F405602

General Info

Members Datasets Scaffolds Average Seq Length
320 168 314 198

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10198722|Ga0307407_101987221
Length 221
Sequence VAAHRRNPALAYSDLMVARHETHPGNAAAAGPAEFRAAVESMRRASLRPEVFCEEMPAPQRIAPWSSALSGDVTVDEEDLGTGRLILLHDPAGNDAWDGTFRCVAYARADIDPELGADPMLAAVGWSWLVEALDAHGAGHHAASGTVTCVTTESFGGMADEDGTAQVEIRASWTPDVDEDGGLDMTAHVEAWGELMCTAVGLPPVPEGVTAIPSRRGQRGT

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221696 Nocardioides sp. Root140 Isolate Unclassified
3 2739367898 Nocardioides sp. CF479 Isolate Unclassified
4 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
5 2919395869 Microbacterium resistens 2980 Isolate Unclassified
6 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
87 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
88 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
89 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
90 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
162 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0.31
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0.31
Rhizoplane 7.81
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 4.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002553 3300000549 Bacteria 2518
2 JGI24740J21852_10003944 3300001979 Bacteria 6440
3 JGI25154J39366_1002452 3300002738 Bacteria 4795
4 Ga0070658_10476448 3300005327 Bacteria 1077
5 Ga0070683_100053498 3300005329 Bacteria 3741
6 Ga0070670_100706528 3300005331 Bacteria 907
7 Ga0068868_100439822 3300005338 Bacteria 1132
8 Ga0068868_100478965 3300005338 Bacteria 1087
9 Ga0070687_100060822 3300005343 Bacteria 1994
10 Ga0070687_100115628 3300005343 Bacteria 1526
11 Ga0070668_100078733 3300005347 Bacteria 2578
12 Ga0070675_100768051 3300005354 Bacteria 880
13 Ga0070671_100536497 3300005355 Bacteria 1008
14 Ga0070674_100049234 3300005356 Bacteria 2896
15 Ga0070678_100617274 3300005456 Bacteria 969
16 Ga0068867_100172130 3300005459 Bacteria 1716
17 Ga0070706_100665462 3300005467 Bacteria 966
18 Ga0070707_100076272 3300005468 Bacteria 3234
19 Ga0070698_100110006 3300005471 Bacteria 2721
20 Ga0068857_100408070 3300005577 Bacteria 1265
21 Ga0068856_100536212 3300005614 Bacteria 1191
22 Ga0068852_100039204 3300005616 Bacteria 3988
23 Ga0068852_100414227 3300005616 Bacteria 1328
24 Ga0068864_100554873 3300005618 Bacteria 1111
25 Ga0068864_100692257 3300005618 Bacteria 995
26 Ga0068861_100133900 3300005719 Bacteria 2014
27 Ga0068861_100408575 3300005719 Bacteria 1207
28 Ga0068870_10036571 3300005840 Bacteria 2527
29 Ga0068858_100230393 3300005842 Bacteria 1756
30 Ga0075365_10000585 3300006038 Bacteria 14182
31 Ga0075365_10088657 3300006038 Bacteria 2105
32 Ga0075364_10110887 3300006051 Bacteria 1831
33 Ga0068865_100680189 3300006881 Bacteria 877
34 Ga0105245_10166087 3300009098 Bacteria 2098
35 Ga0105245_10169299 3300009098 Bacteria 2079
36 Ga0105245_10169389 3300009098 Bacteria 2079
37 Ga0105245_10182133 3300009098 Bacteria 2008
38 Ga0114129_10697049 3300009147 Bacteria 1305
39 Ga0105243_10099598 3300009148 Bacteria 2409
40 Ga0105248_10558653 3300009177 Bacteria 1291
41 Ga0105238_10333775 3300009551 Bacteria 1503
42 Ga0105238_10798869 3300009551 Bacteria 959
43 Ga0105239_11619877 3300010375 Bacteria 749
44 Ga0105246_10350650 3300011119 Bacteria 1209
45 Ga0105246_10361514 3300011119 Bacteria 1193
46 Ga0157369_10231604 3300013105 Bacteria 1931
47 Ga0157369_10504529 3300013105 Bacteria 1252
48 Ga0157372_10214224 3300013307 Bacteria 2232
49 Ga0157375_10028754 3300013308 Bacteria 5216
50 Ga0157375_10247539 3300013308 Bacteria 1943
51 Ga0157375_10290741 3300013308 Bacteria 1797
52 Ga0163163_10060062 3300014325 Bacteria 3763
53 Ga0163163_10088742 3300014325 Bacteria 3103
54 Ga0163163_10179827 3300014325 Bacteria 2162
55 Ga0157377_10146624 3300014745 Bacteria 1455
56 Ga0157376_10300103 3300014969 Bacteria 1520
57 Ga0163161_10078290 3300017792 Bacteria 2430
58 Ga0206354_10560591 3300020081 Bacteria 848
59 Ga0207682_10113906 3300025893 Bacteria 1193
60 Ga0207643_10036816 3300025908 Bacteria 2745
61 Ga0207662_10061229 3300025918 Bacteria 2259
62 Ga0207657_10218507 3300025919 Bacteria 1528
63 Ga0207646_10175443 3300025922 Bacteria 1936
64 Ga0207650_10377329 3300025925 Bacteria 1170
65 Ga0207687_10212592 3300025927 Bacteria 1518
66 Ga0207687_10400534 3300025927 Bacteria 1129
67 Ga0207644_10357759 3300025931 Bacteria 1187
68 Ga0207690_10063189 3300025932 Bacteria 2524
69 Ga0207690_11038371 3300025932 Bacteria 682
70 Ga0207669_10466452 3300025937 Bacteria 1004
71 Ga0207669_10558327 3300025937 Bacteria 925
72 Ga0207704_10201857 3300025938 Bacteria 1456
73 Ga0207689_10189306 3300025942 Bacteria 1697
