F405676
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 320 | 213 | 320 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0031601|Ga0495628_0031601_3475_3870 |
| Length | 122 |
| Sequence | MSTYAVKRIDEMEAVFGGAFKRARAELGVESFGMQIIDMPPNYDNYPVHDHEQDGQEEVYVTLGGERFPLDADHVVRVGPGVTRKVWPGDAGIRILVLGGKAGEAYDAPDITKLGEPDPMAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 90 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 91 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 92 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 93 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 94 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 95 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 97 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 98 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 99 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 102 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 103 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 109 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 111 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 112 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 113 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 114 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 115 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 156 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 157 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 158 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 159 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 160 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 161 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 164 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 165 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 166 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 167 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 168 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 169 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 172 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 175 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 176 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 211 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 212 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 213 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.25 |
| Nodule | 0 |
| Rhizoplane | 10 |
| Rhizosphere | 82.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1033456 | 3300000546 | Bacteria | 554 |
| 2 | rootH2_10016517 | 3300003320 | Bacteria | 2239 |
| 3 | Ga0070683_100162066 | 3300005329 | Bacteria | 2122 |
| 4 | Ga0070680_100523822 | 3300005336 | Bacteria | 1015 |
| 5 | Ga0070682_100000032 | 3300005337 | Bacteria | 155141 |
| 6 | Ga0068868_100000568 | 3300005338 | Bacteria | 24761 |
| 7 | Ga0070691_10000100 | 3300005341 | Bacteria | 25275 |
| 8 | Ga0070661_100000255 | 3300005344 | Bacteria | 43552 |
| 9 | Ga0070671_100751935 | 3300005355 | Bacteria | 847 |
| 10 | Ga0070674_100000001 | 3300005356 | Bacteria | 277173 |
| 11 | Ga0070688_100000747 | 3300005365 | Bacteria | 16013 |
| 12 | Ga0070688_101085685 | 3300005365 | Unclassified | 639 |
| 13 | Ga0070659_100063676 | 3300005366 | Bacteria | 2918 |
| 14 | Ga0070667_100074070 | 3300005367 | Bacteria | 2904 |
| 15 | Ga0070710_10388890 | 3300005437 | Bacteria | 932 |
| 16 | Ga0070711_100023085 | 3300005439 | Bacteria | 4041 |
| 17 | Ga0070711_100454902 | 3300005439 | Bacteria | 1049 |
| 18 | Ga0070705_100130845 | 3300005440 | Bacteria | 1637 |
| 19 | Ga0070694_100485795 | 3300005444 | Bacteria | 981 |
| 20 | Ga0070663_100001196 | 3300005455 | Bacteria | 14269 |
