F405658

General Info

Members Datasets Scaffolds Average Seq Length
320 172 640 191

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0370207|Ga0466959_0370207_69_734
Length 221
Sequence MRERFIVLRLAARRRFRQLAGGKRQNYAHPMRLAFLACMILALAACHKPARQFPETNETAAQPQAGPVKGLDRTHRGTLMPDISFDDPDGHQTSLTKFSGKPLLVNLWATWCAPCVKELPTLDRLAQSHEKDGALSVLAVSEDFGPHPSVVAFLDTHKIRKLAAYQDAKSNLSSGLGAEVLPTSILFDAQGHELWRYVGDLDWTSPQAAKLLSEAAARRKS

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
148 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
149 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.12
Rhizosphere 95.94
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0370207 3300045049 Bacteria 976
2 JGI24741J21665_1016784 3300001915 Bacteria 1191
3 JGI24740J21852_10000089 3300001979 Bacteria 31515
4 JGI24740J21852_10088291 3300001979 Bacteria 802
5 JGI24739J22299_10000097 3300001989 Bacteria 25965
6 JGI24737J22298_10000037 3300001990 Bacteria 37991
7 JGI24737J22298_10003214 3300001990 Bacteria 5798
8 JGI24735J21928_10009235 3300002067 Bacteria 3172
9 JGI24745J21846_1003903 3300002073 Bacteria 1577
10 JGI24738J21930_10000023 3300002075 Bacteria 29088
11 JGI24034J26672_10018938 3300002239 Bacteria 1071
12 rootH1_10067058 3300003323 Bacteria 2095
13 Ga0070658_10016317 3300005327 Bacteria 5943
14 Ga0070658_10058469 3300005327 Bacteria 3138
15 Ga0070658_10073207 3300005327 Bacteria 2809
16 Ga0070658_10743382 3300005327 Bacteria 852
17 Ga0070658_10994682 3300005327 Bacteria 729
18 Ga0070676_10071807 3300005328 Bacteria 2080
19 Ga0070683_100178198 3300005329 Bacteria 2017
20 Ga0070683_100247961 3300005329 Bacteria 1693
21 Ga0070690_100027804 3300005330 Bacteria 3499
22 Ga0070670_100028176 3300005331 Bacteria 4834
23 Ga0070670_100067896 3300005331 Bacteria 3059
24 Ga0070670_100081523 3300005331 Bacteria 2780
25 Ga0068869_100002765 3300005334 Bacteria 10626
26 Ga0070666_10044110 3300005335 Bacteria 2987
27 Ga0070666_10140435 3300005335 Bacteria 1682
28 Ga0068868_100007692 3300005338 Bacteria 7686
29 Ga0068868_100842714 3300005338 Bacteria 830
30 Ga0070660_100002456 3300005339 Bacteria 12715
31 Ga0070660_100018599 3300005339 Bacteria 5080
32 Ga0070660_100178980 3300005339 Bacteria 1715
33 Ga0070660_100266809 3300005339 Bacteria 1399
34 Ga0070660_100492330 3300005339 Bacteria 1019
35 Ga0070661_100073829 3300005344 Bacteria 2511
36 Ga0070661_100143697 3300005344 Bacteria 1799
37 Ga0070668_100004892 3300005347 Bacteria 9932
38 Ga0070668_100198471 3300005347 Bacteria 1646
39 Ga0070668_100562251 3300005347 Bacteria 994
40 Ga0070669_100000174 3300005353 Bacteria 56290
41 Ga0070671_100014533 3300005355 Bacteria 6365
42 Ga0070671_100015323 3300005355 Bacteria 6191
43 Ga0070671_100070346 3300005355 Bacteria 2919
44 Ga0070671_100611998 3300005355 Bacteria 942
45 Ga0070674_100060156 3300005356 Bacteria 2647
46 Ga0070674_100236121 3300005356 Bacteria 1429
47 Ga0070673_100000337 3300005364 Bacteria 24629
48 Ga0070673_100005138 3300005364 Bacteria 8347
49 Ga0070673_101006577 3300005364 Bacteria 776
50 Ga0070659_100000674 3300005366 Bacteria 24835
51 Ga0070659_100015956 3300005366 Bacteria 5633
52 Ga0070659_100025963 3300005366 Bacteria 4506
53 Ga0070659_100143729 3300005366 Bacteria 1943
54 Ga0070659_100174680 3300005366 Bacteria 1761
55 Ga0070659_100206390 3300005366 Bacteria 1618
56 Ga0070659_100271435 3300005366 Bacteria 1409
