F405288

General Info

Members Datasets Scaffolds Average Seq Length
319 210 638 114

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0013373|Ga0501073_0013373_364_720
Length 118
Sequence MSGYTGPFGDLWFYLLLILVGFLPNEIWRWLGLIVARGLDEDSEVLVWVRAVATAILAAVIAKLTIFAPGSLAAIPLWLRLLAVATGFAGFVLIRRSVFAGVATAEIVLIGGALLLGL

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
152 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
153 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 2643221651 Afipia sp. Root123D2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.12
Nodule 0
Rhizoplane 2.82
Rhizosphere 74.92
Stem 0
Stem Tuber 0
Unclassified 5.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0013373 3300049589 Bacteria 5973
2 Ga0065712_10384419 3300005290 Bacteria 748
3 Ga0070676_11199820 3300005328 Bacteria 577
4 Ga0070676_11455620 3300005328 Bacteria 527
5 Ga0070683_100256665 3300005329 Bacteria 1663
6 Ga0070690_101590318 3300005330 Unclassified 530
7 Ga0070670_100877229 3300005331 Bacteria 812
8 Ga0070670_100966254 3300005331 Bacteria 774
9 Ga0070677_10047388 3300005333 Bacteria 1723
10 Ga0068869_100428519 3300005334 Bacteria 1093
11 Ga0070666_10132820 3300005335 Bacteria 1730
12 Ga0070682_101613089 3300005337 Bacteria 561
13 Ga0068868_102195052 3300005338 Bacteria 526
14 Ga0070689_100257810 3300005340 Bacteria 1440
15 Ga0070689_100437921 3300005340 Bacteria 1110
16 Ga0070689_101167187 3300005340 Bacteria 690
17 Ga0070687_100264262 3300005343 Bacteria 1075
18 Ga0070661_100063245 3300005344 Bacteria 2718
19 Ga0070675_100432352 3300005354 Bacteria 1178
20 Ga0070675_100943432 3300005354 Bacteria 791
21 Ga0070674_100007359 3300005356 Bacteria 6491
22 Ga0070673_100693713 3300005364 Bacteria 934
23 Ga0070673_100694607 3300005364 Bacteria 934
24 Ga0070673_101125560 3300005364 Bacteria 734
25 Ga0070659_100676583 3300005366 Bacteria 891
26 Ga0070694_100719680 3300005444 Bacteria 813
27 Ga0070663_101588511 3300005455 Bacteria 583
28 Ga0070678_100471943 3300005456 Bacteria 1102
29 Ga0070662_100981059 3300005457 Bacteria 723
30 Ga0070685_10131857 3300005466 Bacteria 1563
31 Ga0070685_10173087 3300005466 Bacteria 1385
32 Ga0070679_100996605 3300005530 Bacteria 782
33 Ga0068853_100403185 3300005539 Bacteria 1280
34 Ga0068853_100928141 3300005539 Bacteria 836
35 Ga0068853_101782166 3300005539 Bacteria 597
36 Ga0070672_100353834 3300005543 Bacteria 1252
37 Ga0070686_100748120 3300005544 Bacteria 784
38 Ga0070704_100585474 3300005549 Bacteria 979
39 Ga0070664_100062693 3300005564 Bacteria 3170
40 Ga0068857_100235972 3300005577 Bacteria 1673
41 Ga0068856_100890793 3300005614 Bacteria 909
42 Ga0068856_101799785 3300005614 Bacteria 624
43 Ga0070702_100128411 3300005615 Bacteria 1598
44 Ga0068859_100029162 3300005617 Bacteria 5538
45 Ga0068859_101056998 3300005617 Bacteria 892
46 Ga0068859_102559224 3300005617 Bacteria 562
47 Ga0068864_100314321 3300005618 Bacteria 1469
48 Ga0068861_100684815 3300005719 Bacteria 951
49 Ga0068863_100375650 3300005841 Bacteria 1387
50 Ga0068858_100228488 3300005842 Bacteria 1764
51 Ga0068858_101841475 3300005842 Bacteria 598
