F405459

General Info

Members Datasets Scaffolds Average Seq Length
320 173 640 386

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100000403|Ga0068860_10000040353
Length 398
Sequence MSQVAEASSSPTPSGRPSELAEPSSYDGLALRKLAKHFGAFQAVRELDLDVPRGSFFALLGPSGCGKTTTLRMVAGLETPSAGSITLAGNDITFAKPYQRPVNTVFQSYALFPHLDIYENVAFGLRRRKQRDVDAQVREMLALVELESQARKKPAQLSGGQQQRVALARALINSPEVLLLDEPLGALDLKLRRSMQIELKRIQTDVGRTFIHVTHDQEEAMTMADTVAVMNGGVIEQMGAPTELYENPRSTFVANFLGQSNLIEGQVTSRSSDLVTVDMHGIPVSVPTGRAHTPGDRGWVGIRPEKVLIGDEGEQLDAPGNTIPGGVVSDVSFVGVSTQYLVRMPWGQELQVFSQNTGRHRLFAVGDKVELSWRPEYAFLLDAAQDASAGAQKMDSDG

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
77 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
78 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
81 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
157 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
158 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
159 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
165 2643221576 Nocardioides sp. Root614 Isolate Unclassified
166 2643221590 Nocardioides sp. Root682 Isolate Unclassified
167 2643221615 Nocardioides sp. Root224 Isolate Unclassified
168 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
169 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
170 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
171 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
172 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
173 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 0.31
Isolates 2.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.62
Nodule 0
Rhizoplane 7.19
Rhizosphere 73.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100000403 3300005843 Bacteria 56312
2 JGI24738J21930_10007090 3300002075 Bacteria 2602
3 JGI24744J21845_10011016 3300002077 Bacteria 1852
4 JGI25405J52794_10001587 3300003911 Bacteria 3770
5 Ga0070683_100002249 3300005329 Bacteria 15311
6 Ga0070683_100088110 3300005329 Bacteria 2912
7 Ga0070683_100211615 3300005329 Bacteria 1842
8 Ga0070682_100003152 3300005337 Bacteria 9134
9 Ga0070687_100029681 3300005343 Bacteria 2665
10 Ga0070661_100143643 3300005344 Bacteria 1800
11 Ga0070700_100119358 3300005441 Bacteria 1764
12 Ga0070678_100055041 3300005456 Bacteria 2903
13 Ga0070678_100092724 3300005456 Bacteria 2321
14 Ga0068867_100031429 3300005459 Bacteria 3833
15 Ga0070684_100002183 3300005535 Bacteria 14445
16 Ga0070684_100040527 3300005535 Bacteria 4011
17 Ga0068853_100140763 3300005539 Bacteria 2166
18 Ga0070665_100031230 3300005548 Bacteria 5361
19 Ga0070664_100090792 3300005564 Bacteria 2644
20 Ga0070664_100199353 3300005564 Bacteria 1786
21 Ga0068856_100032536 3300005614 Bacteria 5106
22 Ga0068856_100289287 3300005614 Bacteria 1655
23 Ga0068861_100172121 3300005719 Bacteria 1795
24 Ga0068861_100216579 3300005719 Bacteria 1616
25 Ga0081455_10001385 3300005937 Bacteria 29923
26 Ga0081455_10002395 3300005937 Bacteria 22384
27 Ga0081455_10012398 3300005937 Bacteria 8506
28 Ga0081538_10010294 3300005981 Bacteria 7677
29 Ga0081538_10019069 3300005981 Bacteria 5118
30 Ga0075365_10001174 3300006038 Bacteria 11504
31 Ga0075365_10008776 3300006038 Bacteria 5766
32 Ga0075365_10024346 3300006038 Bacteria 3817