57 Ga0070667_100003559 3300005367 Bacteria 13269
58 Ga0070667_100094286 3300005367 Bacteria 2579
59 Ga0070667_100180837 3300005367 Bacteria 1865
60 Ga0070709_10368054 3300005434 Bacteria 1066
61 Ga0070714_100366674 3300005435 Bacteria 1355
62 Ga0070713_100420155 3300005436 Bacteria 1251
63 Ga0070700_100510985 3300005441 Bacteria 926
64 Ga0070663_100266451 3300005455 Bacteria 1360
65 Ga0070663_100496674 3300005455 Bacteria 1012
66 Ga0070678_100168970 3300005456 Bacteria 1779
67 Ga0070662_100001658 3300005457 Bacteria 13697
68 Ga0070662_100023203 3300005457 Bacteria 4260
69 Ga0070662_100067075 3300005457 Bacteria 2634
70 Ga0070662_100089286 3300005457 Bacteria 2312
71 Ga0070662_100338984 3300005457 Bacteria 1229
72 Ga0070681_10082427 3300005458 Bacteria 3171
73 Ga0070681_10122313 3300005458 Bacteria 2536
74 Ga0070681_10166046 3300005458 Bacteria 2130
75 Ga0068867_100004031 3300005459 Bacteria 10331
76 Ga0070706_100494581 3300005467 Bacteria 1138
77 Ga0070679_100327177 3300005530 Bacteria 1481
78 Ga0070679_100654781 3300005530 Bacteria 993
79 Ga0070679_100698991 3300005530 Bacteria 957
80 Ga0070684_100658591 3300005535 Bacteria 975
81 Ga0068853_100000811 3300005539 Bacteria 21781
82 Ga0068853_100148447 3300005539 Bacteria 2109
83 Ga0068853_100152004 3300005539 Bacteria 2084
84 Ga0068853_100511950 3300005539 Bacteria 1134
85 Ga0070672_100000945 3300005543 Bacteria 17467
86 Ga0070686_100424743 3300005544 Bacteria 1016
87 Ga0070695_100125332 3300005545 Bacteria 1763
88 Ga0070696_100033648 3300005546 Bacteria 3523
89 Ga0070693_100069722 3300005547 Bacteria 2067
90 Ga0070665_100003604 3300005548 Bacteria 16399
91 Ga0070665_100030361 3300005548 Bacteria 5439
92 Ga0070665_100117227 3300005548 Bacteria 2665
93 Ga0070665_100916275 3300005548 Bacteria 889
94 Ga0070704_100236785 3300005549 Bacteria 1492
95 Ga0068855_100003900 3300005563 Bacteria 18212
96 Ga0068855_100509082 3300005563 Bacteria 1307
97 Ga0070664_100005323 3300005564 Bacteria 10325
98 Ga0068857_100004021 3300005577 Bacteria 12383
99 Ga0068857_100159930 3300005577 Bacteria 2043
100 Ga0068857_100957662 3300005577 Bacteria 822
101 Ga0068854_100003701 3300005578 Bacteria 9566
102 Ga0068854_100158930 3300005578 Bacteria 1748
103 Ga0068856_100813013 3300005614 Bacteria 954
104 Ga0068852_100001448 3300005616 Bacteria 16016
105 Ga0068852_100019753 3300005616 Bacteria 5341
106 Ga0068852_100020870 3300005616 Bacteria 5214
107 Ga0068852_100599723 3300005616 Bacteria 1105
108 Ga0068859_100002786 3300005617 Bacteria 17711
109 Ga0068864_100002633 3300005618 Bacteria 14809
110 Ga0068864_100318211 3300005618 Bacteria 1461
111 Ga0068866_10041025 3300005718 Bacteria 2294
112 Ga0068851_10049764 3300005834 Bacteria 2127
113 Ga0068851_10291622 3300005834 Bacteria 936
114 Ga0068863_100002317 3300005841 Bacteria 18934
115 Ga0068863_101009406 3300005841 Bacteria 835
116 Ga0068858_100000620 3300005842 Bacteria 36979
117 Ga0068860_100003524 3300005843 Bacteria 16093
118 Ga0070712_100124228 3300006175 Bacteria 1946
119 Ga0068871_100011802 3300006358 Bacteria 6421
120 Ga0068871_100197262 3300006358 Bacteria 1737
121 Ga0068865_100037042 3300006881 Bacteria 3292
122 Ga0097620_100002786 3300006931 Bacteria 17711
123 Ga0111539_10107407 3300009094 Bacteria 3275
124 Ga0105245_10000229 3300009098 Bacteria 53255
125 Ga0105243_10302557 3300009148 Bacteria 1450