52 Ga0068862_100283971 3300005844 Bacteria 1518
53 Ga0068862_100659725 3300005844 Bacteria 1010
54 Ga0075365_10166466 3300006038 Bacteria 1538
55 Ga0075365_10257651 3300006038 Bacteria 1226
56 Ga0075365_10453671 3300006038 Unclassified 905
57 Ga0075365_10569967 3300006038 Bacteria 801
58 Ga0075365_11176635 3300006038 Archaea 539
59 Ga0075368_10009564 3300006042 Bacteria 3486
60 Ga0075368_10033316 3300006042 Bacteria 2004
61 Ga0075368_10141649 3300006042 Bacteria 1002
62 Ga0075368_10332212 3300006042 Bacteria 659
63 Ga0075363_100008266 3300006048 Bacteria 4837
64 Ga0075363_100027296 3300006048 Bacteria 2926
65 Ga0075364_10009163 3300006051 Bacteria 5929
66 Ga0075364_10059110 3300006051 Bacteria 2513
67 Ga0075364_10635000 3300006051 Bacteria 729
68 Ga0070715_11018072 3300006163 Unclassified 517
69 Ga0070716_100905509 3300006173 Bacteria 691
70 Ga0075362_10084872 3300006177 Bacteria 1463
71 Ga0075367_10087404 3300006178 Bacteria 1893
72 Ga0075367_10094237 3300006178 Bacteria 1825
73 Ga0075367_10212310 3300006178 Bacteria 1210
74 Ga0075367_10853840 3300006178 Bacteria 580
75 Ga0075369_10577199 3300006186 Archaea 537
76 Ga0075366_10053942 3300006195 Bacteria 2388
77 Ga0075366_10063466 3300006195 Bacteria 2196
78 Ga0075366_10394637 3300006195 Bacteria 851
79 Ga0075366_10472310 3300006195 Bacteria 774
80 Ga0075370_10006046 3300006353 Bacteria 6064
81 Ga0075370_10051901 3300006353 Bacteria 2326
82 Ga0075370_10169700 3300006353 Unclassified 1282
83 Ga0075430_101028532 3300006846 Bacteria 679
84 Ga0068865_100912363 3300006881 Bacteria 765
85 Ga0068865_101084024 3300006881 Bacteria 705
86 Ga0097620_100029158 3300006931 Bacteria 5538
87 Ga0097620_101057060 3300006931 Bacteria 892
88 Ga0097620_102559156 3300006931 Bacteria 562
89 Ga0105244_10481567 3300009036 Bacteria 571
90 Ga0111539_11209932 3300009094 Bacteria 877
91 Ga0105245_10246850 3300009098 Bacteria 1733
92 Ga0105245_10916295 3300009098 Bacteria 918
93 Ga0105247_10004521 3300009101 Bacteria 8869
94 Ga0105247_11514162 3300009101 Bacteria 547
95 Ga0114129_10836421 3300009147 Bacteria 1171
96 Ga0114129_11027917 3300009147 Bacteria 1036
97 Ga0114129_12147996 3300009147 Unclassified 673
98 Ga0105243_10595108 3300009148 Bacteria 1064
99 Ga0105243_11635894 3300009148 Unclassified 671
100 Ga0105241_10854134 3300009174 Bacteria 842
101 Ga0105248_10246779 3300009177 Bacteria 2010
102 Ga0105237_12574984 3300009545 Unclassified 519
103 Ga0105238_12558517 3300009551 Bacteria 546
104 Ga0105249_10018980 3300009553 Bacteria 6131
105 Ga0105249_10912883 3300009553 Bacteria 945
106 Ga0105246_10621712 3300011119 Bacteria 936
107 Ga0157378_10464223 3300013297 Bacteria 1259
108 Ga0163162_10169876 3300013306 Bacteria 2305
109 Ga0157375_11913200 3300013308 Bacteria 704
110 Ga0157375_12963669 3300013308 Bacteria 567
111 Ga0163163_10096060 3300014325 Bacteria 2984
112 Ga0157380_10214988 3300014326 Bacteria 1716
113 Ga0157380_10362930 3300014326 Bacteria 1360
114 Ga0157380_10377873 3300014326 Bacteria 1336
115 Ga0157380_11546510 3300014326 Bacteria 718
116 Ga0157377_11537123 3300014745 Bacteria 530
117 Ga0157379_10684354 3300014968 Bacteria 962