| 21 | Ga0070663_101667486 | 3300005455 | Bacteria | 569 |
| 22 | Ga0070681_10327644 | 3300005458 | Bacteria | 1441 |
| 23 | Ga0068867_100803657 | 3300005459 | Unclassified | 839 |
| 24 | Ga0070685_10001568 | 3300005466 | Bacteria | 12047 |
| 25 | Ga0070679_100001834 | 3300005530 | Bacteria | 19119 |
| 26 | Ga0068853_101809412 | 3300005539 | Bacteria | 592 |
| 27 | Ga0070686_100576001 | 3300005544 | Bacteria | 884 |
| 28 | Ga0070695_100146776 | 3300005545 | Bacteria | 1642 |
| 29 | Ga0070696_100110983 | 3300005546 | Bacteria | 1975 |
| 30 | Ga0070665_100190441 | 3300005548 | Bacteria | 2052 |
| 31 | Ga0070704_100182557 | 3300005549 | Unclassified | 1679 |
| 32 | Ga0068854_100000267 | 3300005578 | Bacteria | 35526 |
| 33 | Ga0068856_100001040 | 3300005614 | Bacteria | 29492 |
| 34 | Ga0068856_100042225 | 3300005614 | Bacteria | 4485 |
| 35 | Ga0070702_100143410 | 3300005615 | Bacteria | 1524 |
| 36 | Ga0068866_10000140 | 3300005718 | Bacteria | 32464 |
| 37 | Ga0068866_10310984 | 3300005718 | Bacteria | 987 |
| 38 | Ga0068851_10000258 | 3300005834 | Bacteria | 25137 |
| 39 | Ga0068863_100000050 | 3300005841 | Bacteria | 130200 |
| 40 | Ga0068860_101421078 | 3300005843 | Bacteria | 715 |
| 41 | Ga0081455_10024963 | 3300005937 | Bacteria | 5523 |
| 42 | Ga0070715_10027378 | 3300006163 | Bacteria | 2277 |
| 43 | Ga0070716_100056239 | 3300006173 | Bacteria | 2255 |
| 44 | Ga0105240_10483408 | 3300009093 | Bacteria | 1380 |
| 45 | Ga0105245_10004472 | 3300009098 | Bacteria | 12358 |
| 46 | Ga0105245_10102937 | 3300009098 | Bacteria | 2645 |
| 47 | Ga0105243_10465026 | 3300009148 | Bacteria | 1190 |
| 48 | Ga0105241_10319644 | 3300009174 | Bacteria | 1338 |
| 49 | Ga0105242_10001159 | 3300009176 | Bacteria | 20774 |
| 50 | Ga0105242_10022159 | 3300009176 | Bacteria | 4992 |
| 51 | Ga0105242_10202272 | 3300009176 | Bacteria | 1765 |
| 52 | Ga0105238_10000016 | 3300009551 | Bacteria | 236218 |
| 53 | Ga0105239_10239865 | 3300010375 | Bacteria | 2035 |
| 54 | Ga0105239_12552404 | 3300010375 | Unclassified | 596 |
| 55 | Ga0105246_12195940 | 3300011119 | Bacteria | 537 |
| 56 | Ga0157370_10002517 | 3300013104 | Bacteria | 22034 |
| 57 | Ga0157370_10974034 | 3300013104 | Archaea | 768 |
| 58 | Ga0157374_10426968 | 3300013296 | Unclassified | 1325 |
| 59 | Ga0163162_10776722 | 3300013306 | Bacteria | 1076 |
| 60 | Ga0157375_10001744 | 3300013308 | Bacteria | 18673 |
| 61 | Ga0157375_10002471 | 3300013308 | Bacteria | 15996 |
| 62 | Ga0157375_10162600 | 3300013308 | Bacteria | 2375 |
| 63 | Ga0157375_10981276 | 3300013308 | Bacteria | 985 |
| 64 | Ga0157375_11016756 | 3300013308 | Bacteria | 968 |
| 65 | Ga0163163_10379483 | 3300014325 | Bacteria | 1471 |
| 66 | Ga0163163_10806215 | 3300014325 | Unclassified | 1002 |
| 67 | Ga0157380_12910350 | 3300014326 | Bacteria | 545 |
| 68 | Ga0157379_10605495 | 3300014968 | Bacteria | 1023 |
| 69 | Ga0157376_10364185 | 3300014969 | Bacteria | 1387 |
| 70 | Ga0163161_10000103 | 3300017792 | Bacteria | 81496 |
| 71 | Ga0206356_10052778 | 3300020070 | Unclassified | 707 |
| 72 | Ga0207656_10001236 | 3300025321 | Bacteria | 8446 |
| 73 | Ga0207692_10293842 | 3300025898 | Bacteria | 987 |
| 74 | Ga0207642_10000066 | 3300025899 | Bacteria | 28858 |
| 75 | Ga0207642_10008240 | 3300025899 | Bacteria | 3564 |
| 76 | Ga0207642_10176559 | 3300025899 | Bacteria | 1160 |
| 77 | Ga0207680_10022098 | 3300025903 | Bacteria | 3455 |
| 78 | Ga0207685_10044252 | 3300025905 | Bacteria | 1682 |
| 79 | Ga0207654_10193600 | 3300025911 | Bacteria | 1334 |
| 80 | Ga0207695_10155010 | 3300025913 | Unclassified | 2226 |
| 81 | Ga0207663_10002757 | 3300025916 | Bacteria | 8472 |