74 Ga0207661_10395690 3300025944 Bacteria 1252
75 Ga0207679_10078497 3300025945 Bacteria 2515
76 Ga0207712_10270432 3300025961 Bacteria 1382
77 Ga0207668_10649486 3300025972 Bacteria 923
78 Ga0207677_10222503 3300026023 Bacteria 1515
79 Ga0207678_10550834 3300026067 Bacteria 1009
80 Ga0207708_10226663 3300026075 Bacteria 1499
81 Ga0207708_10986747 3300026075 Bacteria 731
82 Ga0207702_10278383 3300026078 Bacteria 1581
83 Ga0207641_10604945 3300026088 Bacteria 1074
84 Ga0207648_10076121 3300026089 Bacteria 2925
85 Ga0207648_10261727 3300026089 Bacteria 1544
86 Ga0207674_10341053 3300026116 Bacteria 1449
87 Ga0207675_100510544 3300026118 Bacteria 1197
88 Ga0207683_10124411 3300026121 Bacteria 2317
89 Ga0268265_10783803 3300028380 Bacteria 928
90 Ga0316183_1068223 3300030742 Bacteria 972
91 Ga0307405_10539593 3300031731 Bacteria 942
92 Ga0307413_10184026 3300031824 Bacteria 1493
93 Ga0307410_10130193 3300031852 Bacteria 1848
94 Ga0307406_10080000 3300031901 Bacteria 2169
95 Ga0307407_10198722 3300031903 Bacteria 1342
96 Ga0307409_100266278 3300031995 Bacteria 1576
97 Ga0307416_100214765 3300032002 Bacteria 1839
98 Ga0307414_10382082 3300032004 Bacteria 1218
99 Ga0307414_10588934 3300032004 Bacteria 996
100 Ga0307415_100031860 3300032126 Bacteria 3403
101 Ga0307415_100075360 3300032126 Bacteria 2388
102 Ga0373931_0379692 3300035691 Bacteria 891
103 Ga0436364_0857252 3300037853 Bacteria 4143
104 Ga0451791_0005626 3300041451 Bacteria 709
105 Ga0451793_0237533 3300041452 Bacteria 873
106 Ga0451800_0280938 3300041459 Bacteria 910
107 Ga0451835_0485672 3300041492 Bacteria 892
108 Ga0451837_0150336 3300041494 Bacteria 1147
109 Ga0451837_0491570 3300041494 Bacteria 1950
110 Ga0451843_0210803 3300041509 Bacteria 766
111 Ga0451853_0156145 3300041512 Bacteria 996
112 Ga0451853_1590062 3300041512 Bacteria 1702
113 Ga0451853_1871461 3300041512 Bacteria 4494
114 Ga0451853_2768049 3300041512 Bacteria 777
115 Ga0466972_0083269 3300044658 Bacteria 1522
116 Ga0466972_0132577 3300044658 Bacteria 1173
117 Ga0466965_0065147 3300044683 Bacteria 1825
118 Ga0466965_0078060 3300044683 Bacteria 1672
119 Ga0466965_0084061 3300044683 Bacteria 1612
120 Ga0466965_0374808 3300044683 Bacteria 783
121 Ga0466966_0048048 3300044684 Bacteria 2719
122 Ga0466966_0068961 3300044684 Bacteria 2219
123 Ga0466966_0124023 3300044684 Bacteria 1585
124 Ga0466961_0035478 3300044693 Bacteria 3203
125 Ga0466961_0087834 3300044693 Bacteria 1964
126 Ga0466961_0318985 3300044693 Bacteria 948
127 Ga0466963_0651427 3300044694 Bacteria 743
128 Ga0466964_0023032 3300044706 Bacteria 2419
129 Ga0466964_0049934 3300044706 Bacteria 1714
130 Ga0466971_0155392 3300044719 Bacteria 1069
131 Ga0466970_0014097 3300044765 Bacteria 4099
132 Ga0466970_0040792 3300044765 Bacteria 2465
133 Ga0466970_0091541 3300044765 Bacteria 1651
134 Ga0466970_0124544 3300044765 Bacteria 1413
135 Ga0466970_0151247 3300044765 Bacteria 1281
136 Ga0466957_0721458 3300044842 Bacteria 704
137 Ga0466960_0011152 3300044901 Bacteria 3749
138 Ga0466960_0014012 3300044901 Bacteria 3419
139 Ga0466960_0029937 3300044901 Bacteria 2502
140 Ga0466960_0150282 3300044901 Bacteria 1244
141 Ga0466958_0126998 3300045836 Bacteria 1599
142 Ga0466967_0065771 3300045976 Bacteria 3228
143 Ga0466967_0079133 3300045976 Bacteria 2963
144 Ga0466967_1084500 3300045976 Bacteria 798
145 Ga0466967_1091677 3300045976 Bacteria 795
146 Ga0495653_0117250 3300046463 Bacteria 1902
147 Ga0495664_0030739 3300046477 Bacteria 3147
148 Ga0495635_0065322 3300046663 Bacteria 2497
149 Ga0495658_0100638 3300046683 Bacteria 1725
150 Ga0495658_0284654 3300046683 Bacteria 1044
151 Ga0496100_0034824 3300048903 Bacteria 3163
152 Ga0496101_0051856 3300048904 Bacteria 2957
153 Ga0496102_0059011 3300048905 Bacteria 3507
154 Ga0496102_0589376 3300048905 Bacteria 1035
155 Ga0496102_1063063 3300048905 Bacteria 729
156 Ga0496103_0067267 3300048906 Bacteria 2237
157 Ga0496103_0231855 3300048906 Bacteria 1188
158 Ga0496104_0042693 3300048907 Bacteria 4257
159 Ga0496106_0249504 3300048909 Bacteria 1419
160 Ga0496106_0647861 3300048909 Bacteria 844
161 Ga0496107_0136634 3300048910 Bacteria 1811
162 Ga0496107_0586414 3300048910 Bacteria 824
163 Ga0496108_0132045 3300048911 Bacteria 2146
164 Ga0496108_0654250 3300048911 Bacteria 913
165 Ga0496110_0083328 3300048913 Bacteria 2852
166 Ga0496111_0121322 3300048914 Bacteria 1930
167 Ga0496111_0194786 3300048914 Bacteria 1506
168 Ga0496112_0135677 3300048915 Bacteria 2431
169 Ga0496112_0340740 3300048915 Bacteria 1443
170 Ga0496113_0088789 3300048916 Bacteria 2378
171 Ga0496114_0025522 3300048917 Bacteria 4830
172 Ga0496114_0154190 3300048917 Bacteria 1994
173 Ga0501031_0000201 3300049568 Bacteria 34044