118 Ga0157376_10548267 3300014969 Bacteria 1144
119 Ga0182007_10415571 3300015262 Bacteria 514
120 Ga0163161_10703609 3300017792 Bacteria 841
121 Ga0213876_10022285 3300021384 Bacteria 3351
122 Ga0213875_10000089 3300021388 Bacteria 105772
123 Ga0207692_10673908 3300025898 Bacteria 669
124 Ga0207710_10017462 3300025900 Bacteria 3044
125 Ga0207688_10078028 3300025901 Bacteria 1888
126 Ga0207680_10409391 3300025903 Bacteria 959
127 Ga0207699_10679290 3300025906 Bacteria 753
128 Ga0207645_10049980 3300025907 Bacteria 2670
129 Ga0207643_10348010 3300025908 Bacteria 930
130 Ga0207671_10670514 3300025914 Unclassified 825
131 Ga0207693_10040477 3300025915 Bacteria 3671
132 Ga0207662_10044896 3300025918 Bacteria 2611
133 Ga0207662_10074828 3300025918 Bacteria 2056
134 Ga0207681_10862010 3300025923 Bacteria 758
135 Ga0207650_10584228 3300025925 Bacteria 938
136 Ga0207650_10605438 3300025925 Bacteria 922
137 Ga0207659_10024097 3300025926 Bacteria 4073
138 Ga0207664_10297210 3300025929 Bacteria 1420
139 Ga0207664_10331062 3300025929 Bacteria 1345
140 Ga0207644_10534316 3300025931 Bacteria 970
141 Ga0207690_10123259 3300025932 Bacteria 1886
142 Ga0207706_11087452 3300025933 Bacteria 669
143 Ga0207709_10057782 3300025935 Bacteria 2407
144 Ga0207709_11775421 3300025935 Bacteria 513
145 Ga0207670_10122386 3300025936 Bacteria 1893
146 Ga0207670_10300917 3300025936 Bacteria 1256
147 Ga0207669_10023893 3300025937 Bacteria 3274
148 Ga0207669_10568555 3300025937 Bacteria 917
149 Ga0207704_11488167 3300025938 Bacteria 581
150 Ga0207665_10470792 3300025939 Bacteria 967
151 Ga0207691_10010655 3300025940 Bacteria 8823
152 Ga0207691_10353395 3300025940 Bacteria 1257
153 Ga0207689_10071920 3300025942 Bacteria 2841
154 Ga0207661_10240522 3300025944 Bacteria 1606
155 Ga0207679_10012081 3300025945 Bacteria 5617
156 Ga0207712_10129314 3300025961 Bacteria 1922
157 Ga0207712_10290009 3300025961 Bacteria 1339
158 Ga0207658_10278629 3300025986 Bacteria 1433
159 Ga0207703_10130177 3300026035 Bacteria 2172
160 Ga0207703_10653706 3300026035 Bacteria 997
161 Ga0207639_11287013 3300026041 Unclassified 686
162 Ga0207702_10211821 3300026078 Bacteria 1802
163 Ga0207648_10073130 3300026089 Bacteria 2988
164 Ga0207648_11462247 3300026089 Bacteria 642
165 Ga0207676_11524896 3300026095 Bacteria 665
166 Ga0207674_10042094 3300026116 Bacteria 4720
167 Ga0207674_10357913 3300026116 Bacteria 1411
168 Ga0207675_101023894 3300026118 Bacteria 844
169 Ga0207683_10091575 3300026121 Bacteria 2709
170 Ga0209813_10064933 3300027866 Unclassified 1174
171 Ga0209813_10199313 3300027866 Bacteria 740
172 Ga0207428_10071707 3300027907 Bacteria 2720
173 Ga0268265_10644904 3300028380 Bacteria 1017
174 Ga0268265_11125504 3300028380 Bacteria 780
175 Ga0265318_10006928 3300028577 Bacteria 5167
176 Ga0265338_10798962 3300028800 Bacteria 647
177 Ga0265330_10015779 3300031235 Bacteria 3490
178 Ga0265332_10009552 3300031238 Bacteria 4327
179 Ga0265332_10033849 3300031238 Bacteria 2223
180 Ga0265328_10044224 3300031239 Bacteria 1638
181 Ga0265320_10028218 3300031240 Bacteria 2917
182 Ga0265325_10001543 3300031241 Bacteria 16115
