
605 nmdc:mga09592_27017_c1
606 nmdc:mga06r32_37831_c1
607 nmdc:mga08y16_526_c1
608 nmdc:mga08y16_56498_c1
609 nmdc:mga0n895_36145_c1
610 nmdc:mga0n895_99418_c1
611 nmdc:mga0rr50_89450_c1
612 nmdc:mga08x19_2_c1
613 nmdc:mga0a205_24314_c1
614 Ga0495612_0000572
615 Ga0495619_0069098
616 Ga0500566_0001235
617 Ga0500566_0032470
618 Ga0500640_000291
619 Ga0500641_0003780
620 Ga0500554_000033
621 Ga0500555_000818
622 Ga0500595_000429
623 Ga0500614_000091
624 Ga0500559_0002717
625 Ga0500616_0000549
626 Ga0501084_0002142
627 Ga0501084_0006642
628 Ga0501084_0010401
629 Ga0501084_0014638
630 Ga0501084_0025229
631 Ga0501084_0032681
632 Ga0501082_0001525
633 Ga0501082_0006396
634 Ga0501082_0026039
635 Ga0501082_0054109
636 Ga0530510_0011912
637 Ga0530510_0017417
638 Ga0530510_0043067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02738

MoCoBD_1

Molybdopterin cofactor-binding domain

228

473

0.96

PF20256

MoCoBD_2

Molybdopterin cofactor-binding domain

498

778

0.91

PF01315

Ald_Xan_dh_C

Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain

118

225

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3am9-assembly1.cif.gz_B complex of bovine xanthine dehydrogenase and trihydroxy fyx-051 0.9422 5 696
3hrd-assembly1.cif.gz_E crystal structure of nicotinate dehydrogenase 0.9419 8 398
3unc-assembly1.cif.gz_B crystal structure of bovine milk xanthine dehydrogenase to 1.65a resolution 0.941 5 696
3b9j-assembly2.cif.gz_K structure of xanthine oxidase with 2-hydroxy-6-methylpurine 0.9408 6 696
1v97-assembly1.cif.gz_A crystal structure of bovine milk xanthine dehydrogenase fyx-051 bound form 0.9405 5 696
ID Description Score Start End Superfamily
3hrdE02 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.9569 135 398 3.30.365.10
3zyvA08 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.9368 135 381 3.30.365.10
af_B7F856_210_321_3.30.365.10 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.9338 260 370 3.30.365.10
af_Q46799_603_751_3.30.365.10 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.9313 561 696 3.30.365.10
3hrdF01 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.9305 560 696 3.30.365.10
ID Description Score Start End GO Terms
AF-A0A7V8E4K5-F1-model_v4 Molybdopterin binding aldehyde oxidase and xanthine dehydrogenase 0.9821 4 702 GO:0005506
GO:0016491
AF-A0A7W0QNE6-F1-model_v4 Xanthine dehydrogenase family protein 0.97 5 368 GO:0005506
GO:0016491
AF-A0A7G3BH06-F1-model_v4 deleted 0.9681 260 396
AF-A0A2V7PT38-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9676 46 686 GO:0005506
GO:0016491
GO:0051537
AF-A0A7V6WIS5-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9666 249 399 GO:0005506
GO:0016491

Map