33 Ga0075365_10025078 3300006038 Bacteria 3771
34 Ga0075365_10072417 3300006038 Bacteria 2321
35 Ga0075365_10125250 3300006038 Bacteria 1775
36 Ga0075368_10017294 3300006042 Bacteria 2697
37 Ga0075363_100002737 3300006048 Bacteria 7298
38 Ga0075363_100033670 3300006048 Bacteria 2670
39 Ga0075364_10005779 3300006051 Bacteria 7216
40 Ga0075364_10014893 3300006051 Bacteria 4812
41 Ga0075364_10056255 3300006051 Bacteria 2575
42 Ga0075364_10095317 3300006051 Bacteria 1978
43 Ga0075362_10008363 3300006177 Bacteria 3953
44 Ga0075367_10036077 3300006178 Bacteria 2865
45 Ga0075367_10081544 3300006178 Bacteria 1957
46 Ga0097621_100170082 3300006237 Bacteria 1878
47 Ga0075370_10043114 3300006353 Bacteria 2550
48 Ga0075370_10044102 3300006353 Bacteria 2521
49 Ga0075370_10087174 3300006353 Bacteria 1798
50 Ga0075370_10091858 3300006353 Bacteria 1752
51 Ga0075428_100002185 3300006844 Bacteria 21168
52 Ga0075430_100009439 3300006846 Bacteria 8240
53 Ga0075430_100097262 3300006846 Bacteria 2460
54 Ga0075431_100001646 3300006847 Bacteria 20928
55 Ga0075431_100002381 3300006847 Bacteria 18073
56 Ga0075431_100002443 3300006847 Bacteria 17883
57 Ga0075429_100002100 3300006880 Bacteria 16628
58 Ga0111539_10017709 3300009094 Bacteria 8820
59 Ga0111539_10045910 3300009094 Bacteria 5228
60 Ga0105245_10029771 3300009098 Bacteria 4826
61 Ga0105245_10109758 3300009098 Bacteria 2564
62 Ga0105245_10191858 3300009098 Bacteria 1957
63 Ga0114129_10001686 3300009147 Bacteria 30132
64 Ga0105243_10186923 3300009148 Bacteria 1806
65 Ga0105242_10290971 3300009176 Bacteria 1487
66 Ga0105248_10072675 3300009177 Bacteria 3866
67 Ga0105238_10116754 3300009551 Bacteria 2648
68 Ga0105249_10189828 3300009553 Bacteria 2005
69 Ga0105239_10003188 3300010375 Bacteria 20302
70 Ga0105246_10001958 3300011119 Bacteria 12406
71 Ga0105246_10174600 3300011119 Bacteria 1649
72 Ga0157371_10063316 3300013102 Bacteria 2622
73 Ga0157369_10052509 3300013105 Bacteria 4410
74 Ga0157369_10255685 3300013105 Bacteria 1828
75 Ga0163162_10002006 3300013306 Bacteria 19153
76 Ga0157372_10004638 3300013307 Bacteria 14601
77 Ga0157372_10080241 3300013307 Bacteria 3691
78 Ga0157372_10174450 3300013307 Bacteria 2488
79 Ga0157375_10025265 3300013308 Bacteria 5516
80 Ga0157379_10024049 3300014968 Bacteria 5406
81 Ga0157376_10156526 3300014969 Bacteria 2061
82 Ga0163161_10004640 3300017792 Bacteria 9559
83 Ga0207688_10074473 3300025901 Bacteria 1931
84 Ga0207647_10019403 3300025904 Bacteria 4574
85 Ga0207662_10098363 3300025918 Bacteria 1810
86 Ga0207687_10026599 3300025927 Bacteria 3875
87 Ga0207687_10137394 3300025927 Bacteria 1850
88 Ga0207687_10142231 3300025927 Bacteria 1821
89 Ga0207686_10062914 3300025934 Bacteria 2358
90 Ga0207709_10114035 3300025935 Bacteria 1813
91 Ga0207709_10198824 3300025935 Bacteria 1430
92 Ga0207704_10124979 3300025938 Bacteria 1769
93 Ga0207691_10002035 3300025940 Bacteria 19784
94 Ga0207661_10003731 3300025944 Bacteria 10613
95 Ga0207661_10064772 3300025944 Bacteria 2964
96 Ga0207661_10190797 3300025944 Bacteria 1796
97 Ga0207679_10066901 3300025945 Bacteria 2694
98 Ga0207679_10231400 3300025945 Bacteria 1561
99 Ga0207651_10131739 3300025960 Bacteria 1915