183 Ga0265325_10025608 3300031241 Bacteria 3202
184 Ga0265325_10418113 3300031241 Bacteria 586
185 Ga0265340_10002004 3300031247 Bacteria 11653
186 Ga0265340_10002924 3300031247 Bacteria 9729
187 Ga0265340_10229858 3300031247 Bacteria 829
188 Ga0265339_10005207 3300031249 Bacteria 8700
189 Ga0265339_10009320 3300031249 Bacteria 6177
190 Ga0265339_10198112 3300031249 Bacteria 992
191 Ga0265331_10030138 3300031250 Bacteria 2702
192 Ga0265331_10076637 3300031250 Bacteria 1558
193 Ga0307513_11071418 3300031456 Bacteria 517
194 Ga0265313_10008906 3300031595 Bacteria 6598
195 Ga0316575_10029197 3300031665 Bacteria 2153
196 Ga0265314_10029089 3300031711 Bacteria 4111
197 Ga0265314_10036130 3300031711 Bacteria 3594
198 Ga0265342_10000011 3300031712 Bacteria 208435
199 Ga0265342_10123165 3300031712 Bacteria 1458
200 Ga0307405_11924267 3300031731 Bacteria 528
201 Ga0307410_12143030 3300031852 Bacteria 500
202 Ga0316583_10321473 3300032133 Unclassified 535
203 Ga0373934_0270074 3300035086 Bacteria 704
204 Ga0373953_0212832 3300035117 Bacteria 837
205 Ga0373954_0025553 3300035118 Bacteria 2701
206 Ga0373954_0050111 3300035118 Bacteria 1959
207 Ga0373956_0103353 3300035119 Bacteria 1323
208 Ga0316574_0002736 3300035398 Bacteria 8938
209 Ga0373931_0248890 3300035691 Bacteria 1080
210 Ga0373935_0156341 3300035692 Bacteria 1551
211 Ga0373935_0206416 3300035692 Bacteria 1360
212 Ga0373937_0018774 3300036401 Bacteria 6180
213 Ga0373937_1198778 3300036401 Bacteria 708
214 Ga0316584_0060707 3300036712 Bacteria 2832
215 Ga0373925_0549865 3300037068 Bacteria 949
216 Ga0436364_0673172 3300037853 Bacteria 1295
217 Ga0436364_1161738 3300037853 Bacteria 883
218 Ga0436364_1470117 3300037853 Bacteria 17732
219 Ga0436365_1057834 3300039437 Bacteria 10797
220 Ga0436361_0796970 3300039447 Bacteria 535
221 Ga0439453_0004847 3300041408 Bacteria 2021
222 Ga0451807_1074311 3300041486 Bacteria 555
223 Ga0451849_1368777 3300041505 Bacteria 688
224 Ga0451853_0411474 3300041512 Bacteria 544
225 Ga0439441_129128 3300042001 Bacteria 584
226 Ga0439443_003054 3300042003 Bacteria 2071
227 Ga0439456_028097 3300042013 Bacteria 1200
228 Ga0439435_0003094 3300042436 Bacteria 3414
229 Ga0439464_0195446 3300042439 Bacteria 644
230 Ga0439460_0118770 3300042461 Bacteria 863
231 Ga0450893_0057821 3300042532 Unclassified 736
232 Ga0466968_0494777 3300044735 Bacteria 609
233 Ga0495592_0129235 3300046454 Bacteria 1769
234 Ga0495638_0044965 3300046460 Bacteria 2780
235 Ga0495638_0603290 3300046460 Bacteria 539
236 Ga0495643_0218710 3300046522 Bacteria 905
237 Ga0495598_0001349 3300046537 Bacteria 4820
238 Ga0495621_0015652 3300046539 Bacteria 2421
239 Ga0495656_0168412 3300046615 Bacteria 1069
240 Ga0495668_0064825 3300046616 Bacteria 2011
241 Ga0495599_0453491 3300046678 Bacteria 759
242 Ga0495646_0713540 3300046680 Bacteria 504
243 Ga0495685_141300 3300047447 Bacteria 784
244 Ga0495615_0035636 3300048090 Bacteria 1217
245 Ga0496100_0228857 3300048903 Unclassified 1367
246 Ga0496104_0183798 3300048907 Bacteria 2001
247 Ga0496107_0092449 3300048910 Bacteria 2212
248 Ga0496109_0545431 3300048912 Bacteria 1094