126 Ga0105241_10424396 3300009174 Bacteria 1171
127 Ga0105248_10023083 3300009177 Bacteria 6909
128 Ga0105248_10238381 3300009177 Bacteria 2048
129 Ga0105237_10354475 3300009545 Bacteria 1472
130 Ga0105239_10055022 3300010375 Bacteria 4364
131 Ga0105239_11225373 3300010375 Bacteria 865
132 Ga0157373_10070596 3300013100 Bacteria 2468
133 Ga0157373_10087156 3300013100 Bacteria 2200
134 Ga0157373_10207583 3300013100 Bacteria 1381
135 Ga0157373_10593013 3300013100 Bacteria 806
136 Ga0157371_10000756 3300013102 Bacteria 37389
137 Ga0157371_10509239 3300013102 Bacteria 889
138 Ga0157370_10378117 3300013104 Bacteria 1305
139 Ga0157369_10002493 3300013105 Bacteria 22063
140 Ga0157369_10300820 3300013105 Bacteria 1669
141 Ga0157374_11116627 3300013296 Unclassified 809
142 Ga0157378_10000154 3300013297 Bacteria 64986
143 Ga0163162_10014072 3300013306 Bacteria 7819
144 Ga0157372_10047976 3300013307 Bacteria 4747
145 Ga0157372_10110284 3300013307 Bacteria 3151
146 Ga0157372_10692878 3300013307 Bacteria 1186
147 Ga0157372_10770154 3300013307 Bacteria 1119
148 Ga0213875_10005584 3300021388 Bacteria 6727
149 Ga0207697_10001966 3300025315 Bacteria 10909
150 Ga0207656_10046958 3300025321 Bacteria 1855
151 Ga0207656_10100989 3300025321 Bacteria 1323
152 Ga0207656_10158459 3300025321 Bacteria 1076
153 Ga0207642_10093279 3300025899 Bacteria 1493
154 Ga0207688_10000595 3300025901 Bacteria 17763
155 Ga0207680_10029915 3300025903 Bacteria 3065
156 Ga0207680_10166791 3300025903 Bacteria 1480
157 Ga0207647_10000090 3300025904 Bacteria 69395
158 Ga0207647_10052482 3300025904 Bacteria 2517
159 Ga0207647_10106233 3300025904 Bacteria 1662
160 Ga0207645_10018883 3300025907 Bacteria 4528
161 Ga0207705_10191101 3300025909 Bacteria 1548
162 Ga0207684_10417612 3300025910 Bacteria 1153
163 Ga0207654_10057208 3300025911 Bacteria 2265
164 Ga0207707_10251518 3300025912 Bacteria 1535
165 Ga0207671_10442212 3300025914 Bacteria 1035
166 Ga0207693_10184968 3300025915 Bacteria 1640
167 Ga0207657_10002682 3300025919 Bacteria 19192
168 Ga0207657_10012036 3300025919 Bacteria 8558
169 Ga0207657_10015470 3300025919 Bacteria 7390
170 Ga0207657_10071536 3300025919 Bacteria 2937
171 Ga0207657_10187697 3300025919 Bacteria 1669
172 Ga0207649_10079012 3300025920 Bacteria 2124
173 Ga0207649_10124244 3300025920 Bacteria 1744
174 Ga0207649_10349876 3300025920 Bacteria 1093
175 Ga0207649_10374259 3300025920 Bacteria 1060
176 Ga0207681_10009605 3300025923 Bacteria 5912
177 Ga0207687_10001063 3300025927 Bacteria 18628
178 Ga0207664_10535556 3300025929 Bacteria 1050
179 Ga0207644_10015148 3300025931 Bacteria 5173
180 Ga0207644_10114491 3300025931 Bacteria 2044
181 Ga0207644_10258552 3300025931 Bacteria 1391
182 Ga0207690_10003400 3300025932 Bacteria 9509
183 Ga0207690_10044137 3300025932 Bacteria 2937
184 Ga0207690_10084034 3300025932 Bacteria 2230
185 Ga0207690_10288469 3300025932 Bacteria 1280
186 Ga0207706_10001429 3300025933 Bacteria 23905
187 Ga0207706_10018355 3300025933 Bacteria 6295
188 Ga0207706_10047347 3300025933 Bacteria 3805
189 Ga0207706_10074537 3300025933 Bacteria 2984
190 Ga0207706_10498161 3300025933 Bacteria 1052
191 Ga0207709_10167458 3300025935 Bacteria 1539
192 Ga0207669_10007804 3300025937 Bacteria 4980
193 Ga0207704_10208516 3300025938 Bacteria 1436
194 Ga0207665_10078987 3300025939 Bacteria 2261
195 Ga0207691_10000045 3300025940 Bacteria 99798