100 Ga0207712_10130524 3300025961 Bacteria 1914
101 Ga0207703_10199689 3300026035 Bacteria 1776
102 Ga0207708_10013246 3300026075 Bacteria 6156
103 Ga0207702_10021651 3300026078 Bacteria 5323
104 Ga0207648_10009814 3300026089 Bacteria 9142
105 Ga0207674_10001048 3300026116 Bacteria 35994
106 Ga0207675_100003571 3300026118 Bacteria 15149
107 Ga0207683_10078467 3300026121 Bacteria 2926
108 Ga0209813_10001549 3300027866 Bacteria 5157
109 Ga0209813_10004981 3300027866 Bacteria 3206
110 Ga0207428_10012951 3300027907 Bacteria 7309
111 Ga0207428_10021554 3300027907 Bacteria 5454
112 Ga0268266_10002638 3300028379 Bacteria 18911
113 Ga0268264_10000355 3300028381 Bacteria 68889
114 Ga0268264_10022583 3300028381 Bacteria 5135
115 Ga0316576_10023646 3300031727 Bacteria 4283
116 Ga0307413_10094519 3300031824 Bacteria 1957
117 Ga0307412_10171471 3300031911 Bacteria 1623
118 Ga0451793_1319247 3300041452 Bacteria 2277
119 Ga0451833_0469571 3300041491 Bacteria 13777
120 Ga0451837_0057400 3300041494 Bacteria 2517
121 Ga0451853_2498439 3300041512 Bacteria 1786
122 Ga0439446_0002277 3300042156 Bacteria 4581
123 Ga0439434_0016292 3300042435 Bacteria 2220
124 Ga0466969_0000475 3300044656 Bacteria 21978
125 Ga0466965_0005780 3300044683 Bacteria 5584
126 Ga0466965_0034912 3300044683 Bacteria 2462
127 Ga0466965_0077975 3300044683 Bacteria 1673
128 Ga0466966_0063969 3300044684 Bacteria 2317
129 Ga0466966_0097700 3300044684 Bacteria 1818
130 Ga0466961_0001332 3300044693 Bacteria 15220
131 Ga0466961_0030310 3300044693 Bacteria 3476
132 Ga0466963_0032542 3300044694 Bacteria 3378
133 Ga0466963_0041691 3300044694 Bacteria 3011
134 Ga0466964_0001606 3300044706 Bacteria 7796
135 Ga0466964_0031921 3300044706 Bacteria 2091
136 Ga0466971_0000060 3300044719 Bacteria 42431
137 Ga0466971_0010488 3300044719 Bacteria 4050
138 Ga0466968_0041558 3300044735 Bacteria 1941
139 Ga0466970_0004440 3300044765 Bacteria 6916
140 Ga0466970_0006455 3300044765 Bacteria 5865
141 Ga0466970_0009838 3300044765 Bacteria 4842
142 Ga0466970_0016329 3300044765 Bacteria 3825
143 Ga0466970_0086380 3300044765 Bacteria 1700
144 Ga0466960_0000810 3300044901 Bacteria 10986
145 Ga0466960_0018927 3300044901 Bacteria 3025
146 Ga0466960_0021602 3300044901 Bacteria 2868
147 Ga0466960_0024692 3300044901 Bacteria 2714
148 Ga0466960_0031114 3300044901 Bacteria 2460
149 Ga0466960_0083709 3300044901 Bacteria 1613
150 Ga0466959_0132770 3300045049 Bacteria 1764
151 Ga0466959_0220124 3300045049 Bacteria 1317
152 Ga0466958_0034738 3300045836 Bacteria 3010
153 Ga0466967_0008387 3300045976 Bacteria 7563
154 Ga0466967_0018779 3300045976 Bacteria 5538
155 Ga0466967_0033634 3300045976 Bacteria 4342
156 Ga0466967_0051182 3300045976 Bacteria 3618
157 Ga0466967_0078903 3300045976 Bacteria 2967
158 Ga0495603_0091522 3300046455 Bacteria 1778
159 Ga0495641_0068328 3300046461 Bacteria 1598
160 Ga0495651_0005500 3300046462 Bacteria 9663
161 Ga0495628_0008618 3300046516 Bacteria 8736
162 Ga0495635_0006726 3300046663 Bacteria 8030
163 Ga0495600_0043038 3300046809 Bacteria 2944
164 Ga0495602_0158524 3300048088 Bacteria 1770
165 Ga0496100_0117166 3300048903 Bacteria 1859
166 Ga0496102_0012699 3300048905 Bacteria 7296
167 Ga0496104_0084039 3300048907 Bacteria 3037