249 Ga0496109_1275903 3300048912 Bacteria 671
250 Ga0496109_1849473 3300048912 Bacteria 537
251 Ga0496110_0432169 3300048913 Bacteria 1200
252 Ga0496112_0449646 3300048915 Bacteria 1226
253 Ga0501034_0350333 3300049571 Unclassified 1405
254 Ga0501034_0719427 3300049571 Bacteria 896
255 Ga0501047_0133350 3300049581 Bacteria 2364
256 Ga0501067_0037402 3300049583 Bacteria 2696
257 Ga0501068_0308070 3300049584 Bacteria 1014
258 Ga0501069_0790446 3300049585 Bacteria 575
259 Ga0501072_0013044 3300049588 Bacteria 6361
260 Ga0501072_0232726 3300049588 Bacteria 1468
261 Ga0501074_0124370 3300049590 Bacteria 1844
262 Ga0501074_0261433 3300049590 Unclassified 1230
263 Ga0501079_0248974 3300049741 Bacteria 1389
264 Ga0501080_0053208 3300049742 Bacteria 3768
265 Ga0501080_1043088 3300049742 Bacteria 708
266 Ga0501083_0037150 3300049744 Bacteria 3318
267 Ga0501083_0093313 3300049744 Bacteria 1987
268 Ga0501083_0222331 3300049744 Bacteria 1230
269 Ga0501035_0440613 3300049822 Bacteria 1079
270 Ga0501044_0067871 3300049823 Bacteria 3633
271 Ga0501044_0188091 3300049823 Bacteria 2029
272 nmdc:mga03n38_621567_c1 3300050490 Unclassified 617
273 nmdc:mga03n38_639302_c1 3300050490 Bacteria 609
274 nmdc:mga03n38_77942_c1 3300050490 Bacteria 1550
275 nmdc:mga00v17_115333_c1 3300050491 Bacteria 1707
276 nmdc:mga00v17_186027_c1 3300050491 Bacteria 1341
277 nmdc:mga00v17_8476_c1 3300050491 Bacteria 2551
278 nmdc:mga0yw44_1151223_c1 3300050492 Archaea 524
279 nmdc:mga0yw44_34416_c1 3300050492 Bacteria 2968
280 nmdc:mga0yw44_728258_c1 3300050492 Bacteria 674
281 nmdc:mga0k408_410341_c1 3300050493 Bacteria 806
282 nmdc:mga0k408_65576_c1 3300050493 Bacteria 2114
283 nmdc:mga0k408_688635_c1 3300050493 Bacteria 599
284 nmdc:mga06z11_11724_c1 3300050494 Bacteria 3789
285 nmdc:mga06z11_158336_c1 3300050494 Bacteria 1293
286 nmdc:mga06z11_464307_c1 3300050494 Bacteria 765
287 nmdc:mga06z11_494695_c1 3300050494 Unclassified 741
288 nmdc:mga06z11_6671_c1 3300050494 Bacteria 4718
289 nmdc:mga06z11_714771_c1 3300050494 Bacteria 610
290 nmdc:mga04h51_140363_c1 3300050495 Bacteria 916
291 nmdc:mga04h51_237497_c1 3300050495 Bacteria 727
292 nmdc:mga07m45_178002_c1 3300050496 Bacteria 1237
293 nmdc:mga07m45_339687_c1 3300050496 Bacteria 873
294 nmdc:mga05p37_1468243_c1 3300050507 Bacteria 681
295 nmdc:mga05p37_888706_c1 3300050507 Bacteria 962
296 nmdc:mga0qj67_416352_c1 3300050509 Bacteria 1083
297 nmdc:mga0qj67_862480_c1 3300050509 Bacteria 715
298 nmdc:mga06r32_1461296_c1 3300050510 Bacteria 624
299 nmdc:mga08y16_1203242_c1 3300050511 Bacteria 728
300 nmdc:mga08y16_42072_c1 3300050511 Bacteria 4785
301 nmdc:mga0sz30_202861_c1 3300050516 Bacteria 880
302 nmdc:mga0sz30_523448_c1 3300050516 Bacteria 534
303 Ga0495601_0442601 3300053077 Bacteria 841
304 Ga0495595_0121728 3300053084 Bacteria 1271
305 Ga0500646_0091142 3300053090 Bacteria 944
306 Ga0500641_0090563 3300053096 Bacteria 1305
307 Ga0500641_0188634 3300053096 Bacteria 883
308 Ga0500593_061465 3300053117 Bacteria 1649
309 Ga0500595_015539 3300053119 Bacteria 2855
310 Ga0500658_0339362 3300053134 Unclassified 690
311 Ga0500627_0067181 3300053158 Bacteria 1584