| 82 | Ga0207663_10057704 | 3300025916 | Bacteria | 2447 |
| 83 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 84 | Ga0207652_10000513 | 3300025921 | Bacteria | 39231 |
| 85 | Ga0207652_11114722 | 3300025921 | Bacteria | 690 |
| 86 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 87 | Ga0207694_10811120 | 3300025924 | Unclassified | 791 |
| 88 | Ga0207650_11237305 | 3300025925 | Bacteria | 636 |
| 89 | Ga0207687_10001665 | 3300025927 | Bacteria | 15338 |
| 90 | Ga0207687_10406632 | 3300025927 | Bacteria | 1121 |
| 91 | Ga0207690_10045821 | 3300025932 | Bacteria | 2892 |
| 92 | Ga0207706_10270736 | 3300025933 | Bacteria | 1482 |
| 93 | Ga0207686_10000035 | 3300025934 | Bacteria | 130483 |
| 94 | Ga0207686_10013833 | 3300025934 | Bacteria | 4476 |
| 95 | Ga0207686_10089563 | 3300025934 | Bacteria | 2028 |
| 96 | Ga0207709_10032288 | 3300025935 | Bacteria | 3064 |
| 97 | Ga0207709_10571611 | 3300025935 | Bacteria | 892 |
| 98 | Ga0207709_10651175 | 3300025935 | Bacteria | 839 |
| 99 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 100 | Ga0207665_10087244 | 3300025939 | Bacteria | 2157 |
| 101 | Ga0207665_10164847 | 3300025939 | Bacteria | 1597 |
| 102 | Ga0207661_10115082 | 3300025944 | Bacteria | 2281 |
| 103 | Ga0207651_10282881 | 3300025960 | Bacteria | 1372 |
| 104 | Ga0207712_10630159 | 3300025961 | Bacteria | 930 |
| 105 | Ga0207640_10000669 | 3300025981 | Bacteria | 19997 |
| 106 | Ga0207658_10010576 | 3300025986 | Bacteria | 6270 |
| 107 | Ga0207677_10001061 | 3300026023 | Bacteria | 15064 |
| 108 | Ga0207677_12030578 | 3300026023 | Bacteria | 535 |
| 109 | Ga0207639_10402197 | 3300026041 | Bacteria | 1234 |
| 110 | Ga0207678_10002590 | 3300026067 | Bacteria | 16479 |
| 111 | Ga0207678_11004222 | 3300026067 | Bacteria | 738 |
| 112 | Ga0207702_10000349 | 3300026078 | Bacteria | 52941 |
| 113 | Ga0207641_10000295 | 3300026088 | Bacteria | 62363 |
| 114 | Ga0207641_10002521 | 3300026088 | Bacteria | 16875 |
| 115 | Ga0207648_10837551 | 3300026089 | Unclassified | 857 |
| 116 | Ga0268266_10000369 | 3300028379 | Bacteria | 69354 |
| 117 | Ga0268266_10240101 | 3300028379 | Bacteria | 1672 |
| 118 | Ga0268264_10675838 | 3300028381 | Unclassified | 1024 |
| 119 | Ga0265337_1002592 | 3300028556 | Bacteria | 8185 |
| 120 | Ga0265326_10000056 | 3300028558 | Bacteria | 64840 |
| 121 | Ga0265326_10021122 | 3300028558 | Bacteria | 1867 |
| 122 | Ga0265319_1000037 | 3300028563 | Bacteria | 115642 |
| 123 | Ga0265322_10000017 | 3300028654 | Bacteria | 114833 |
| 124 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 125 | Ga0265324_10001639 | 3300029957 | Bacteria | 12385 |
| 126 | Ga0265332_10025178 | 3300031238 | Bacteria | 2615 |
| 127 | Ga0265328_10000258 | 3300031239 | Bacteria | 24453 |
| 128 | Ga0265320_10000068 | 3300031240 | Bacteria | 91884 |
| 129 | Ga0265325_10009857 | 3300031241 | Bacteria | 5562 |
| 130 | Ga0265329_10007182 | 3300031242 | Bacteria | 4333 |
| 131 | Ga0265339_10054877 | 3300031249 | Bacteria | 2163 |
| 132 | Ga0265331_10005995 | 3300031250 | Bacteria | 7252 |
| 133 | Ga0265327_10000317 | 3300031251 | Bacteria | 92215 |
| 134 | Ga0265316_10247311 | 3300031344 | Bacteria | 1310 |
| 135 | Ga0265313_10397392 | 3300031595 | Bacteria | 541 |
| 136 | Ga0265314_10000973 | 3300031711 | Bacteria | 33669 |
| 137 | Ga0265342_10132537 | 3300031712 | Bacteria | 1395 |
| 138 | Ga0373935_1261429 | 3300035692 | Bacteria | 551 |
| 139 | Ga0373947_0314641 | 3300035725 | Bacteria | 1046 |
| 140 | Ga0373937_1159080 | 3300036401 | Bacteria | 721 |
| 141 | Ga0451800_1239691 | 3300041459 | Bacteria | 1056 |
| 142 | Ga0451807_1102958 | 3300041486 | Bacteria | 1165 |