168 Ga0496105_0003702 3300048908 Bacteria 11375
169 Ga0496105_0015115 3300048908 Bacteria 6143
170 Ga0496105_0101423 3300048908 Bacteria 2377
171 Ga0496107_0004462 3300048910 Bacteria 9489
172 Ga0496107_0034731 3300048910 Bacteria 3612
173 Ga0496108_0011893 3300048911 Bacteria 7080
174 Ga0496108_0015083 3300048911 Bacteria 6309
175 Ga0496108_0326113 3300048911 Bacteria 1339
176 Ga0496109_0019007 3300048912 Bacteria 6052
177 Ga0496109_0083951 3300048912 Bacteria 2938
178 Ga0496110_0003014 3300048913 Bacteria 12777
179 Ga0496110_0037123 3300048913 Bacteria 4234
180 Ga0496110_0117379 3300048913 Bacteria 2396
181 Ga0496114_0007469 3300048917 Bacteria 8642
182 Ga0496114_0020343 3300048917 Bacteria 5387
183 Ga0496114_0037619 3300048917 Bacteria 4003
184 Ga0496114_0059094 3300048917 Bacteria 3203
185 Ga0496114_0126801 3300048917 Bacteria 2201
186 Ga0496115_0011067 3300048918 Bacteria 6760
187 Ga0496123_0040035 3300048926 Bacteria 3271
188 Ga0501031_0075849 3300049568 Bacteria 2189
189 Ga0501033_0001394 3300049570 Bacteria 21476
190 Ga0501034_0007458 3300049571 Bacteria 11641
191 Ga0501034_0010553 3300049571 Bacteria 9616
192 Ga0501034_0016642 3300049571 Bacteria 7539
193 Ga0501034_0018866 3300049571 Bacteria 7067
194 Ga0501034_0045357 3300049571 Bacteria 4442
195 Ga0501034_0154861 3300049571 Bacteria 2266
196 Ga0501036_0012761 3300049572 Bacteria 6971
197 Ga0501036_0018002 3300049572 Bacteria 5915
198 Ga0501036_0019508 3300049572 Bacteria 5693
199 Ga0501036_0054161 3300049572 Bacteria 3397
200 Ga0501036_0162659 3300049572 Bacteria 1881
201 Ga0501036_0180754 3300049572 Bacteria 1776
202 Ga0501037_0015767 3300049573 Bacteria 5560
203 Ga0501037_0036602 3300049573 Bacteria 3616
204 Ga0501038_0000978 3300049574 Bacteria 25638
205 Ga0501038_0009704 3300049574 Bacteria 8827
206 Ga0501038_0032030 3300049574 Bacteria 4643
207 Ga0501039_0056848 3300049575 Bacteria 3031
208 Ga0501039_0121069 3300049575 Bacteria 2051
209 Ga0501040_0150455 3300049576 Bacteria 1642
210 Ga0501042_0013496 3300049578 Bacteria 5562
211 Ga0501042_0046649 3300049578 Bacteria 3089
212 Ga0501042_0100507 3300049578 Bacteria 2080
213 Ga0501046_0001404 3300049580 Bacteria 23190
214 Ga0501046_0052980 3300049580 Bacteria 3196
215 Ga0501046_0123231 3300049580 Bacteria 1971
216 Ga0501047_0227197 3300049581 Bacteria 1721
217 Ga0501048_0005248 3300049582 Bacteria 9866
218 Ga0501048_0017001 3300049582 Bacteria 5360
219 Ga0501048_0017867 3300049582 Bacteria 5217
220 Ga0501067_0001286 3300049583 Bacteria 13612
221 Ga0501067_0019240 3300049583 Bacteria 3779
222 Ga0501068_0005559 3300049584 Bacteria 6904
223 Ga0501068_0086449 3300049584 Bacteria 1930
224 Ga0501069_0034220 3300049585 Bacteria 2798
225 Ga0501070_0005058 3300049586 Bacteria 11240
226 Ga0501070_0010164 3300049586 Bacteria 7966
227 Ga0501070_0038928 3300049586 Bacteria 3967
228 Ga0501070_0092595 3300049586 Bacteria 2501
229 Ga0501070_0184316 3300049586 Bacteria 1717
230 Ga0501070_0255377 3300049586 Bacteria 1433
231 Ga0501071_0000958 3300049587 Bacteria 15721
232 Ga0501071_0027252 3300049587 Bacteria 4019
233 Ga0501071_0033211 3300049587 Bacteria 3667
234 Ga0501071_0044929 3300049587 Bacteria 3170
235 Ga0501071_0105368 3300049587 Bacteria 2082