196 Ga0207711_10001677 3300025941 Bacteria 20395
197 Ga0207711_10004361 3300025941 Bacteria 12073
198 Ga0207689_10000226 3300025942 Bacteria 50110
199 Ga0207661_10222540 3300025944 Bacteria 1669
200 Ga0207679_10008266 3300025945 Bacteria 6627
201 Ga0207679_10437542 3300025945 Bacteria 1157
202 Ga0207679_10573558 3300025945 Bacteria 1014
203 Ga0207667_10012505 3300025949 Bacteria 9771
204 Ga0207651_10003165 3300025960 Bacteria 8027
205 Ga0207668_10040217 3300025972 Bacteria 3153
206 Ga0207640_10752570 3300025981 Bacteria 840
207 Ga0207658_10008518 3300025986 Bacteria 6977
208 Ga0207658_10491467 3300025986 Bacteria 1092
209 Ga0207677_10003351 3300026023 Bacteria 8489
210 Ga0207703_10056650 3300026035 Bacteria 3193
211 Ga0207639_10078664 3300026041 Bacteria 2604
212 Ga0207639_10086332 3300026041 Bacteria 2498
213 Ga0207639_10096528 3300026041 Bacteria 2378
214 Ga0207639_10282713 3300026041 Bacteria 1460
215 Ga0207678_10032960 3300026067 Bacteria 4514
216 Ga0207678_10033417 3300026067 Bacteria 4482
217 Ga0207678_10109099 3300026067 Bacteria 2361
218 Ga0207708_10514727 3300026075 Bacteria 1005
219 Ga0207641_10024561 3300026088 Bacteria 4967
220 Ga0207648_10002102 3300026089 Bacteria 21704
221 Ga0207676_10001193 3300026095 Bacteria 19504
222 Ga0207676_10247533 3300026095 Bacteria 1603
223 Ga0207674_10000531 3300026116 Bacteria 49979
224 Ga0207674_10093902 3300026116 Bacteria 2988
225 Ga0207683_10224569 3300026121 Bacteria 1712
226 Ga0207698_10003349 3300026142 Bacteria 9648
227 Ga0207698_10005568 3300026142 Bacteria 7788
228 Ga0207698_11415934 3300026142 Bacteria 710
229 Ga0207428_10411840 3300027907 Bacteria 989
230 Ga0268266_10001810 3300028379 Bacteria 24195
231 Ga0268266_10040162 3300028379 Bacteria 3987
232 Ga0268266_10078634 3300028379 Bacteria 2870
233 Ga0268266_10944097 3300028379 Bacteria 834
234 Ga0268264_10111721 3300028381 Bacteria 2394
235 Ga0268264_10980559 3300028381 Bacteria 851
236 Ga0307413_10397978 3300031824 Bacteria 1078
237 Ga0307410_10484258 3300031852 Bacteria 1015
238 Ga0307410_10751473 3300031852 Bacteria 826
239 Ga0307409_100038381 3300031995 Bacteria 3542
240 Ga0307411_10950434 3300032005 Unclassified 766
241 Ga0373953_0106840 3300035117 Unclassified 1181
242 Ga0373954_0004290 3300035118 Bacteria 6130
243 Ga0373956_0032545 3300035119 Bacteria 2288
244 Ga0373943_0002765 3300035170 Bacteria 7988
245 Ga0373955_0002116 3300035172 Bacteria 8574
246 Ga0373927_0210209 3300035695 Bacteria 1278
247 Ga0373937_0009792 3300036401 Bacteria 8356
248 Ga0373937_0875430 3300036401 Bacteria 847
249 Ga0395899_0007795 3300037312 Bacteria 8256
250 Ga0395899_0071150 3300037312 Bacteria 2545
251 Ga0395899_0087579 3300037312 Bacteria 2260
252 Ga0395899_0117608 3300037312 Bacteria 1906
253 Ga0395899_0294182 3300037312 Bacteria 1101
254 Ga0395899_0470599 3300037312 Bacteria 820
255 Ga0395900_0066988 3300037418 Bacteria 3690
256 Ga0395900_0137622 3300037418 Bacteria 2502
257 Ga0395900_0186155 3300037418 Bacteria 2107
258 Ga0395900_0245031 3300037418 Bacteria 1796
259 Ga0395900_0393438 3300037418 Bacteria 1351
260 Ga0395900_0422665 3300037418 Bacteria 1293
261 Ga0395900_0603032 3300037418 Bacteria 1038
262 Ga0395900_1034674 3300037418 Bacteria 740
263 Ga0395898_0237438 3300037466 Bacteria 1738
264 Ga0395898_0324891 3300037466 Bacteria 1467
265 Ga0395905_0009080 3300037471 Bacteria 9749