174 Ga0501031_0022508 3300049568 Bacteria 4106
175 Ga0501031_0053746 3300049568 Bacteria 2625
176 Ga0501031_0134238 3300049568 Bacteria 1617
177 Ga0501031_0482370 3300049568 Bacteria 800
178 Ga0501032_0002612 3300049569 Bacteria 14077
179 Ga0501032_0098147 3300049569 Bacteria 1941
180 Ga0501032_0129177 3300049569 Bacteria 1668
181 Ga0501033_0000425 3300049570 Bacteria 40353
182 Ga0501033_0063680 3300049570 Bacteria 2714
183 Ga0501033_0271239 3300049570 Bacteria 1199
184 Ga0501033_0500198 3300049570 Bacteria 841
185 Ga0501034_0002197 3300049571 Bacteria 24140
186 Ga0501034_0010965 3300049571 Bacteria 9414
187 Ga0501036_0000247 3300049572 Bacteria 36544
188 Ga0501036_0010955 3300049572 Bacteria 7496
189 Ga0501036_0040490 3300049572 Bacteria 3941
190 Ga0501036_0054986 3300049572 Bacteria 3372
191 Ga0501036_0118175 3300049572 Bacteria 2239
192 Ga0501037_0001791 3300049573 Bacteria 15604
193 Ga0501037_0005898 3300049573 Bacteria 8948
194 Ga0501037_0224805 3300049573 Bacteria 1319
195 Ga0501037_0709785 3300049573 Bacteria 669
196 Ga0501038_0002504 3300049574 Bacteria 17105
197 Ga0501038_0005968 3300049574 Bacteria 11265
198 Ga0501038_0032220 3300049574 Bacteria 4626
199 Ga0501038_0201979 3300049574 Bacteria 1595
200 Ga0501039_0000234 3300049575 Bacteria 40397
201 Ga0501039_0056852 3300049575 Bacteria 3031
202 Ga0501039_0088558 3300049575 Bacteria 2411
203 Ga0501039_0109513 3300049575 Bacteria 2159
204 Ga0501039_0258236 3300049575 Bacteria 1370
205 Ga0501039_0411318 3300049575 Bacteria 1062
206 Ga0501039_0638557 3300049575 Bacteria 834
207 Ga0501040_0004216 3300049576 Bacteria 9360
208 Ga0501040_0012377 3300049576 Bacteria 5591
209 Ga0501040_0069331 3300049576 Bacteria 2433
210 Ga0501040_0076288 3300049576 Bacteria 2318
211 Ga0501041_0041787 3300049577 Bacteria 2785
212 Ga0501041_0077113 3300049577 Bacteria 2050
213 Ga0501042_0049985 3300049578 Bacteria 2983
214 Ga0501042_0076777 3300049578 Bacteria 2392
215 Ga0501042_0078897 3300049578 Bacteria 2358
216 Ga0501042_0135741 3300049578 Bacteria 1774
217 Ga0501042_0196618 3300049578 Bacteria 1454
218 Ga0501042_0281948 3300049578 Bacteria 1200
219 Ga0501043_0000375 3300049579 Bacteria 40553
220 Ga0501043_0253949 3300049579 Bacteria 1354
221 Ga0501046_0000758 3300049580 Bacteria 31166
222 Ga0501046_0018081 3300049580 Bacteria 5871
223 Ga0501046_0067214 3300049580 Bacteria 2792
224 Ga0501047_0013840 3300049581 Bacteria 7659
225 Ga0501047_0082533 3300049581 Bacteria 3089
226 Ga0501048_0000238 3300049582 Bacteria 36540
227 Ga0501048_0027999 3300049582 Bacteria 4093
228 Ga0501048_0176454 3300049582 Bacteria 1514
229 Ga0501048_0198813 3300049582 Bacteria 1421
230 Ga0501048_0221541 3300049582 Bacteria 1342
231 Ga0501048_0691687 3300049582 Bacteria 732
232 Ga0501067_0014580 3300049583 Bacteria 4351
233 Ga0501067_0071221 3300049583 Bacteria 1925
234 Ga0501068_0011657 3300049584 Bacteria 4968
235 Ga0501068_0040102 3300049584 Bacteria 2810
236 Ga0501068_0297121 3300049584 Bacteria 1033
237 Ga0501068_0489082 3300049584 Bacteria 798
238 Ga0501069_0000112 3300049585 Bacteria 36488
239 Ga0501069_0020790 3300049585 Bacteria 3559
240 Ga0501069_0264730 3300049585 Bacteria 1004
241 Ga0501070_0028926 3300049586 Bacteria 4646
242 Ga0501070_0672335 3300049586 Bacteria 821
243 Ga0501071_0041045 3300049587 Bacteria 3313
244 Ga0501071_0062879 3300049587 Bacteria 2690
245 Ga0501071_0078284 3300049587 Bacteria 2416
246 Ga0501071_0363879 3300049587 Bacteria 1102
247 Ga0501071_0396543 3300049587 Bacteria 1053
248 Ga0501072_0040244 3300049588 Bacteria 3670
249 Ga0501072_0096849 3300049588 Bacteria 2345
250 Ga0501072_0103320 3300049588 Bacteria 2265
251 Ga0501072_0944789 3300049588 Bacteria 673
252 Ga0501073_0003045 3300049589 Bacteria 12569
253 Ga0501074_0140356 3300049590 Bacteria 1728
254 Ga0501074_0190327 3300049590 Bacteria 1463
255 Ga0501074_0314164 3300049590 Bacteria 1113
256 Ga0501075_0125745 3300049591 Bacteria 1952
257 Ga0501075_0285840 3300049591 Bacteria 1256
258 Ga0501075_0354907 3300049591 Bacteria 1117
259 Ga0501075_0466730 3300049591 Bacteria 963
260 Ga0501075_0827609 3300049591 Bacteria 704
261 Ga0501076_0023755 3300049592 Bacteria 4729
262 Ga0501076_0219653 3300049592 Bacteria 1553
263 Ga0501076_0233781 3300049592 Bacteria 1503
264 Ga0501076_0245075 3300049592 Bacteria 1466
265 Ga0501076_0257809 3300049592 Bacteria 1427
266 Ga0501076_0500467 3300049592 Bacteria 1002
267 Ga0501077_0040258 3300049593 Bacteria 2978
268 Ga0501077_0370203 3300049593 Bacteria 915
269 Ga0501079_0121636 3300049741 Bacteria 2030
270 Ga0501079_0405375 3300049741 Bacteria 1069
271 Ga0501080_0000080 3300049742 Bacteria 65358
272 Ga0501080_0388734 3300049742 Bacteria 1256
273 Ga0501080_0421817 3300049742 Bacteria 1198