236 Ga0501072_0014767 3300049588 Bacteria 5987
237 Ga0501072_0020026 3300049588 Bacteria 5181
238 Ga0501073_0008582 3300049589 Bacteria 7573
239 Ga0501073_0041220 3300049589 Bacteria 3262
240 Ga0501074_0000760 3300049590 Bacteria 20290
241 Ga0501074_0010149 3300049590 Bacteria 6838
242 Ga0501074_0013139 3300049590 Bacteria 6020
243 Ga0501074_0039812 3300049590 Bacteria 3404
244 Ga0501074_0125326 3300049590 Bacteria 1837
245 Ga0501075_0025047 3300049591 Bacteria 4381
246 Ga0501075_0039315 3300049591 Bacteria 3541
247 Ga0501076_0002617 3300049592 Bacteria 12395
248 Ga0501076_0242397 3300049592 Bacteria 1475
249 Ga0501076_0312935 3300049592 Bacteria 1288
250 Ga0501077_0004816 3300049593 Bacteria 8202
251 Ga0501079_0066458 3300049741 Bacteria 2782
252 Ga0501079_0175358 3300049741 Bacteria 1672
253 Ga0501079_0195533 3300049741 Bacteria 1579
254 Ga0501079_0244672 3300049741 Bacteria 1401
255 Ga0501080_0005537 3300049742 Bacteria 11275
256 Ga0501080_0027296 3300049742 Bacteria 5309
257 Ga0501080_0187630 3300049742 Bacteria 1901
258 Ga0501083_0003832 3300049744 Bacteria 10559
259 Ga0501083_0029630 3300049744 Bacteria 3762
260 Ga0501035_0002624 3300049822 Bacteria 17515
261 Ga0501044_0156707 3300049823 Bacteria 2256
262 Ga0501045_0065816 3300049824 Bacteria 2661
263 nmdc:mga03683_11614_c1 3300050489 Bacteria 3193
264 nmdc:mga00v17_17781_c1 3300050491 Bacteria 4032
265 nmdc:mga00v17_205907_c1 3300050491 Bacteria 1272
266 nmdc:mga00v17_24671_c1 3300050491 Bacteria 3489
267 nmdc:mga00v17_31940_c1 3300050491 Bacteria 3109
268 nmdc:mga00v17_3814_c2 3300050491 Bacteria 4599
269 nmdc:mga00v17_53663_c1 3300050491 Bacteria 2458
270 nmdc:mga00v17_55709_c1 3300050491 Bacteria 2415
271 nmdc:mga00v17_74157_c1 3300050491 Bacteria 2114
272 nmdc:mga0yw44_27935_c1 3300050492 Bacteria 3239
273 nmdc:mga0yw44_4806_c1 3300050492 Bacteria 6267
274 nmdc:mga0yw44_52542_c1 3300050492 Bacteria 2471
275 nmdc:mga0yw44_54643_c1 3300050492 Bacteria 2428
276 nmdc:mga0yw44_64136_c1 3300050492 Bacteria 2260
277 nmdc:mga0yw44_9881_c1 3300050492 Bacteria 4846
278 nmdc:mga06z11_133283_c1 3300050494 Bacteria 1397
279 nmdc:mga06z11_33768_c1 3300050494 Bacteria 2505
280 nmdc:mga06z11_34978_c1 3300050494 Bacteria 2469
281 nmdc:mga04h51_5621_c1 3300050495 Bacteria 3206
282 nmdc:mga07m45_26420_c1 3300050496 Bacteria 3192
283 nmdc:mga07m45_27002_c1 3300050496 Bacteria 3159
284 nmdc:mga07m45_54723_c1 3300050496 Bacteria 2254
285 nmdc:mga07m45_56101_c1 3300050496 Bacteria 2226
286 nmdc:mga07m45_59465_c1 3300050496 Bacteria 2162
287 nmdc:mga05p37_2307_c1 3300050507 Bacteria 22250
288 nmdc:mga09592_63_c1 3300050508 Bacteria 60777
289 nmdc:mga06r32_1008_c1 3300050510 Bacteria 25293
290 nmdc:mga06r32_5257_c1 3300050510 Bacteria 11644
291 nmdc:mga08y16_12302_c1 3300050511 Bacteria 8998
292 nmdc:mga08y16_12645_c1 3300050511 Bacteria 8879
293 nmdc:mga0n895_430122_c1 3300050512 Bacteria 1334
294 nmdc:mga0a205_179099_c1 3300050515 Bacteria 2014
295 Ga0495601_0023820 3300053077 Bacteria 3764
296 Ga0495612_0003055 3300053078 Bacteria 6945
297 Ga0500644_0000090 3300053088 Bacteria 56710
298 Ga0500556_0001462 3300053104 Bacteria 9933
299 Ga0500593_000198 3300053117 Bacteria 24426