312 Ga0500627_0325757 3300053158 Bacteria 667
313 Ga0501084_0126297 3300054114 Bacteria 2152
314 Ga0501084_0539586 3300054114 Unclassified 986
315 Ga0501084_1114651 3300054114 Bacteria 662
316 Ga0501082_0248360 3300060353 Bacteria 1549
317 Ga0501082_0289916 3300060353 Bacteria 1425
318 Ga0501082_0584815 3300060353 Bacteria 977
319 2644288122 2643221651 Bacteria 4798932
320 Ga0501073_0013373
321 Ga0065712_10384419
322 Ga0070676_11199820
323 Ga0070676_11455620
324 Ga0070683_100256665
325 Ga0070690_101590318
326 Ga0070670_100877229
327 Ga0070670_100966254
328 Ga0070677_10047388
329 Ga0068869_100428519
330 Ga0070666_10132820
331 Ga0070682_101613089
332 Ga0068868_102195052
333 Ga0070689_100257810
334 Ga0070689_100437921
335 Ga0070689_101167187
336 Ga0070687_100264262
337 Ga0070661_100063245
338 Ga0070675_100432352
339 Ga0070675_100943432
340 Ga0070674_100007359
341 Ga0070673_100693713
342 Ga0070673_100694607
343 Ga0070673_101125560
344 Ga0070659_100676583
345 Ga0070694_100719680
346 Ga0070663_101588511
347 Ga0070678_100471943
348 Ga0070662_100981059
349 Ga0070685_10131857
350 Ga0070685_10173087
351 Ga0070679_100996605
352 Ga0068853_100403185
353 Ga0068853_100928141
354 Ga0068853_101782166
355 Ga0070672_100353834
356 Ga0070686_100748120
357 Ga0070704_100585474
358 Ga0070664_100062693
359 Ga0068857_100235972
360 Ga0068856_100890793
361 Ga0068856_101799785
362 Ga0070702_100128411
363 Ga0068859_100029162
364 Ga0068859_101056998
365 Ga0068859_102559224
366 Ga0068864_100314321
367 Ga0068861_100684815
368 Ga0068863_100375650
369 Ga0068858_100228488
370 Ga0068858_101841475
371 Ga0068862_100283971
372 Ga0068862_100659725
373 Ga0075365_10166466
374 Ga0075365_10257651
375 Ga0075365_10453671
376 Ga0075365_10569967
377 Ga0075365_11176635
378 Ga0075368_10009564
379 Ga0075368_10033316
380 Ga0075368_10141649
381 Ga0075368_10332212
382 Ga0075363_100008266
383 Ga0075363_100027296
384 Ga0075364_10009163
385 Ga0075364_10059110
386 Ga0075364_10635000
387 Ga0070715_11018072
388 Ga0070716_100905509
389 Ga0075362_10084872
390 Ga0075367_10087404
391 Ga0075367_10094237
392 Ga0075367_10212310
393 Ga0075367_10853840
394 Ga0075369_10577199
395 Ga0075366_10053942
396 Ga0075366_10063466
397 Ga0075366_10394637
398 Ga0075366_10472310
399 Ga0075370_10006046
400 Ga0075370_10051901
401 Ga0075370_10169700
402 Ga0075430_101028532
403 Ga0068865_100912363
404 Ga0068865_101084024
405 Ga0097620_100029158
406 Ga0097620_101057060
407 Ga0097620_102559156
408 Ga0105244_10481567
409 Ga0111539_11209932
410 Ga0105245_10246850
411 Ga0105245_10916295
412 Ga0105247_10004521
413 Ga0105247_11514162
414 Ga0114129_10836421
415 Ga0114129_11027917
416 Ga0114129_12147996
417 Ga0105243_10595108
418 Ga0105243_11635894
419 Ga0105241_10854134
420 Ga0105248_10246779
421 Ga0105237_12574984
422 Ga0105238_12558517
423 Ga0105249_10018980
424 Ga0105249_10912883
425 Ga0105246_10621712
426 Ga0157378_10464223
427 Ga0163162_10169876
428 Ga0157375_11913200
429 Ga0157375_12963669
430 Ga0163163_10096060
431 Ga0157380_10214988
432 Ga0157380_10362930
433 Ga0157380_10377873
434 Ga0157380_11546510
435 Ga0157377_11537123