| 143 | Ga0451837_0068871 | 3300041494 | Unclassified | 840 |
| 144 | Ga0451839_0214419 | 3300041496 | Bacteria | 544 |
| 145 | Ga0451853_3625586 | 3300041512 | Bacteria | 1494 |
| 146 | Ga0495592_0133213 | 3300046454 | Bacteria | 1736 |
| 147 | Ga0495592_0149611 | 3300046454 | Unclassified | 1616 |
| 148 | Ga0495592_0321645 | 3300046454 | Bacteria | 1000 |
| 149 | Ga0495603_0000085 | 3300046455 | Bacteria | 41686 |
| 150 | Ga0495603_0002488 | 3300046455 | Bacteria | 10843 |
| 151 | Ga0495629_0021272 | 3300046459 | Bacteria | 4629 |
| 152 | Ga0495638_0032677 | 3300046460 | Bacteria | 3333 |
| 153 | Ga0495641_0175638 | 3300046461 | Unclassified | 958 |
| 154 | Ga0495651_0072853 | 3300046462 | Bacteria | 2608 |
| 155 | Ga0495653_0015845 | 3300046463 | Bacteria | 6144 |
| 156 | Ga0495653_0202919 | 3300046463 | Bacteria | 1344 |
| 157 | Ga0495662_0000162 | 3300046476 | Bacteria | 26288 |
| 158 | Ga0495608_0000042 | 3300046511 | Bacteria | 115906 |
| 159 | Ga0495608_0002177 | 3300046511 | Bacteria | 14130 |
| 160 | Ga0495628_0000548 | 3300046516 | Bacteria | 34470 |
| 161 | Ga0495628_0031601 | 3300046516 | Bacteria | 4282 |
| 162 | Ga0495628_0085301 | 3300046516 | Bacteria | 2450 |
| 163 | Ga0495644_0010007 | 3300046523 | Bacteria | 3654 |
| 164 | Ga0495652_0007230 | 3300046529 | Bacteria | 10249 |
| 165 | Ga0495640_0004849 | 3300046533 | Bacteria | 10709 |
| 166 | Ga0495640_0008071 | 3300046533 | Bacteria | 8268 |
| 167 | Ga0495640_0854791 | 3300046533 | Bacteria | 540 |
| 168 | Ga0495586_0001779 | 3300046535 | Bacteria | 11781 |
| 169 | Ga0495587_0723163 | 3300046536 | Bacteria | 545 |
| 170 | Ga0495645_0005133 | 3300046543 | Bacteria | 8968 |
| 171 | Ga0495645_0029697 | 3300046543 | Bacteria | 3977 |
| 172 | Ga0495645_0277455 | 3300046543 | Bacteria | 1104 |
| 173 | Ga0495633_0008184 | 3300046558 | Bacteria | 5921 |
| 174 | Ga0495667_0000019 | 3300046559 | Bacteria | 181645 |
| 175 | Ga0495667_0029763 | 3300046559 | Bacteria | 3674 |
| 176 | Ga0495634_0000050 | 3300046642 | Bacteria | 94546 |
| 177 | Ga0495635_0000017 | 3300046663 | Bacteria | 195506 |
| 178 | Ga0495635_0323092 | 3300046663 | Unclassified | 1032 |
| 179 | Ga0495657_0000040 | 3300046675 | Bacteria | 115899 |
| 180 | Ga0495657_0013724 | 3300046675 | Bacteria | 5966 |
| 181 | Ga0495623_0169208 | 3300046679 | Bacteria | 1278 |
| 182 | Ga0495646_0368912 | 3300046680 | Bacteria | 750 |
| 183 | Ga0495647_0128336 | 3300046681 | Bacteria | 1072 |
| 184 | Ga0495669_0123271 | 3300046684 | Bacteria | 1216 |
| 185 | Ga0495669_0357185 | 3300046684 | Unclassified | 706 |
| 186 | Ga0495613_0000067 | 3300046689 | Bacteria | 101960 |
| 187 | Ga0495613_0282568 | 3300046689 | Bacteria | 1152 |
| 188 | Ga0495613_0331419 | 3300046689 | Bacteria | 1049 |
| 189 | Ga0495670_0034498 | 3300046691 | Unclassified | 2520 |
| 190 | Ga0495671_0371028 | 3300046692 | Bacteria | 686 |
| 191 | Ga0495600_0000376 | 3300046809 | Bacteria | 23258 |
| 192 | Ga0495581_0126894 | 3300047315 | Unclassified | 1486 |
| 193 | Ga0495674_0000024 | 3300047319 | Bacteria | 141746 |
| 194 | Ga0495672_0267025 | 3300047320 | Unclassified | 823 |
| 195 | Ga0495676_0000928 | 3300047321 | Bacteria | 24577 |
| 196 | Ga0495676_0004042 | 3300047321 | Bacteria | 13356 |
| 197 | Ga0495676_0756675 | 3300047321 | Unclassified | 627 |
| 198 | Ga0495680_0001106 | 3300047322 | Bacteria | 29781 |
| 199 | Ga0495680_0213008 | 3300047322 | Bacteria | 1382 |
| 200 | Ga0495675_0000036 | 3300047444 | Bacteria | 91842 |
| 201 | Ga0495675_0050692 | 3300047444 | Bacteria | 2638 |
| 202 | Ga0495684_0037579 | 3300047471 | Bacteria | 3714 |
| 203 | Ga0495686_0037368 | 3300047472 | Bacteria | 3111 |