266 Ga0395905_0052292 3300037471 Bacteria 3824
267 Ga0395905_0095394 3300037471 Bacteria 2791
268 Ga0395905_0189047 3300037471 Bacteria 1932
269 Ga0395905_0264473 3300037471 Bacteria 1605
270 Ga0395905_0285228 3300037471 Bacteria 1538
271 Ga0395905_0357360 3300037471 Bacteria 1353
272 Ga0395905_0494834 3300037471 Bacteria 1122
273 Ga0395905_0607960 3300037471 Bacteria 995
274 Ga0395905_0850528 3300037471 Bacteria 815
275 Ga0395905_0863715 3300037471 Bacteria 808
276 Ga0436364_1155132 3300037853 Bacteria 16641
277 Ga0395901_0074320 3300038443 Bacteria 3545
278 Ga0395901_0085634 3300038443 Bacteria 3294
279 Ga0395901_0098750 3300038443 Bacteria 3061
280 Ga0395901_0099207 3300038443 Bacteria 3054
281 Ga0395901_0186002 3300038443 Bacteria 2179
282 Ga0395901_0197883 3300038443 Bacteria 2107
283 Ga0395901_0377190 3300038443 Bacteria 1460
284 Ga0395901_1004296 3300038443 Bacteria 810
285 Ga0450917_003055 3300042120 Bacteria 1206
286 Ga0450905_001715 3300042142 Bacteria 2800
287 Ga0450889_000026 3300042144 Bacteria 12524
288 Ga0439458_0004448 3300042157 Bacteria 3216
289 Ga0466972_0049754 3300044658 Bacteria 2024
290 Ga0466972_0084580 3300044658 Bacteria 1508
291 Ga0466966_0075981 3300044684 Bacteria 2098
292 Ga0466966_0197181 3300044684 Bacteria 1219
293 Ga0466966_0393133 3300044684 Bacteria 833
294 Ga0466961_0023604 3300044693 Bacteria 3957
295 Ga0466961_0169095 3300044693 Bacteria 1360
296 Ga0466963_0057964 3300044694 Bacteria 2581
297 Ga0466971_0173454 3300044719 Bacteria 1012
298 Ga0466970_0243891 3300044765 Bacteria 1006
299 Ga0466957_0111735 3300044842 Bacteria 1733
300 Ga0466960_0091767 3300044901 Bacteria 1549
301 Ga0466959_0132019 3300045049 Bacteria 1770
302 Ga0466967_0012904 3300045976 Bacteria 6424
303 Ga0466967_0085421 3300045976 Bacteria 2857
304 Ga0466967_0112675 3300045976 Bacteria 2501
305 Ga0466967_0583030 3300045976 Bacteria 1103
306 Ga0495643_0150217 3300046522 Bacteria 1154
307 Ga0495669_0169034 3300046684 Bacteria 1039
308 Ga0495602_0009401 3300048088 Bacteria 10171
309 Ga0496100_0260230 3300048903 Bacteria 1286
310 Ga0496101_0121796 3300048904 Bacteria 1973
311 Ga0496101_0132681 3300048904 Bacteria 1892
312 Ga0496102_0923690 3300048905 Bacteria 794
313 Ga0496104_0856910 3300048907 Bacteria 814
314 Ga0496107_0008008 3300048910 Bacteria 7293
315 Ga0496111_0124892 3300048914 Bacteria 1902
316 Ga0496112_1580618 3300048915 Bacteria 569
317 Ga0496114_0000016 3300048917 Bacteria 274656
318 Ga0496114_0152726 3300048917 Bacteria 2003
319 Ga0501070_0198513 3300049586 Bacteria 1648
320 nmdc:mga08y16_11359_c1 3300050511 Bacteria 9357
321 Ga0466959_0370207
322 JGI24741J21665_1016784
323 JGI24740J21852_10000089
324 JGI24740J21852_10088291
325 JGI24739J22299_10000097
326 JGI24737J22298_10000037
327 JGI24737J22298_10003214
328 JGI24735J21928_10009235
329 JGI24745J21846_1003903
330 JGI24738J21930_10000023
331 JGI24034J26672_10018938
332 rootH1_10067058
333 Ga0070658_10016317
334 Ga0070658_10058469
335 Ga0070658_10073207
336 Ga0070658_10743382
337 Ga0070658_10994682
338 Ga0070676_10071807
339 Ga0070683_100178198
340 Ga0070683_100247961
341 Ga0070690_100027804
342 Ga0070670_100028176
343 Ga0070670_100067896
344 Ga0070670_100081523
345 Ga0068869_100002765
346 Ga0070666_10044110
347 Ga0070666_10140435
348 Ga0068868_100007692
349 Ga0068868_100842714
350 Ga0070660_100002456
351 Ga0070660_100018599