436 Ga0157379_10684354
437 Ga0157376_10548267
438 Ga0182007_10415571
439 Ga0163161_10703609
440 Ga0213876_10022285
441 Ga0213875_10000089
442 Ga0207692_10673908
443 Ga0207710_10017462
444 Ga0207688_10078028
445 Ga0207680_10409391
446 Ga0207699_10679290
447 Ga0207645_10049980
448 Ga0207643_10348010
449 Ga0207671_10670514
450 Ga0207693_10040477
451 Ga0207662_10044896
452 Ga0207662_10074828
453 Ga0207681_10862010
454 Ga0207650_10584228
455 Ga0207650_10605438
456 Ga0207659_10024097
457 Ga0207664_10297210
458 Ga0207664_10331062
459 Ga0207644_10534316
460 Ga0207690_10123259
461 Ga0207706_11087452
462 Ga0207709_10057782
463 Ga0207709_11775421
464 Ga0207670_10122386
465 Ga0207670_10300917
466 Ga0207669_10023893
467 Ga0207669_10568555
468 Ga0207704_11488167
469 Ga0207665_10470792
470 Ga0207691_10010655
471 Ga0207691_10353395
472 Ga0207689_10071920
473 Ga0207661_10240522
474 Ga0207679_10012081
475 Ga0207712_10129314
476 Ga0207712_10290009
477 Ga0207658_10278629
478 Ga0207703_10130177
479 Ga0207703_10653706
480 Ga0207639_11287013
481 Ga0207702_10211821
482 Ga0207648_10073130
483 Ga0207648_11462247
484 Ga0207676_11524896
485 Ga0207674_10042094
486 Ga0207674_10357913
487 Ga0207675_101023894
488 Ga0207683_10091575
489 Ga0209813_10064933
490 Ga0209813_10199313
491 Ga0207428_10071707
492 Ga0268265_10644904
493 Ga0268265_11125504
494 Ga0265318_10006928
495 Ga0265338_10798962
496 Ga0265330_10015779
497 Ga0265332_10009552
498 Ga0265332_10033849
499 Ga0265328_10044224
500 Ga0265320_10028218
501 Ga0265325_10001543
502 Ga0265325_10025608
503 Ga0265325_10418113
504 Ga0265340_10002004
505 Ga0265340_10002924
506 Ga0265340_10229858
507 Ga0265339_10005207
508 Ga0265339_10009320
509 Ga0265339_10198112
510 Ga0265331_10030138
511 Ga0265331_10076637
512 Ga0307513_11071418
513 Ga0265313_10008906
514 Ga0316575_10029197
515 Ga0265314_10029089
516 Ga0265314_10036130
517 Ga0265342_10000011
518 Ga0265342_10123165
519 Ga0307405_11924267
520 Ga0307410_12143030
521 Ga0316583_10321473
522 Ga0373934_0270074
523 Ga0373953_0212832
524 Ga0373954_0025553
525 Ga0373954_0050111
526 Ga0373956_0103353
527 Ga0316574_0002736
528 Ga0373931_0248890
529 Ga0373935_0156341
530 Ga0373935_0206416
531 Ga0373937_0018774
532 Ga0373937_1198778
533 Ga0316584_0060707
534 Ga0373925_0549865
535 Ga0436364_0673172
536 Ga0436364_1161738
537 Ga0436364_1470117
538 Ga0436365_1057834
539 Ga0436361_0796970
540 Ga0439453_0004847
541 Ga0451807_1074311
542 Ga0451849_1368777
543 Ga0451853_0411474
544 Ga0439441_129128
545 Ga0439443_003054
546 Ga0439456_028097
547 Ga0439435_0003094
548 Ga0439464_0195446
549 Ga0439460_0118770
550 Ga0450893_0057821
551 Ga0466968_0494777
552 Ga0495592_0129235
553 Ga0495638_0044965
554 Ga0495638_0603290
555 Ga0495643_0218710
556 Ga0495598_0001349
557 Ga0495621_0015652
558 Ga0495656_0168412
559 Ga0495668_0064825
560 Ga0495599_0453491
561 Ga0495646_0713540
562 Ga0495685_141300
563 Ga0495615_0035636
564 Ga0496100_0228857
565 Ga0496104_0183798
566 Ga0496107_0092449
567 Ga0496109_0545431
568 Ga0496109_1275903
569 Ga0496109_1849473
570 Ga0496110_0432169
571 Ga0496112_0449646
572 Ga0501034_0350333
573 Ga0501034_0719427