| 204 | Ga0495602_0018543 | 3300048088 | Bacteria | 6945 |
| 205 | Ga0495602_0044758 | 3300048088 | Bacteria | 4011 |
| 206 | Ga0496100_0000019 | 3300048903 | Bacteria | 149995 |
| 207 | Ga0496100_0347873 | 3300048903 | Bacteria | 1119 |
| 208 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 209 | Ga0496102_0000021 | 3300048905 | Bacteria | 246920 |
| 210 | Ga0496102_0025778 | 3300048905 | Bacteria | 5236 |
| 211 | Ga0496102_0272015 | 3300048905 | Bacteria | 1597 |
| 212 | Ga0496102_0340675 | 3300048905 | Unclassified | 1412 |
| 213 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 214 | Ga0496103_0047447 | 3300048906 | Bacteria | 2654 |
| 215 | Ga0496104_0037124 | 3300048907 | Bacteria | 4556 |
| 216 | Ga0496104_0918592 | 3300048907 | Bacteria | 780 |
| 217 | Ga0496105_0015739 | 3300048908 | Bacteria | 6035 |
| 218 | Ga0496106_0000033 | 3300048909 | Bacteria | 131412 |
| 219 | Ga0496106_0000107 | 3300048909 | Bacteria | 64689 |
| 220 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 221 | Ga0496107_0025196 | 3300048910 | Bacteria | 4209 |
| 222 | Ga0496107_0202823 | 3300048910 | Bacteria | 1474 |
| 223 | Ga0496108_0000133 | 3300048911 | Bacteria | 72253 |
| 224 | Ga0496109_0000021 | 3300048912 | Bacteria | 189945 |
| 225 | Ga0496111_0686194 | 3300048914 | Bacteria | 746 |
| 226 | Ga0496112_0000641 | 3300048915 | Bacteria | 24272 |
| 227 | Ga0496113_0000002 | 3300048916 | Bacteria | 220193 |
| 228 | Ga0496113_0550783 | 3300048916 | Bacteria | 925 |
| 229 | Ga0496113_1136917 | 3300048916 | Bacteria | 611 |
| 230 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 231 | Ga0496114_0680558 | 3300048917 | Bacteria | 903 |
| 232 | Ga0496115_0000022 | 3300048918 | Bacteria | 164224 |
| 233 | Ga0496115_0000027 | 3300048918 | Bacteria | 145505 |
| 234 | Ga0496115_0028973 | 3300048918 | Bacteria | 4345 |
| 235 | Ga0496115_0166967 | 3300048918 | Bacteria | 1820 |
| 236 | Ga0496116_0000138 | 3300048919 | Bacteria | 151606 |
| 237 | Ga0496117_0002715 | 3300048920 | Bacteria | 21760 |
| 238 | Ga0496118_0005655 | 3300048921 | Bacteria | 14094 |
| 239 | Ga0496118_0095630 | 3300048921 | Bacteria | 2027 |
| 240 | Ga0496118_0218301 | 3300048921 | Bacteria | 1112 |
| 241 | Ga0496119_0004108 | 3300048922 | Bacteria | 14674 |
| 242 | Ga0496119_0079226 | 3300048922 | Bacteria | 1898 |
| 243 | Ga0496120_0001479 | 3300048923 | Bacteria | 27945 |
| 244 | Ga0496121_0065605 | 3300048924 | Bacteria | 2953 |
| 245 | Ga0496121_0081139 | 3300048924 | Bacteria | 2568 |
| 246 | Ga0496121_0234202 | 3300048924 | Bacteria | 1284 |
| 247 | Ga0496124_0260962 | 3300048927 | Bacteria | 1275 |
| 248 | Ga0496124_0429758 | 3300048927 | Bacteria | 907 |
| 249 | Ga0496126_0006956 | 3300048929 | Bacteria | 12515 |
| 250 | Ga0496126_0007385 | 3300048929 | Bacteria | 12053 |
| 251 | Ga0496126_0089751 | 3300048929 | Bacteria | 2705 |
| 252 | Ga0501031_0000140 | 3300049568 | Bacteria | 40630 |
| 253 | Ga0501032_0000313 | 3300049569 | Bacteria | 40757 |
| 254 | Ga0501033_0000417 | 3300049570 | Bacteria | 40747 |
| 255 | Ga0501034_0160597 | 3300049571 | Bacteria | 2218 |
| 256 | Ga0501034_0692063 | 3300049571 | Bacteria | 918 |
| 257 | Ga0501034_0723995 | 3300049571 | Unclassified | 892 |
| 258 | Ga0501036_0000063 | 3300049572 | Bacteria | 69495 |
| 259 | Ga0501037_0026921 | 3300049573 | Bacteria | 4247 |
| 260 | Ga0501038_0000333 | 3300049574 | Bacteria | 40732 |
| 261 | Ga0501039_0339283 | 3300049575 | Bacteria | 1181 |
| 262 | Ga0501040_0051450 | 3300049576 | Bacteria | 2818 |
| 263 | Ga0501042_0032598 | 3300049578 | Bacteria | 3690 |
| 264 | Ga0501042_0045762 | 3300049578 | Bacteria | 3119 |