352 Ga0070660_100178980
353 Ga0070660_100266809
354 Ga0070660_100492330
355 Ga0070661_100073829
356 Ga0070661_100143697
357 Ga0070668_100004892
358 Ga0070668_100198471
359 Ga0070668_100562251
360 Ga0070669_100000174
361 Ga0070671_100014533
362 Ga0070671_100015323
363 Ga0070671_100070346
364 Ga0070671_100611998
365 Ga0070674_100060156
366 Ga0070674_100236121
367 Ga0070673_100000337
368 Ga0070673_100005138
369 Ga0070673_101006577
370 Ga0070659_100000674
371 Ga0070659_100015956
372 Ga0070659_100025963
373 Ga0070659_100143729
374 Ga0070659_100174680
375 Ga0070659_100206390
376 Ga0070659_100271435
377 Ga0070667_100003559
378 Ga0070667_100094286
379 Ga0070667_100180837
380 Ga0070709_10368054
381 Ga0070714_100366674
382 Ga0070713_100420155
383 Ga0070700_100510985
384 Ga0070663_100266451
385 Ga0070663_100496674
386 Ga0070678_100168970
387 Ga0070662_100001658
388 Ga0070662_100023203
389 Ga0070662_100067075
390 Ga0070662_100089286
391 Ga0070662_100338984
392 Ga0070681_10082427
393 Ga0070681_10122313
394 Ga0070681_10166046
395 Ga0068867_100004031
396 Ga0070706_100494581
397 Ga0070679_100327177
398 Ga0070679_100654781
399 Ga0070679_100698991
400 Ga0070684_100658591
401 Ga0068853_100000811
402 Ga0068853_100148447
403 Ga0068853_100152004
404 Ga0068853_100511950
405 Ga0070672_100000945
406 Ga0070686_100424743
407 Ga0070695_100125332
408 Ga0070696_100033648
409 Ga0070693_100069722
410 Ga0070665_100003604
411 Ga0070665_100030361
412 Ga0070665_100117227
413 Ga0070665_100916275
414 Ga0070704_100236785
415 Ga0068855_100003900
416 Ga0068855_100509082
417 Ga0070664_100005323
418 Ga0068857_100004021
419 Ga0068857_100159930
420 Ga0068857_100957662
421 Ga0068854_100003701
422 Ga0068854_100158930
423 Ga0068856_100813013
424 Ga0068852_100001448
425 Ga0068852_100019753
426 Ga0068852_100020870
427 Ga0068852_100599723
428 Ga0068859_100002786
429 Ga0068864_100002633
430 Ga0068864_100318211
431 Ga0068866_10041025
432 Ga0068851_10049764
433 Ga0068851_10291622
434 Ga0068863_100002317
435 Ga0068863_101009406
436 Ga0068858_100000620
437 Ga0068860_100003524
438 Ga0070712_100124228
439 Ga0068871_100011802
440 Ga0068871_100197262
441 Ga0068865_100037042
442 Ga0097620_100002786
443 Ga0111539_10107407
444 Ga0105245_10000229
445 Ga0105243_10302557
446 Ga0105241_10424396
447 Ga0105248_10023083
448 Ga0105248_10238381
449 Ga0105237_10354475
450 Ga0105239_10055022
451 Ga0105239_11225373
452 Ga0157373_10070596
453 Ga0157373_10087156
454 Ga0157373_10207583
455 Ga0157373_10593013
456 Ga0157371_10000756
457 Ga0157371_10509239
458 Ga0157370_10378117
459 Ga0157369_10002493
460 Ga0157369_10300820
461 Ga0157374_11116627
462 Ga0157378_10000154
463 Ga0163162_10014072
464 Ga0157372_10047976
465 Ga0157372_10110284
466 Ga0157372_10692878
467 Ga0157372_10770154
468 Ga0213875_10005584
469 Ga0207697_10001966
470 Ga0207656_10046958
471 Ga0207656_10100989
472 Ga0207656_10158459
473 Ga0207642_10093279
474 Ga0207688_10000595
475 Ga0207680_10029915
476 Ga0207680_10166791
477 Ga0207647_10000090
478 Ga0207647_10052482
479 Ga0207647_10106233
480 Ga0207645_10018883
481 Ga0207705_10191101
482 Ga0207684_10417612
483 Ga0207654_10057208
484 Ga0207707_10251518
485 Ga0207671_10442212
486 Ga0207693_10184968
487 Ga0207657_10002682
488 Ga0207657_10012036
489 Ga0207657_10015470
490 Ga0207657_10071536
491 Ga0207657_10187697
492 Ga0207649_10079012
493 Ga0207649_10124244