274 Ga0501081_0055637 3300049743 Bacteria 2734
275 Ga0501081_0064045 3300049743 Bacteria 2553
276 Ga0501081_0504952 3300049743 Bacteria 901
277 Ga0501083_0018547 3300049744 Bacteria 4848
278 Ga0501035_0003311 3300049822 Bacteria 15438
279 Ga0501035_0004801 3300049822 Bacteria 12812
280 Ga0501035_0281287 3300049822 Bacteria 1406
281 Ga0501044_0004098 3300049823 Bacteria 16346
282 Ga0501044_0041756 3300049823 Bacteria 4774
283 Ga0501044_0455280 3300049823 Bacteria 1186
284 Ga0501045_0020387 3300049824 Bacteria 4734
285 Ga0501045_0036591 3300049824 Bacteria 3565
286 Ga0501045_0068838 3300049824 Bacteria 2601
287 Ga0501045_0139485 3300049824 Bacteria 1803
288 Ga0501045_0290240 3300049824 Bacteria 1217
289 Ga0501212_031911 3300049851 Bacteria 852
290 nmdc:mga03683_415213_c1 3300050489 Bacteria 644
291 nmdc:mga03n38_484338_c1 3300050490 Bacteria 692
292 nmdc:mga06z11_103475_c1 3300050494 Bacteria 1566
293 Ga0495601_0319115 3300053077 Bacteria 1012
294 Ga0495612_0034374 3300053078 Bacteria 2053
295 Ga0500573_0003612 3300053140 Bacteria 8026
296 Ga0500620_031036 3300053155 Bacteria 1692
297 Ga0501084_0000676 3300054114 Bacteria 26008
298 Ga0501084_0124112 3300054114 Bacteria 2172
299 Ga0501084_0206526 3300054114 Bacteria 1657
300 Ga0501084_0234143 3300054114 Bacteria 1550
301 Ga0590071_083923 3300059421 Bacteria 794
302 Ga0501082_0067146 3300060353 Bacteria 3088
303 Ga0501082_0084717 3300060353 Bacteria 2733
304 Ga0501082_0300805 3300060353 Bacteria 1397
305 Ga0501082_0582099 3300060353 Bacteria 979
306 Ga0501082_0640250 3300060353 Bacteria 930
307 Ga0501082_1084826 3300060353 Bacteria 700
308 Ga0466962_0013584 3300061719 Bacteria 3921
309 Ga0466962_0113079 3300061719 Bacteria 1308
310 Ga0466962_0342067 3300061719 Bacteria 744
311 Ga0530510_0053513 3300061734 Bacteria 2917
312 Ga0530510_0081161 3300061734 Bacteria 2361
313 Ga0530510_0098421 3300061734 Bacteria 2139
314 Ga0530510_0582449 3300061734 Bacteria 851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_1063063 Ga0496102_1063063_201_710 166
2 3300025893 Ga0207682_10113906 Ga0207682_101139062 177
3 3300045976 Ga0466967_1084500 Ga0466967_1084500_44_583 177
4 3300041451 Ga0451791_0005626 Ga0451791_0005626_130_672 179
5 3300041452 Ga0451793_0237533 Ga0451793_0237533_34_576 179
6 3300044683 Ga0466965_0374808 Ga0466965_0374808_138_683 179
7 3300049568 Ga0501031_0482370 Ga0501031_0482370_13_564 179
8 3300049575 Ga0501039_0056852 Ga0501039_0056852_2269_2811 179
9 3300049580 Ga0501046_0067214 Ga0501046_0067214_13_564 179
10 3300049582 Ga0501048_0198813 Ga0501048_0198813_368_910 179
11 3300049590 Ga0501074_0190327 Ga0501074_0190327_600_1142 179
12 3300049592 Ga0501076_0257809 Ga0501076_0257809_482_1024 179
13 3300049743 Ga0501081_0504952 Ga0501081_0504952_45_596 179
14 3300049824 Ga0501045_0139485 Ga0501045_0139485_1247_1789 179
15 3300050494 nmdc:mga06z11_103475_c1 nmdc:mga06z11_103475_c1_340_882 179
16 3300053077 Ga0495601_0319115 Ga0495601_0319115_11_550 179
17 3300060353 Ga0501082_0300805 Ga0501082_0300805_551_1093 179
18 3300060353 Ga0501082_1084826 Ga0501082_1084826_136_678 179
19 3300049584 Ga0501068_0040102 Ga0501068_0040102_1067_1612 181
20 3300009098 Ga0105245_10166087 Ga0105245_101660872 182
21 3300009147 Ga0114129_10697049 Ga0114129_106970491 182
22 3300011119 Ga0105246_10350650 Ga0105246_103506502 182
23 3300013308 Ga0157375_10247539 Ga0157375_102475392 182
24 3300014325 Ga0163163_10179827 Ga0163163_101798272 182
25 3300014745 Ga0157377_10146624 Ga0157377_101466242 182
26 3300014969 Ga0157376_10300103 Ga0157376_103001032 182
27 3300041512 Ga0451853_1590062 Ga0451853_1590062_589_1140 182
28 3300048917 Ga0496114_0154190 Ga0496114_0154190_154_705 182
29 3300049568 Ga0501031_0000201 Ga0501031_0000201_11975_12535 182
30 3300049569 Ga0501032_0002612 Ga0501032_0002612_7960_8520 182
31 3300049570 Ga0501033_0000425 Ga0501033_0000425_28017_28577 182
32 3300049571 Ga0501034_0002197 Ga0501034_0002197_5148_5708 182
33 3300049572 Ga0501036_0000247 Ga0501036_0000247_7774_8334 182
34 3300049573 Ga0501037_0001791 Ga0501037_0001791_11834_12394 182
35 3300049574 Ga0501038_0005968 Ga0501038_0005968_5148_5708 182
36 3300049575 Ga0501039_0000234 Ga0501039_0000234_28029_28589 182
37 3300049576 Ga0501040_0076288 Ga0501040_0076288_774_1334 182
38 3300049578 Ga0501042_0076777 Ga0501042_0076777_1029_1589 182
39 3300049579 Ga0501043_0000375 Ga0501043_0000375_28179_28739 182
40 3300049580 Ga0501046_0000758 Ga0501046_0000758_18305_18865 182
41 3300049581 Ga0501047_0082533 Ga0501047_0082533_1671_2231 182
42 3300049582 Ga0501048_0000238 Ga0501048_0000238_7789_8349 182
43 3300049583 Ga0501067_0014580 Ga0501067_0014580_3042_3602 182