300 Ga0500573_0032749 3300053140 Bacteria 2998
301 Ga0501084_0042147 3300054114 Bacteria 3818
302 Ga0501084_0265012 3300054114 Bacteria 1451
303 Ga0587072_001779 3300059643 Bacteria 2762
304 Ga0501082_0001590 3300060353 Bacteria 20028
305 Ga0501082_0022082 3300060353 Bacteria 5487
306 Ga0501082_0060556 3300060353 Bacteria 3259
307 Ga0501082_0069479 3300060353 Bacteria 3032
308 Ga0466962_0000321 3300061719 Bacteria 20548
309 Ga0530510_0018998 3300061734 Bacteria 4875
310 Ga0530510_0055291 3300061734 Bacteria 2867
311 Ga0530510_0115365 3300061734 Bacteria 1969
312 2643891387 2643221576 Bacteria 5214352
313 2643960435 2643221590 Bacteria 5214697
314 2644089792 2643221615 Bacteria 5487866
315 2644319637 2643221657 Bacteria 5490246
316 2644537879 2643221697 Bacteria 3575694
317 2645720126 2643221961 Bacteria 3919167
318 2645726984 2643221962 Bacteria 3874254
319 2855387653 2855386786 Bacteria 4752232
320 2857482017 2857481737 Bacteria 4761446
321 Ga0068860_100000403
322 JGI24738J21930_10007090
323 JGI24744J21845_10011016
324 JGI25405J52794_10001587
325 Ga0070683_100002249
326 Ga0070683_100088110
327 Ga0070683_100211615
328 Ga0070682_100003152
329 Ga0070687_100029681
330 Ga0070661_100143643
331 Ga0070700_100119358
332 Ga0070678_100055041
333 Ga0070678_100092724
334 Ga0068867_100031429
335 Ga0070684_100002183
336 Ga0070684_100040527
337 Ga0068853_100140763
338 Ga0070665_100031230
339 Ga0070664_100090792
340 Ga0070664_100199353
341 Ga0068856_100032536
342 Ga0068856_100289287
343 Ga0068861_100172121
344 Ga0068861_100216579
345 Ga0081455_10001385
346 Ga0081455_10002395
347 Ga0081455_10012398
348 Ga0081538_10010294
349 Ga0081538_10019069
350 Ga0075365_10001174
351 Ga0075365_10008776
352 Ga0075365_10024346
353 Ga0075365_10025078
354 Ga0075365_10072417
355 Ga0075365_10125250
356 Ga0075368_10017294
357 Ga0075363_100002737
358 Ga0075363_100033670
359 Ga0075364_10005779
360 Ga0075364_10014893
361 Ga0075364_10056255
362 Ga0075364_10095317
363 Ga0075362_10008363
364 Ga0075367_10036077
365 Ga0075367_10081544
366 Ga0097621_100170082
367 Ga0075370_10043114
368 Ga0075370_10044102
369 Ga0075370_10087174
370 Ga0075370_10091858
371 Ga0075428_100002185
372 Ga0075430_100009439
373 Ga0075430_100097262
374 Ga0075431_100001646
375 Ga0075431_100002381
376 Ga0075431_100002443
377 Ga0075429_100002100
378 Ga0111539_10017709
379 Ga0111539_10045910
380 Ga0105245_10029771
381 Ga0105245_10109758
382 Ga0105245_10191858
383 Ga0114129_10001686
384 Ga0105243_10186923
385 Ga0105242_10290971
386 Ga0105248_10072675
387 Ga0105238_10116754
388 Ga0105249_10189828
389 Ga0105239_10003188
390 Ga0105246_10001958
391 Ga0105246_10174600
392 Ga0157371_10063316
393 Ga0157369_10052509
394 Ga0157369_10255685
395 Ga0163162_10002006
396 Ga0157372_10004638
397 Ga0157372_10080241
398 Ga0157372_10174450
399 Ga0157375_10025265
400 Ga0157379_10024049
401 Ga0157376_10156526
402 Ga0163161_10004640
403 Ga0207688_10074473
404 Ga0207647_10019403
405 Ga0207662_10098363
406 Ga0207687_10026599
407 Ga0207687_10137394
408 Ga0207687_10142231
409 Ga0207686_10062914
410 Ga0207709_10114035
411 Ga0207709_10198824
412 Ga0207704_10124979
413 Ga0207691_10002035
414 Ga0207661_10003731
415 Ga0207661_10064772
416 Ga0207661_10190797
417 Ga0207679_10066901