494 Ga0207649_10349876
495 Ga0207649_10374259
496 Ga0207681_10009605
497 Ga0207687_10001063
498 Ga0207664_10535556
499 Ga0207644_10015148
500 Ga0207644_10114491
501 Ga0207644_10258552
502 Ga0207690_10003400
503 Ga0207690_10044137
504 Ga0207690_10084034
505 Ga0207690_10288469
506 Ga0207706_10001429
507 Ga0207706_10018355
508 Ga0207706_10047347
509 Ga0207706_10074537
510 Ga0207706_10498161
511 Ga0207709_10167458
512 Ga0207669_10007804
513 Ga0207704_10208516
514 Ga0207665_10078987
515 Ga0207691_10000045
516 Ga0207711_10001677
517 Ga0207711_10004361
518 Ga0207689_10000226
519 Ga0207661_10222540
520 Ga0207679_10008266
521 Ga0207679_10437542
522 Ga0207679_10573558
523 Ga0207667_10012505
524 Ga0207651_10003165
525 Ga0207668_10040217
526 Ga0207640_10752570
527 Ga0207658_10008518
528 Ga0207658_10491467
529 Ga0207677_10003351
530 Ga0207703_10056650
531 Ga0207639_10078664
532 Ga0207639_10086332
533 Ga0207639_10096528
534 Ga0207639_10282713
535 Ga0207678_10032960
536 Ga0207678_10033417
537 Ga0207678_10109099
538 Ga0207708_10514727
539 Ga0207641_10024561
540 Ga0207648_10002102
541 Ga0207676_10001193
542 Ga0207676_10247533
543 Ga0207674_10000531
544 Ga0207674_10093902
545 Ga0207683_10224569
546 Ga0207698_10003349
547 Ga0207698_10005568
548 Ga0207698_11415934
549 Ga0207428_10411840
550 Ga0268266_10001810
551 Ga0268266_10040162
552 Ga0268266_10078634
553 Ga0268266_10944097
554 Ga0268264_10111721
555 Ga0268264_10980559
556 Ga0307413_10397978
557 Ga0307410_10484258
558 Ga0307410_10751473
559 Ga0307409_100038381
560 Ga0307411_10950434
561 Ga0373953_0106840
562 Ga0373954_0004290
563 Ga0373956_0032545
564 Ga0373943_0002765
565 Ga0373955_0002116
566 Ga0373927_0210209
567 Ga0373937_0009792
568 Ga0373937_0875430
569 Ga0395899_0007795
570 Ga0395899_0071150
571 Ga0395899_0087579
572 Ga0395899_0117608
573 Ga0395899_0294182
574 Ga0395899_0470599
575 Ga0395900_0066988
576 Ga0395900_0137622
577 Ga0395900_0186155
578 Ga0395900_0245031
579 Ga0395900_0393438
580 Ga0395900_0422665
581 Ga0395900_0603032
582 Ga0395900_1034674
583 Ga0395898_0237438
584 Ga0395898_0324891
585 Ga0395905_0009080
586 Ga0395905_0052292
587 Ga0395905_0095394
588 Ga0395905_0189047
589 Ga0395905_0264473
590 Ga0395905_0285228
591 Ga0395905_0357360
592 Ga0395905_0494834
593 Ga0395905_0607960
594 Ga0395905_0850528
595 Ga0395905_0863715
596 Ga0436364_1155132
597 Ga0395901_0074320
598 Ga0395901_0085634
599 Ga0395901_0098750
600 Ga0395901_0099207
601 Ga0395901_0186002
602 Ga0395901_0197883
603 Ga0395901_0377190
604 Ga0395901_1004296
605 Ga0450917_003055
606 Ga0450905_001715
607 Ga0450889_000026
608 Ga0439458_0004448
609 Ga0466972_0049754
610 Ga0466972_0084580
611 Ga0466966_0075981
612 Ga0466966_0197181
613 Ga0466966_0393133
614 Ga0466961_0023604
615 Ga0466961_0169095
616 Ga0466963_0057964
617 Ga0466971_0173454
618 Ga0466970_0243891
619 Ga0466957_0111735
620 Ga0466960_0091767
621 Ga0466959_0132019
622 Ga0466967_0012904
623 Ga0466967_0085421
624 Ga0466967_0112675
625 Ga0466967_0583030
626 Ga0495643_0150217
627 Ga0495669_0169034
628 Ga0495602_0009401
629 Ga0496100_0260230
630 Ga0496101_0121796
631 Ga0496101_0132681
632 Ga0496102_0923690
633 Ga0496104_0856910
634 Ga0496107_0008008
635 Ga0496111_0124892
636 Ga0496112_1580618
637 Ga0496114_0000016
638 Ga0496114_0152726
639 Ga0501070_0198513
640 nmdc:mga08y16_11359_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13905