44 3300049584 Ga0501068_0011657 Ga0501068_0011657_2062_2622 182
45 3300049585 Ga0501069_0000112 Ga0501069_0000112_28128_28688 182
46 3300049586 Ga0501070_0028926 Ga0501070_0028926_3756_4316 182
47 3300049587 Ga0501071_0078284 Ga0501071_0078284_1376_1936 182
48 3300049589 Ga0501073_0003045 Ga0501073_0003045_7501_8061 182
49 3300049592 Ga0501076_0245075 Ga0501076_0245075_489_1049 182
50 3300049742 Ga0501080_0000080 Ga0501080_0000080_7717_8277 182
51 3300049744 Ga0501083_0018547 Ga0501083_0018547_2397_2957 182
52 3300049822 Ga0501035_0003311 Ga0501035_0003311_11796_12356 182
53 3300049823 Ga0501044_0041756 Ga0501044_0041756_3884_4444 182
54 3300049824 Ga0501045_0068838 Ga0501045_0068838_550_1110 182
55 3300053140 Ga0500573_0003612 Ga0500573_0003612_453_1001 182
56 3300054114 Ga0501084_0000676 Ga0501084_0000676_4497_5057 182
57 3300046683 Ga0495658_0284654 Ga0495658_0284654_15_632 183
58 3300049572 Ga0501036_0040490 Ga0501036_0040490_1716_2276 184
59 3300049575 Ga0501039_0088558 Ga0501039_0088558_783_1343 184
60 3300049576 Ga0501040_0012377 Ga0501040_0012377_1498_2058 184
61 3300049577 Ga0501041_0077113 Ga0501041_0077113_749_1309 184
62 3300049578 Ga0501042_0078897 Ga0501042_0078897_131_691 184
63 3300049587 Ga0501071_0062879 Ga0501071_0062879_1491_2051 184
64 3300049588 Ga0501072_0103320 Ga0501072_0103320_978_1538 184
65 3300049591 Ga0501075_0125745 Ga0501075_0125745_1308_1868 184
66 3300049592 Ga0501076_0219653 Ga0501076_0219653_621_1181 184
67 3300049593 Ga0501077_0370203 Ga0501077_0370203_87_647 184
68 3300049741 Ga0501079_0121636 Ga0501079_0121636_1205_1765 184
69 3300049742 Ga0501080_0421817 Ga0501080_0421817_564_1124 184
70 3300049743 Ga0501081_0055637 Ga0501081_0055637_818_1378 184
71 3300049824 Ga0501045_0036591 Ga0501045_0036591_425_985 184
72 3300050490 nmdc:mga03n38_484338_c1 nmdc:mga03n38_484338_c1_56_613 184
73 3300054114 Ga0501084_0124112 Ga0501084_0124112_1394_1954 184
74 3300060353 Ga0501082_0067146 Ga0501082_0067146_1513_2073 184
75 3300061734 Ga0530510_0081161 Ga0530510_0081161_861_1421 184
76 3300005343 Ga0070687_100115628 Ga0070687_1001156282 185
77 3300005719 Ga0068861_100133900 Ga0068861_1001339002 185
78 3300041512 Ga0451853_2768049 Ga0451853_2768049_164_733 185
79 3300045976 Ga0466967_1091677 Ga0466967_1091677_196_756 185
80 3300048909 Ga0496106_0249504 Ga0496106_0249504_140_700 185
81 3300048910 Ga0496107_0136634 Ga0496107_0136634_54_614 185
82 3300049851 Ga0501212_031911 Ga0501212_031911_122_682 185
83 iso_pu_bacteria 2919395869 2919396635 185
84 3300001979 JGI24740J21852_10003944 JGI24740J21852_100039442 189
85 3300002738 JGI25154J39366_1002452 JGI25154J39366_10024522 189
86 3300046463 Ga0495653_0117250 Ga0495653_0117250_239_820 190
87 3300020081 Ga0206354_10560591 Ga0206354_105605911 191
88 3300025919 Ga0207657_10218507 Ga0207657_102185072 191
89 3300025932 Ga0207690_10063189 Ga0207690_100631892 191
90 3300025937 Ga0207669_10558327 Ga0207669_105583271 191
91 3300026075 Ga0207708_10226663 Ga0207708_102266632 191
92 3300049575 Ga0501039_0638557 Ga0501039_0638557_115_690 191
93 3300050489 nmdc:mga03683_415213_c1 nmdc:mga03683_415213_c1_36_611 191
94 3300005338 Ga0068868_100439822 Ga0068868_1004398222 194
95 3300005459 Ga0068867_100172130 Ga0068867_1001721302 194
96 3300005618 Ga0068864_100554873 Ga0068864_1005548732 194
97 3300005842 Ga0068858_100230393 Ga0068858_1002303932 194
98 3300006881 Ga0068865_100680189 Ga0068865_1006801892 194
99 3300009098 Ga0105245_10169389 Ga0105245_101693892 194
100 3300009148 Ga0105243_10099598 Ga0105243_100995982 194
101 3300009177 Ga0105248_10558653 Ga0105248_105586532 194
102 3300010375 Ga0105239_11619877 Ga0105239_116198771 194
103 3300011119 Ga0105246_10361514 Ga0105246_103615142 194
104 3300013308 Ga0157375_10290741 Ga0157375_102907413 194
105 3300014325 Ga0163163_10088742 Ga0163163_100887422 194
106 3300025927 Ga0207687_10400534 Ga0207687_104005342 194
107 3300025938 Ga0207704_10201857 Ga0207704_102018572 194
108 3300026089 Ga0207648_10261727 Ga0207648_102617272 194
109 3300030742 Ga0316183_1068223 Ga0316183_10682232 194
110 3300048909 Ga0496106_0647861 Ga0496106_0647861_39_629 194
111 3300048911 Ga0496108_0654250 Ga0496108_0654250_127_717 194
112 3300049568 Ga0501031_0022508 Ga0501031_0022508_3312_3905 194
113 3300049569 Ga0501032_0129177 Ga0501032_0129177_602_1195 194
114 3300049570 Ga0501033_0271239 Ga0501033_0271239_413_1006 194
115 3300049572 Ga0501036_0054986 Ga0501036_0054986_662_1255 194
116 3300049574 Ga0501038_0032220 Ga0501038_0032220_3534_4127 194
117 3300049575 Ga0501039_0109513 Ga0501039_0109513_403_996 194
118 3300049576 Ga0501040_0004216 Ga0501040_0004216_4314_4907 194
119 3300049577 Ga0501041_0041787 Ga0501041_0041787_222_815 194