418 Ga0207679_10231400
419 Ga0207651_10131739
420 Ga0207712_10130524
421 Ga0207703_10199689
422 Ga0207708_10013246
423 Ga0207702_10021651
424 Ga0207648_10009814
425 Ga0207674_10001048
426 Ga0207675_100003571
427 Ga0207683_10078467
428 Ga0209813_10001549
429 Ga0209813_10004981
430 Ga0207428_10012951
431 Ga0207428_10021554
432 Ga0268266_10002638
433 Ga0268264_10000355
434 Ga0268264_10022583
435 Ga0316576_10023646
436 Ga0307413_10094519
437 Ga0307412_10171471
438 Ga0451793_1319247
439 Ga0451833_0469571
440 Ga0451837_0057400
441 Ga0451853_2498439
442 Ga0439446_0002277
443 Ga0439434_0016292
444 Ga0466969_0000475
445 Ga0466965_0005780
446 Ga0466965_0034912
447 Ga0466965_0077975
448 Ga0466966_0063969
449 Ga0466966_0097700
450 Ga0466961_0001332
451 Ga0466961_0030310
452 Ga0466963_0032542
453 Ga0466963_0041691
454 Ga0466964_0001606
455 Ga0466964_0031921
456 Ga0466971_0000060
457 Ga0466971_0010488
458 Ga0466968_0041558
459 Ga0466970_0004440
460 Ga0466970_0006455
461 Ga0466970_0009838
462 Ga0466970_0016329
463 Ga0466970_0086380
464 Ga0466960_0000810
465 Ga0466960_0018927
466 Ga0466960_0021602
467 Ga0466960_0024692
468 Ga0466960_0031114
469 Ga0466960_0083709
470 Ga0466959_0132770
471 Ga0466959_0220124
472 Ga0466958_0034738
473 Ga0466967_0008387
474 Ga0466967_0018779
475 Ga0466967_0033634
476 Ga0466967_0051182
477 Ga0466967_0078903
478 Ga0495603_0091522
479 Ga0495641_0068328
480 Ga0495651_0005500
481 Ga0495628_0008618
482 Ga0495635_0006726
483 Ga0495600_0043038
484 Ga0495602_0158524
485 Ga0496100_0117166
486 Ga0496102_0012699
487 Ga0496104_0084039
488 Ga0496105_0003702
489 Ga0496105_0015115
490 Ga0496105_0101423
491 Ga0496107_0004462
492 Ga0496107_0034731
493 Ga0496108_0011893
494 Ga0496108_0015083
495 Ga0496108_0326113
496 Ga0496109_0019007
497 Ga0496109_0083951
498 Ga0496110_0003014
499 Ga0496110_0037123
500 Ga0496110_0117379
501 Ga0496114_0007469
502 Ga0496114_0020343
503 Ga0496114_0037619
504 Ga0496114_0059094
505 Ga0496114_0126801
506 Ga0496115_0011067
507 Ga0496123_0040035
508 Ga0501031_0075849
509 Ga0501033_0001394
510 Ga0501034_0007458
511 Ga0501034_0010553
512 Ga0501034_0016642
513 Ga0501034_0018866
514 Ga0501034_0045357
515 Ga0501034_0154861
516 Ga0501036_0012761
517 Ga0501036_0018002
518 Ga0501036_0019508
519 Ga0501036_0054161
520 Ga0501036_0162659
521 Ga0501036_0180754
522 Ga0501037_0015767
523 Ga0501037_0036602
524 Ga0501038_0000978
525 Ga0501038_0009704
526 Ga0501038_0032030
527 Ga0501039_0056848
528 Ga0501039_0121069
529 Ga0501040_0150455
530 Ga0501042_0013496
531 Ga0501042_0046649
532 Ga0501042_0100507
533 Ga0501046_0001404
534 Ga0501046_0052980
535 Ga0501046_0123231
536 Ga0501047_0227197
537 Ga0501048_0005248
538 Ga0501048_0017001
539 Ga0501048_0017867
540 Ga0501067_0001286
541 Ga0501067_0019240
542 Ga0501068_0005559
543 Ga0501068_0086449
544 Ga0501069_0034220
545 Ga0501070_0005058
546 Ga0501070_0010164
547 Ga0501070_0038928
548 Ga0501070_0092595
549 Ga0501070_0184316
550 Ga0501070_0255377
551 Ga0501071_0000958
552 Ga0501071_0027252
553 Ga0501071_0033211
554 Ga0501071_0044929
555 Ga0501071_0105368
556 Ga0501072_0014767
557 Ga0501072_0020026
558 Ga0501073_0008582
559 Ga0501073_0041220
560 Ga0501074_0000760
561 Ga0501074_0010149