Thioredoxin_8

Thioredoxin-like

100

193

0.94

PF00578

AhpC-TSA

AhpC/TSA family

77

192

0.91

PF08534

Redoxin

Redoxin

75

212

0.87

PF00085

Thioredoxin

Thioredoxin

84

175

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jfu-assembly1.cif.gz_A crystal structure of the soluble domain of tlpa from bradyrhizobium japonicum 0.9069 38 183
7sce-assembly1.cif.gz_A ternary complex of fixed-arm trx-3ost5 (i299e) with 8mer-2 octasaccharide substrate and co-factor product pap 0.9057 66 167
5ikn-assembly1.cif.gz_L crystal structure of the t7 replisome in the absence of dna 0.905 66 178
4txo-assembly2.cif.gz_A crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) 0.9006 38 183
6h1y-assembly2.cif.gz_B crystal structure of a chimeric variant of thioredoxin from escherichia coli 0.8984 69 178
ID Description Score Start End Superfamily
3ul3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9194 69 178 3.40.30.10
4txvC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.902 38 181 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8886 44 178 3.40.30.10
af_Q8VWG7_248_379_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8846 68 180 3.40.30.10
3ul3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.88 69 178 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2Z4UM89-F1-model_v4 Thiol:disulfide interchange protein TlpA 0.9477 38 181 GO:0015036
GO:0016020
GO:0017004
GO:0030313
AF-A0A3C0PKB9-F1-model_v4 Thioredoxin 0.9445 52 178 GO:0015036
GO:0017004
GO:0030313
AF-A0A2S6QFZ4-F1-model_v4 Thiol:disulfide interchange protein TlpA 0.9424 38 178 GO:0015036
GO:0017004
GO:0030313
AF-A0A2D8XJM0-F1-model_v4 Redoxin 0.9417 38 181 GO:0015036
GO:0017004
GO:0030313
AF-A0A161QY32-F1-model_v4 Thioredoxin domain-containing protein 0.9405 39 181 GO:0016209
GO:0016491

Map