| 265 | Ga0501043_0000499 | 3300049579 | Bacteria | 35234 |
| 266 | Ga0501046_0000603 | 3300049580 | Bacteria | 35274 |
| 267 | Ga0501047_0000686 | 3300049581 | Bacteria | 35325 |
| 268 | Ga0501047_0002300 | 3300049581 | Bacteria | 18279 |
| 269 | Ga0501047_0249314 | 3300049581 | Bacteria | 1624 |
| 270 | Ga0501047_0279716 | 3300049581 | Unclassified | 1513 |
| 271 | Ga0501047_0388910 | 3300049581 | Bacteria | 1228 |
| 272 | Ga0501048_0000259 | 3300049582 | Bacteria | 35312 |
| 273 | Ga0501068_0008747 | 3300049584 | Bacteria | 5648 |
| 274 | Ga0501069_0107101 | 3300049585 | Bacteria | 1589 |
| 275 | Ga0501069_0298767 | 3300049585 | Bacteria | 944 |
| 276 | Ga0501070_0000408 | 3300049586 | Bacteria | 39113 |
| 277 | Ga0501070_0068718 | 3300049586 | Bacteria | 2933 |
| 278 | Ga0501070_0118191 | 3300049586 | Unclassified | 2190 |
| 279 | Ga0501070_0351820 | 3300049586 | Bacteria | 1195 |
| 280 | Ga0501071_0095976 | 3300049587 | Unclassified | 2182 |
| 281 | Ga0501071_0164426 | 3300049587 | Bacteria | 1660 |
| 282 | Ga0501072_0386100 | 3300049588 | Bacteria | 1111 |
| 283 | Ga0501072_0911374 | 3300049588 | Bacteria | 686 |
| 284 | Ga0501073_0019228 | 3300049589 | Bacteria | 4934 |
| 285 | Ga0501074_0028746 | 3300049590 | Bacteria | 4027 |
| 286 | Ga0501074_0328012 | 3300049590 | Bacteria | 1087 |
| 287 | Ga0501074_0601606 | 3300049590 | Unclassified | 777 |
| 288 | Ga0501075_0536791 | 3300049591 | Bacteria | 893 |
| 289 | Ga0501076_0221783 | 3300049592 | Bacteria | 1545 |
| 290 | Ga0501079_0004866 | 3300049741 | Bacteria | 9951 |
| 291 | Ga0501079_0299378 | 3300049741 | Bacteria | 1258 |
| 292 | Ga0501079_0320474 | 3300049741 | Unclassified | 1213 |
| 293 | Ga0501080_0001807 | 3300049742 | Bacteria | 18341 |
| 294 | Ga0501080_0237053 | 3300049742 | Unclassified | 1666 |
| 295 | Ga0501081_0251041 | 3300049743 | Bacteria | 1292 |
| 296 | Ga0501081_1543490 | 3300049743 | Unclassified | 505 |
| 297 | Ga0501083_0006427 | 3300049744 | Bacteria | 8334 |
| 298 | Ga0501035_0000555 | 3300049822 | Bacteria | 41488 |
| 299 | Ga0501035_0066415 | 3300049822 | Bacteria | 3201 |
| 300 | Ga0501035_0373141 | 3300049822 | Bacteria | 1191 |
| 301 | Ga0501044_0000817 | 3300049823 | Bacteria | 37447 |
| 302 | Ga0501044_0097108 | 3300049823 | Bacteria | 2968 |
| 303 | Ga0501044_1140704 | 3300049823 | Unclassified | 648 |
| 304 | Ga0501045_0396378 | 3300049824 | Bacteria | 1027 |
| 305 | Ga0495601_0021535 | 3300053077 | Bacteria | 3949 |
| 306 | Ga0495601_0044289 | 3300053077 | Bacteria | 2797 |
| 307 | Ga0495601_0177225 | 3300053077 | Unclassified | 1394 |
| 308 | Ga0495601_0643229 | 3300053077 | Unclassified | 679 |
| 309 | Ga0495655_0000008 | 3300053083 | Bacteria | 153535 |
| 310 | Ga0495595_0000009 | 3300053084 | Bacteria | 193039 |
| 311 | Ga0495595_0000831 | 3300053084 | Bacteria | 11810 |
| 312 | Ga0495595_0146108 | 3300053084 | Unclassified | 1162 |
| 313 | Ga0495619_0000022 | 3300053085 | Bacteria | 184144 |
| 314 | Ga0495619_0000032 | 3300053085 | Bacteria | 139067 |
| 315 | Ga0495619_0000057 | 3300053085 | Bacteria | 93948 |
| 316 | Ga0500566_0045766 | 3300053094 | Bacteria | 2517 |
| 317 | Ga0500566_0502934 | 3300053094 | Bacteria | 521 |
| 318 | Ga0500641_0009985 | 3300053096 | Bacteria | 3422 |
| 319 | Ga0500628_000023 | 3300053129 | Bacteria | 77818 |
| 320 | Ga0501082_0003663 | 3300060353 | Bacteria | 13419 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046516 | Ga0495628_0031601 | Ga0495628_0031601_3475_3870 | 122 |
| 2 | 3300049568 | Ga0501031_0000140 | Ga0501031_0000140_40070_40474 | 122 |
| 3 | 3300049569 | Ga0501032_0000313 | Ga0501032_0000313_157_561 | 122 |
| 4 | 3300049570 | Ga0501033_0000417 | Ga0501033_0000417_40187_40591 | 122 |