120 3300049578 Ga0501042_0196618 Ga0501042_0196618_535_1128 194
121 3300049582 Ga0501048_0691687 Ga0501048_0691687_99_692 194
122 3300049587 Ga0501071_0041045 Ga0501071_0041045_2017_2610 194
123 3300049588 Ga0501072_0040244 Ga0501072_0040244_2944_3537 194
124 3300049590 Ga0501074_0140356 Ga0501074_0140356_755_1348 194
125 3300049591 Ga0501075_0285840 Ga0501075_0285840_337_930 194
126 3300049591 Ga0501075_0827609 Ga0501075_0827609_83_676 194
127 3300049592 Ga0501076_0023755 Ga0501076_0023755_403_996 194
128 3300049593 Ga0501077_0040258 Ga0501077_0040258_906_1499 194
129 3300049741 Ga0501079_0405375 Ga0501079_0405375_320_913 194
130 3300049742 Ga0501080_0388734 Ga0501080_0388734_251_844 194
131 3300049743 Ga0501081_0064045 Ga0501081_0064045_540_1133 194
132 3300049822 Ga0501035_0281287 Ga0501035_0281287_662_1255 194
133 3300049824 Ga0501045_0020387 Ga0501045_0020387_434_1027 194
134 3300049824 Ga0501045_0290240 Ga0501045_0290240_180_773 194
135 3300054114 Ga0501084_0206526 Ga0501084_0206526_81_674 194
136 3300060353 Ga0501082_0084717 Ga0501082_0084717_373_966 194
137 3300061734 Ga0530510_0053513 Ga0530510_0053513_1709_2302 194
138 3300005327 Ga0070658_10476448 Ga0070658_104764482 195
139 3300005354 Ga0070675_100768051 Ga0070675_1007680511 195
140 3300005355 Ga0070671_100536497 Ga0070671_1005364972 195
141 3300005616 Ga0068852_100039204 Ga0068852_1000392042 195
142 3300009098 Ga0105245_10169299 Ga0105245_101692992 195
143 3300009551 Ga0105238_10333775 Ga0105238_103337752 195
144 3300013308 Ga0157375_10028754 Ga0157375_100287542 195
145 3300014325 Ga0163163_10060062 Ga0163163_100600623 195
146 3300025931 Ga0207644_10357759 Ga0207644_103577592 195
147 3300025942 Ga0207689_10189306 Ga0207689_101893062 195
148 3300025945 Ga0207679_10078497 Ga0207679_100784973 195
149 3300031901 Ga0307406_10080000 Ga0307406_100800001 195
150 3300044706 Ga0466964_0049934 Ga0466964_0049934_61_648 195
151 3300048906 Ga0496103_0231855 Ga0496103_0231855_426_1022 195
152 3300048914 Ga0496111_0194786 Ga0496111_0194786_874_1470 195
153 3300048915 Ga0496112_0135677 Ga0496112_0135677_619_1215 195
154 3300048916 Ga0496113_0088789 Ga0496113_0088789_491_1087 195
155 3300048917 Ga0496114_0025522 Ga0496114_0025522_3302_3898 195
156 iso_pu_bacteria 2883821847 2883824449 195
157 3300005577 Ga0068857_100408070 Ga0068857_1004080701 196
158 3300026116 Ga0207674_10341053 Ga0207674_103410531 196
159 3300028380 Ga0268265_10783803 Ga0268265_107838032 196
160 3300005329 Ga0070683_100053498 Ga0070683_1000534982 198
161 3300005338 Ga0068868_100478965 Ga0068868_1004789652 198
162 3300005614 Ga0068856_100536212 Ga0068856_1005362122 198
163 3300009098 Ga0105245_10182133 Ga0105245_101821332 198
164 3300009551 Ga0105238_10798869 Ga0105238_107988691 198
165 3300013105 Ga0157369_10504529 Ga0157369_105045292 198
166 3300025927 Ga0207687_10212592 Ga0207687_102125922 198
167 3300025932 Ga0207690_11038371 Ga0207690_110383711 198
168 3300025944 Ga0207661_10395690 Ga0207661_103956902 198
169 3300026023 Ga0207677_10222503 Ga0207677_102225032 198
170 3300026075 Ga0207708_10986747 Ga0207708_109867471 198
171 3300026078 Ga0207702_10278383 Ga0207702_102783832 198
172 3300026088 Ga0207641_10604945 Ga0207641_106049452 198
173 3300035691 Ga0373931_0379692 Ga0373931_0379692_129_728 198
174 3300041459 Ga0451800_0280938 Ga0451800_0280938_75_677 198
175 3300041512 Ga0451853_1871461 Ga0451853_1871461_1883_2485 198
176 3300046683 Ga0495658_0100638 Ga0495658_0100638_71_670 198
177 3300048903 Ga0496100_0034824 Ga0496100_0034824_662_1261 198
178 3300048904 Ga0496101_0051856 Ga0496101_0051856_534_1133 198
179 3300048905 Ga0496102_0059011 Ga0496102_0059011_1917_2516 198
180 3300048906 Ga0496103_0067267 Ga0496103_0067267_643_1242 198
181 3300048907 Ga0496104_0042693 Ga0496104_0042693_3061_3660 198
182 3300048910 Ga0496107_0586414 Ga0496107_0586414_140_739 198
183 3300048911 Ga0496108_0132045 Ga0496108_0132045_1067_1666 198
184 3300048913 Ga0496110_0083328 Ga0496110_0083328_1684_2283 198
185 3300048914 Ga0496111_0121322 Ga0496111_0121322_887_1486 198
186 3300048915 Ga0496112_0340740 Ga0496112_0340740_397_996 198
187 3300061734 Ga0530510_0098421 Ga0530510_0098421_712_1311 198
188 3300006051 Ga0075364_10110887 Ga0075364_101108872 199
189 3300013105 Ga0157369_10231604 Ga0157369_102316042 199
190 3300013307 Ga0157372_10214224 Ga0157372_102142243 199
191 3300031731 Ga0307405_10539593 Ga0307405_105395931 199
192 3300032126 Ga0307415_100075360 Ga0307415_1000753602 199
193 3300037853 Ga0436364_0857252 Ga0436364_0857252_975_1574 199
194 3300044658 Ga0466972_0132577 Ga0466972_0132577_64_675 199
195 3300044683 Ga0466965_0065147 Ga0466965_0065147_1149_1760 199