562 Ga0501074_0013139
563 Ga0501074_0039812
564 Ga0501074_0125326
565 Ga0501075_0025047
566 Ga0501075_0039315
567 Ga0501076_0002617
568 Ga0501076_0242397
569 Ga0501076_0312935
570 Ga0501077_0004816
571 Ga0501079_0066458
572 Ga0501079_0175358
573 Ga0501079_0195533
574 Ga0501079_0244672
575 Ga0501080_0005537
576 Ga0501080_0027296
577 Ga0501080_0187630
578 Ga0501083_0003832
579 Ga0501083_0029630
580 Ga0501035_0002624
581 Ga0501044_0156707
582 Ga0501045_0065816
583 nmdc:mga03683_11614_c1
584 nmdc:mga00v17_17781_c1
585 nmdc:mga00v17_205907_c1
586 nmdc:mga00v17_24671_c1
587 nmdc:mga00v17_31940_c1
588 nmdc:mga00v17_3814_c2
589 nmdc:mga00v17_53663_c1
590 nmdc:mga00v17_55709_c1
591 nmdc:mga00v17_74157_c1
592 nmdc:mga0yw44_27935_c1
593 nmdc:mga0yw44_4806_c1
594 nmdc:mga0yw44_52542_c1
595 nmdc:mga0yw44_54643_c1
596 nmdc:mga0yw44_64136_c1
597 nmdc:mga0yw44_9881_c1
598 nmdc:mga06z11_133283_c1
599 nmdc:mga06z11_33768_c1
600 nmdc:mga06z11_34978_c1
601 nmdc:mga04h51_5621_c1
602 nmdc:mga07m45_26420_c1
603 nmdc:mga07m45_27002_c1
604 nmdc:mga07m45_54723_c1
605 nmdc:mga07m45_56101_c1
606 nmdc:mga07m45_59465_c1
607 nmdc:mga05p37_2307_c1
608 nmdc:mga09592_63_c1
609 nmdc:mga06r32_1008_c1
610 nmdc:mga06r32_5257_c1
611 nmdc:mga08y16_12302_c1
612 nmdc:mga08y16_12645_c1
613 nmdc:mga0n895_430122_c1
614 nmdc:mga0a205_179099_c1
615 Ga0495601_0023820
616 Ga0495612_0003055
617 Ga0500644_0000090
618 Ga0500556_0001462
619 Ga0500593_000198
620 Ga0500573_0032749
621 Ga0501084_0042147
622 Ga0501084_0265012
623 Ga0587072_001779
624 Ga0501082_0001590
625 Ga0501082_0022082
626 Ga0501082_0060556
627 Ga0501082_0069479
628 Ga0466962_0000321
629 Ga0530510_0018998
630 Ga0530510_0055291
631 Ga0530510_0115365
632 2643891387
633 2643960435
634 2644089792
635 2644319637
636 2644537879
637 2645720126
638 2645726984
639 2855387653
640 2857482017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

44

185

0.91

PF08402

TOBE_2

TOBE domain

300

381

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9405 24 252
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9372 24 252
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9371 22 236
3gfo-assembly1.cif.gz_A structure of cbio1 from clostridium perfringens: part of the abc transporter complex cbionq. 0.9353 24 240
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9339 24 230
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9768 24 234 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.976 22 235 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9602 24 254 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9583 24 248 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9567 24 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V9R859-F1-model_v4 ABC transporter domain-containing protein 0.9677 24 170 GO:0005524
GO:0016887
AF-A0A349H0M9-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9572 22 163 GO:0005524
GO:0016887
AF-Q92ZS1-F1-model_v4 ABC transporter, ATP-binding protein, amino terminus 0.9571 23 184 GO:0005524
GO:0016887
GO:0055052
AF-A0A530ND77-F1-model_v4 deleted 0.9563 24 148
AF-A0A351C2K6-F1-model_v4 LPS export ABC transporter ATP-binding protein 0.9489 24 243 GO:0005524
GO:0016887
GO:0043190
GO:0055085

Map