| 5 | 3300049571 | Ga0501034_0160597 | Ga0501034_0160597_157_561 | 122 |
| 6 | 3300049572 | Ga0501036_0000063 | Ga0501036_0000063_40182_40586 | 122 |
| 7 | 3300049573 | Ga0501037_0026921 | Ga0501037_0026921_157_561 | 122 |
| 8 | 3300049574 | Ga0501038_0000333 | Ga0501038_0000333_40172_40576 | 122 |
| 9 | 3300049578 | Ga0501042_0032598 | Ga0501042_0032598_2448_2852 | 122 |
| 10 | 3300049579 | Ga0501043_0000499 | Ga0501043_0000499_157_561 | 122 |
| 11 | 3300049580 | Ga0501046_0000603 | Ga0501046_0000603_34714_35118 | 122 |
| 12 | 3300049581 | Ga0501047_0000686 | Ga0501047_0000686_34765_35169 | 122 |
| 13 | 3300049582 | Ga0501048_0000259 | Ga0501048_0000259_34765_35169 | 122 |
| 14 | 3300049584 | Ga0501068_0008747 | Ga0501068_0008747_3671_4075 | 122 |
| 15 | 3300049586 | Ga0501070_0000408 | Ga0501070_0000408_157_561 | 122 |
| 16 | 3300049588 | Ga0501072_0911374 | Ga0501072_0911374_176_580 | 122 |
| 17 | 3300049589 | Ga0501073_0019228 | Ga0501073_0019228_3045_3449 | 122 |
| 18 | 3300049590 | Ga0501074_0028746 | Ga0501074_0028746_380_784 | 122 |
| 19 | 3300049741 | Ga0501079_0004866 | Ga0501079_0004866_129_533 | 122 |
| 20 | 3300049742 | Ga0501080_0001807 | Ga0501080_0001807_16404_16808 | 122 |
| 21 | 3300049822 | Ga0501035_0000555 | Ga0501035_0000555_157_561 | 122 |
| 22 | 3300049823 | Ga0501044_0000817 | Ga0501044_0000817_157_561 | 122 |
| 23 | 3300060353 | Ga0501082_0003663 | Ga0501082_0003663_10868_11272 | 122 |
| 24 | 3300046460 | Ga0495638_0032677 | Ga0495638_0032677_2536_2916 | 126 |
| 25 | 3300046516 | Ga0495628_0085301 | Ga0495628_0085301_1696_2079 | 126 |
| 26 | 3300046543 | Ga0495645_0029697 | Ga0495645_0029697_1746_2129 | 126 |
| 27 | 3300003320 | rootH2_10016517 | rootH2_100165175 | 130 |
| 28 | 3300005337 | Ga0070682_100000032 | Ga0070682_10000003210 | 130 |
| 29 | 3300005338 | Ga0068868_100000568 | Ga0068868_1000005688 | 130 |
| 30 | 3300005344 | Ga0070661_100000255 | Ga0070661_10000025535 | 130 |
| 31 | 3300005365 | Ga0070688_100000747 | Ga0070688_1000007477 | 130 |
| 32 | 3300005365 | Ga0070688_101085685 | Ga0070688_1010856852 | 130 |
| 33 | 3300005366 | Ga0070659_100063676 | Ga0070659_1000636763 | 130 |
| 34 | 3300005439 | Ga0070711_100023085 | Ga0070711_1000230853 | 130 |
| 35 | 3300005439 | Ga0070711_100454902 | Ga0070711_1004549022 | 130 |
| 36 | 3300005455 | Ga0070663_101667486 | Ga0070663_1016674861 | 130 |
| 37 | 3300005466 | Ga0070685_10001568 | Ga0070685_100015686 | 130 |
| 38 | 3300005578 | Ga0068854_100000267 | Ga0068854_10000026724 | 130 |
| 39 | 3300005614 | Ga0068856_100001040 | Ga0068856_10000104024 | 130 |
| 40 | 3300005834 | Ga0068851_10000258 | Ga0068851_1000025810 | 130 |
| 41 | 3300006163 | Ga0070715_10027378 | Ga0070715_100273781 | 130 |
| 42 | 3300009098 | Ga0105245_10004472 | Ga0105245_100044723 | 130 |
| 43 | 3300009174 | Ga0105241_10319644 | Ga0105241_103196442 | 130 |
| 44 | 3300011119 | Ga0105246_12195940 | Ga0105246_121959401 | 130 |
| 45 | 3300013104 | Ga0157370_10002517 | Ga0157370_1000251717 | 130 |
| 46 | 3300013308 | Ga0157375_10002471 | Ga0157375_100024712 | 130 |
| 47 | 3300014325 | Ga0163163_10806215 | Ga0163163_108062151 | 130 |
| 48 | 3300014969 | Ga0157376_10364185 | Ga0157376_103641852 | 130 |
| 49 | 3300025321 | Ga0207656_10001236 | Ga0207656_100012363 | 130 |
| 50 | 3300025905 | Ga0207685_10044252 | Ga0207685_100442523 | 130 |
| 51 | 3300025911 | Ga0207654_10193600 | Ga0207654_101936002 | 130 |
| 52 | 3300025916 | Ga0207663_10002757 | Ga0207663_100027577 | 130 |
| 53 | 3300025916 | Ga0207663_10057704 | Ga0207663_100577043 | 130 |
| 54 | 3300025920 | Ga0207649_10000015 | Ga0207649_1000001592 | 130 |