196 3300044765 Ga0466970_0091541 Ga0466970_0091541_694_1305 199
197 3300044901 Ga0466960_0029937 Ga0466960_0029937_1104_1715 199
198 3300049570 Ga0501033_0500198 Ga0501033_0500198_64_663 199
199 3300049573 Ga0501037_0709785 Ga0501037_0709785_44_643 199
200 3300049574 Ga0501038_0201979 Ga0501038_0201979_551_1150 199
201 3300049575 Ga0501039_0258236 Ga0501039_0258236_95_694 199
202 3300049576 Ga0501040_0069331 Ga0501040_0069331_397_996 199
203 3300049578 Ga0501042_0049985 Ga0501042_0049985_1149_1748 199
204 3300049582 Ga0501048_0176454 Ga0501048_0176454_335_934 199
205 3300049582 Ga0501048_0221541 Ga0501048_0221541_704_1303 199
206 3300049587 Ga0501071_0363879 Ga0501071_0363879_59_658 199
207 3300049588 Ga0501072_0944789 Ga0501072_0944789_44_643 199
208 3300049592 Ga0501076_0233781 Ga0501076_0233781_660_1259 199
209 3300049823 Ga0501044_0455280 Ga0501044_0455280_330_941 199
210 3300054114 Ga0501084_0234143 Ga0501084_0234143_351_950 199
211 3300059421 Ga0590071_083923 Ga0590071_083923_89_688 199
212 3300060353 Ga0501082_0582099 Ga0501082_0582099_243_842 199
213 3300060353 Ga0501082_0640250 Ga0501082_0640250_169_768 199
214 3300061719 Ga0466962_0342067 Ga0466962_0342067_68_679 199
215 3300049583 Ga0501067_0071221 Ga0501067_0071221_493_1107 200
216 3300049585 Ga0501069_0020790 Ga0501069_0020790_76_690 200
217 3300053155 Ga0500620_031036 Ga0500620_031036_856_1467 200
218 iso_pu_bacteria 2739367898 2740166180 200
219 iso_pu_bacteria 8054609563 8054610055 201
220 3300041494 Ga0451837_0491570 Ga0451837_0491570_520_1134 202
221 iso_pu_bacteria 2643221561 2643827675 202
222 iso_pu_bacteria 2643221696 2644534929 202
223 3300046477 Ga0495664_0030739 Ga0495664_0030739_1217_1828 203
224 3300046663 Ga0495635_0065322 Ga0495635_0065322_1313_1924 203
225 3300049587 Ga0501071_0396543 Ga0501071_0396543_314_928 203
226 3300049588 Ga0501072_0096849 Ga0501072_0096849_597_1211 203
227 3300049590 Ga0501074_0314164 Ga0501074_0314164_414_1028 203
228 3300049591 Ga0501075_0354907 Ga0501075_0354907_76_690 203
229 3300049592 Ga0501076_0500467 Ga0501076_0500467_17_631 203
230 3300053078 Ga0495612_0034374 Ga0495612_0034374_567_1178 203
231 3300061734 Ga0530510_0582449 Ga0530510_0582449_211_825 203
232 3300005467 Ga0070706_100665462 Ga0070706_1006654622 204
233 3300005468 Ga0070707_100076272 Ga0070707_1000762722 204
234 3300005471 Ga0070698_100110006 Ga0070698_1001100062 204
235 3300025922 Ga0207646_10175443 Ga0207646_101754432 204
236 3300031824 Ga0307413_10184026 Ga0307413_101840262 204
237 3300031995 Ga0307409_100266278 Ga0307409_1002662782 204
238 3300044684 Ga0466966_0068961 Ga0466966_0068961_991_1605 204
239 3300049584 Ga0501068_0489082 Ga0501068_0489082_126_743 204
240 3300006038 Ga0075365_10088657 Ga0075365_100886572 205
241 3300026067 Ga0207678_10550834 Ga0207678_105508342 205
242 3300031852 Ga0307410_10130193 Ga0307410_101301932 205
243 3300031903 Ga0307407_10198722 Ga0307407_101987221 205
244 3300032004 Ga0307414_10382082 Ga0307414_103820822 205
245 3300032004 Ga0307414_10588934 Ga0307414_105889342 205
246 3300032126 Ga0307415_100031860 Ga0307415_1000318601 205
247 3300041492 Ga0451835_0485672 Ga0451835_0485672_74_694 205
248 3300041494 Ga0451837_0150336 Ga0451837_0150336_49_669 205
249 3300041509 Ga0451843_0210803 Ga0451843_0210803_13_633 205
250 3300041512 Ga0451853_0156145 Ga0451853_0156145_335_955 205
251 3300044765 Ga0466970_0124544 Ga0466970_0124544_758_1393 205
252 3300044901 Ga0466960_0150282 Ga0466960_0150282_482_1114 205
253 3300048905 Ga0496102_0589376 Ga0496102_0589376_341_961 205
254 3300049568 Ga0501031_0053746 Ga0501031_0053746_437_1057 205
255 3300049568 Ga0501031_0134238 Ga0501031_0134238_610_1230 205
256 3300049569 Ga0501032_0098147 Ga0501032_0098147_1008_1631 205
257 3300049570 Ga0501033_0063680 Ga0501033_0063680_1038_1661 205
258 3300049571 Ga0501034_0010965 Ga0501034_0010965_915_1538 205
259 3300049572 Ga0501036_0010955 Ga0501036_0010955_1375_1998 205
260 3300049572 Ga0501036_0118175 Ga0501036_0118175_127_747 205
261 3300049573 Ga0501037_0005898 Ga0501037_0005898_4969_5592 205
262 3300049573 Ga0501037_0224805 Ga0501037_0224805_664_1284 205
263 3300049574 Ga0501038_0002504 Ga0501038_0002504_11087_11710 205
264 3300049575 Ga0501039_0411318 Ga0501039_0411318_317_940 205
265 3300049578 Ga0501042_0135741 Ga0501042_0135741_267_887 205
266 3300049578 Ga0501042_0281948 Ga0501042_0281948_102_722 205
267 3300049579 Ga0501043_0253949 Ga0501043_0253949_98_721 205
268 3300049580 Ga0501046_0018081 Ga0501046_0018081_3999_4622 205
269 3300049581 Ga0501047_0013840 Ga0501047_0013840_4624_5247 205
270 3300049582 Ga0501048_0027999 Ga0501048_0027999_1199_1822 205
271 3300049586 Ga0501070_0672335 Ga0501070_0672335_82_702 205