574 Ga0501047_0133350
575 Ga0501067_0037402
576 Ga0501068_0308070
577 Ga0501069_0790446
578 Ga0501072_0013044
579 Ga0501072_0232726
580 Ga0501074_0124370
581 Ga0501074_0261433
582 Ga0501079_0248974
583 Ga0501080_0053208
584 Ga0501080_1043088
585 Ga0501083_0037150
586 Ga0501083_0093313
587 Ga0501083_0222331
588 Ga0501035_0440613
589 Ga0501044_0067871
590 Ga0501044_0188091
591 nmdc:mga03n38_621567_c1
592 nmdc:mga03n38_639302_c1
593 nmdc:mga03n38_77942_c1
594 nmdc:mga00v17_115333_c1
595 nmdc:mga00v17_186027_c1
596 nmdc:mga00v17_8476_c1
597 nmdc:mga0yw44_1151223_c1
598 nmdc:mga0yw44_34416_c1
599 nmdc:mga0yw44_728258_c1
600 nmdc:mga0k408_410341_c1
601 nmdc:mga0k408_65576_c1
602 nmdc:mga0k408_688635_c1
603 nmdc:mga06z11_11724_c1
604 nmdc:mga06z11_158336_c1
605 nmdc:mga06z11_464307_c1
606 nmdc:mga06z11_494695_c1
607 nmdc:mga06z11_6671_c1
608 nmdc:mga06z11_714771_c1
609 nmdc:mga04h51_140363_c1
610 nmdc:mga04h51_237497_c1
611 nmdc:mga07m45_178002_c1
612 nmdc:mga07m45_339687_c1
613 nmdc:mga05p37_1468243_c1
614 nmdc:mga05p37_888706_c1
615 nmdc:mga0qj67_416352_c1
616 nmdc:mga0qj67_862480_c1
617 nmdc:mga06r32_1461296_c1
618 nmdc:mga08y16_1203242_c1
619 nmdc:mga08y16_42072_c1
620 nmdc:mga0sz30_202861_c1
621 nmdc:mga0sz30_523448_c1
622 Ga0495601_0442601
623 Ga0495595_0121728
624 Ga0500646_0091142
625 Ga0500641_0090563
626 Ga0500641_0188634
627 Ga0500593_061465
628 Ga0500595_015539
629 Ga0500658_0339362
630 Ga0500627_0067181
631 Ga0500627_0325757
632 Ga0501084_0126297
633 Ga0501084_0539586
634 Ga0501084_1114651
635 Ga0501082_0248360
636 Ga0501082_0289916
637 Ga0501082_0584815
638 2644288122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05437

AzlD

Branched-chain amino acid transport protein (AzlD)

14

112

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8kd5-assembly1.cif.gz_O rpd3s in complex with nucleosome with h3k36mla modification and 187bp dna, class2 0.4256 22 108
7otq-assembly1.cif.gz_E cryo-em structure of alc1/chd1l bound to a parylated nucleosome 0.3316 22 110
8kd5-assembly1.cif.gz_O rpd3s in complex with nucleosome with h3k36mla modification and 187bp dna, class2 0.3038 22 108
7otq-assembly1.cif.gz_E cryo-em structure of alc1/chd1l bound to a parylated nucleosome 0.2446 22 110
ID Description Score Start End Superfamily
af_P27843_1_126_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3429 15 109 1.20.1070.10
af_P27843_1_126_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3021 15 109 1.20.1070.10
af_O61220_501_774_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.1768 2 109 1.10.287.70
af_O61220_501_774_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.1523 2 109 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A7X3LS92-F1-model_v4 AzlD domain-containing protein 0.7196 14 108 GO:0016020
AF-A0A0K6I5H0-F1-model_v4 Branched-chain amino acid transport protein (AzlD) 0.7178 8 108 GO:0016020
AF-A0A5J6N5W9-F1-model_v4 Branched-chain amino acid transport 0.712 7 108 GO:0016020
AF-A0A182D7D0-F1-model_v4 Branched-chain amino acid transport protein (AzlD) 0.7108 6 107 GO:0016020
AF-A0A1W9KHP6-F1-model_v4 deleted 0.7088 6 111

Map