272 3300049591 Ga0501075_0466730 Ga0501075_0466730_186_806 205
273 3300049822 Ga0501035_0004801 Ga0501035_0004801_7695_8318 205
274 3300049823 Ga0501044_0004098 Ga0501044_0004098_6950_7573 205
275 3300044901 Ga0466960_0014012 Ga0466960_0014012_188_811 206
276 3300045976 Ga0466967_0079133 Ga0466967_0079133_1276_1899 206
277 3300049584 Ga0501068_0297121 Ga0501068_0297121_252_875 206
278 3300049585 Ga0501069_0264730 Ga0501069_0264730_153_776 206
279 3300044693 Ga0466961_0318985 Ga0466961_0318985_104_730 207
280 3300005331 Ga0070670_100706528 Ga0070670_1007065281 208
281 3300005343 Ga0070687_100060822 Ga0070687_1000608222 208
282 3300005347 Ga0070668_100078733 Ga0070668_1000787332 208
283 3300005356 Ga0070674_100049234 Ga0070674_1000492343 208
284 3300005456 Ga0070678_100617274 Ga0070678_1006172742 208
285 3300005616 Ga0068852_100414227 Ga0068852_1004142272 208
286 3300005618 Ga0068864_100692257 Ga0068864_1006922572 208
287 3300005719 Ga0068861_100408575 Ga0068861_1004085752 208
288 3300005840 Ga0068870_10036571 Ga0068870_100365712 208
289 3300006038 Ga0075365_10000585 Ga0075365_100005856 208
290 3300017792 Ga0163161_10078290 Ga0163161_100782902 208
291 3300025908 Ga0207643_10036816 Ga0207643_100368163 208
292 3300025918 Ga0207662_10061229 Ga0207662_100612292 208
293 3300025925 Ga0207650_10377329 Ga0207650_103773292 208
294 3300025937 Ga0207669_10466452 Ga0207669_104664522 208
295 3300025961 Ga0207712_10270432 Ga0207712_102704322 208
296 3300025972 Ga0207668_10649486 Ga0207668_106494862 208
297 3300026089 Ga0207648_10076121 Ga0207648_100761213 208
298 3300026118 Ga0207675_100510544 Ga0207675_1005105442 208
299 3300026121 Ga0207683_10124411 Ga0207683_101244112 208
300 3300032002 Ga0307416_100214765 Ga0307416_1002147652 208
301 3300044658 Ga0466972_0083269 Ga0466972_0083269_282_911 208
302 3300044683 Ga0466965_0078060 Ga0466965_0078060_308_934 208
303 3300044683 Ga0466965_0084061 Ga0466965_0084061_827_1456 208
304 3300044684 Ga0466966_0048048 Ga0466966_0048048_678_1304 208
305 3300044684 Ga0466966_0124023 Ga0466966_0124023_573_1202 208
306 3300044693 Ga0466961_0035478 Ga0466961_0035478_711_1340 208
307 3300044693 Ga0466961_0087834 Ga0466961_0087834_373_999 208
308 3300044694 Ga0466963_0651427 Ga0466963_0651427_28_654 208
309 3300044706 Ga0466964_0023032 Ga0466964_0023032_1104_1730 208
310 3300044719 Ga0466971_0155392 Ga0466971_0155392_334_963 208
311 3300044765 Ga0466970_0014097 Ga0466970_0014097_48_674 208
312 3300044765 Ga0466970_0040792 Ga0466970_0040792_1454_2083 208
313 3300044765 Ga0466970_0151247 Ga0466970_0151247_213_839 208
314 3300044842 Ga0466957_0721458 Ga0466957_0721458_12_638 208
315 3300044901 Ga0466960_0011152 Ga0466960_0011152_2689_3318 208
316 3300045836 Ga0466958_0126998 Ga0466958_0126998_596_1222 208
317 3300045976 Ga0466967_0065771 Ga0466967_0065771_786_1412 208
318 3300061719 Ga0466962_0013584 Ga0466962_0013584_2478_3104 208
319 3300061719 Ga0466962_0113079 Ga0466962_0113079_278_907 208
320 3300000549 LJQas_1002553 LJQas_10025532 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11452

DUF3000

Protein of unknown function (DUF3000)

31

210

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tqd-assembly1.cif.gz_B structure of enterobacter cloacae cap2-cdnd02 2:1 complex 0.5252 22 91
5nqx-assembly3.cif.gz_B structure of a fhbp(v1.1):pora(p1.16) chimera. fusion at fhbp position 294. 0.5128 38 96
7brs-assembly3.cif.gz_C e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.4909 24 99
3fzb-assembly1.cif.gz_H crystal structure of the tail terminator protein from phage lambda (gpu-wt) 0.4686 86 162
7pnw-assembly1.cif.gz_H mouse mitochondrial ribosome small subunit lacking m5u modification 0.4534 87 187
ID Description Score Start End Superfamily
af_O86317_22_202_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8659 17 198 3.30.1460.10
af_O86317_22_202_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8567 17 198 3.30.1460.10
af_Q54MN2_4_160_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7541 53 76 3.40.630.30
af_K7LC61_429_544_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.6062 59 187 3.30.70.60
af_K7LC61_429_544_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.5546 59 187 3.30.70.60
ID Description Score Start End GO Terms
AF-A0A3N9Y730-F1-model_v4 DUF3000 domain-containing protein 0.9636 11 186
AF-A0A7K0VWQ8-F1-model_v4 DUF3000 family protein 0.9491 14 133
AF-A0A3N9Y730-F1-model_v4 DUF3000 domain-containing protein 0.947 11 186
AF-A0A853BH64-F1-model_v4 Enoyl-CoA hydratase 0.9467 32 193
AF-A0A841FCC4-F1-model_v4 DUF3000 domain-containing protein 0.9408 12 200

Feature Viewer

pLDDT pTM Quality
82.98 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map