| 55 | 3300025927 | Ga0207687_10001665 | Ga0207687_1000166515 | 130 |
| 56 | 3300025932 | Ga0207690_10045821 | Ga0207690_100458213 | 130 |
| 57 | 3300025935 | Ga0207709_10651175 | Ga0207709_106511752 | 130 |
| 58 | 3300025981 | Ga0207640_10000669 | Ga0207640_1000066915 | 130 |
| 59 | 3300026023 | Ga0207677_10001061 | Ga0207677_100010618 | 130 |
| 60 | 3300026067 | Ga0207678_11004222 | Ga0207678_110042222 | 130 |
| 61 | 3300026078 | Ga0207702_10000349 | Ga0207702_1000034935 | 130 |
| 62 | 3300046454 | Ga0495592_0133213 | Ga0495592_0133213_904_1296 | 130 |
| 63 | 3300046462 | Ga0495651_0072853 | Ga0495651_0072853_2151_2543 | 130 |
| 64 | 3300046463 | Ga0495653_0015845 | Ga0495653_0015845_5466_5858 | 130 |
| 65 | 3300046511 | Ga0495608_0000042 | Ga0495608_0000042_113320_113712 | 130 |
| 66 | 3300046523 | Ga0495644_0010007 | Ga0495644_0010007_777_1169 | 130 |
| 67 | 3300046535 | Ga0495586_0001779 | Ga0495586_0001779_1316_1708 | 130 |
| 68 | 3300046558 | Ga0495633_0008184 | Ga0495633_0008184_104_496 | 130 |
| 69 | 3300046642 | Ga0495634_0000050 | Ga0495634_0000050_36973_37365 | 130 |
| 70 | 3300046675 | Ga0495657_0000040 | Ga0495657_0000040_113320_113712 | 130 |
| 71 | 3300046679 | Ga0495623_0169208 | Ga0495623_0169208_240_632 | 130 |
| 72 | 3300046689 | Ga0495613_0282568 | Ga0495613_0282568_734_1126 | 130 |
| 73 | 3300046691 | Ga0495670_0034498 | Ga0495670_0034498_1297_1689 | 130 |
| 74 | 3300047444 | Ga0495675_0000036 | Ga0495675_0000036_32906_33298 | 130 |
| 75 | 3300048909 | Ga0496106_0000107 | Ga0496106_0000107_53736_54128 | 130 |
| 76 | 3300048910 | Ga0496107_0025196 | Ga0496107_0025196_139_531 | 130 |
| 77 | 3300048915 | Ga0496112_0000641 | Ga0496112_0000641_15982_16374 | 130 |
| 78 | 3300048916 | Ga0496113_0000002 | Ga0496113_0000002_195408_195800 | 130 |
| 79 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_283585_283977 | 130 |
| 80 | 3300048917 | Ga0496114_0680558 | Ga0496114_0680558_302_694 | 130 |
| 81 | 3300048918 | Ga0496115_0000027 | Ga0496115_0000027_9871_10263 | 130 |
| 82 | 3300048918 | Ga0496115_0028973 | Ga0496115_0028973_3092_3484 | 130 |
| 83 | 3300048924 | Ga0496121_0234202 | Ga0496121_0234202_224_616 | 130 |
| 84 | 3300048927 | Ga0496124_0260962 | Ga0496124_0260962_23_415 | 130 |
| 85 | 3300048929 | Ga0496126_0006956 | Ga0496126_0006956_326_718 | 130 |
| 86 | 3300048929 | Ga0496126_0007385 | Ga0496126_0007385_10151_10543 | 130 |
| 87 | 3300049571 | Ga0501034_0692063 | Ga0501034_0692063_141_533 | 130 |
| 88 | 3300049571 | Ga0501034_0723995 | Ga0501034_0723995_34_441 | 130 |
| 89 | 3300049581 | Ga0501047_0279716 | Ga0501047_0279716_74_481 | 130 |
| 90 | 3300049585 | Ga0501069_0107101 | Ga0501069_0107101_908_1315 | 130 |
| 91 | 3300049586 | Ga0501070_0118191 | Ga0501070_0118191_1604_2011 | 130 |
| 92 | 3300049586 | Ga0501070_0351820 | Ga0501070_0351820_744_1151 | 130 |
| 93 | 3300049587 | Ga0501071_0095976 | Ga0501071_0095976_153_560 | 130 |
| 94 | 3300049590 | Ga0501074_0601606 | Ga0501074_0601606_115_522 | 130 |
| 95 | 3300049591 | Ga0501075_0536791 | Ga0501075_0536791_72_464 | 130 |
| 96 | 3300049741 | Ga0501079_0320474 | Ga0501079_0320474_569_976 | 130 |
| 97 | 3300049742 | Ga0501080_0237053 | Ga0501080_0237053_1014_1421 | 130 |
| 98 | 3300053084 | Ga0495595_0000009 | Ga0495595_0000009_79328_79720 | 130 |
| 99 | 3300053084 | Ga0495595_0146108 | Ga0495595_0146108_221_613 | 130 |
| 100 | 3300053085 | Ga0495619_0000022 | Ga0495619_0000022_45993_46385 | 130 |
| 101 | 3300053085 | Ga0495619_0000057 | Ga0495619_0000057_2187_2579 | 130 |
| 102 | 3300000546 | LJNas_1033456 | LJNas_10334562 | 131 |
| 103 | 3300005329 | Ga0070683_100162066 | Ga0070683_1001620664 | 131 |
| 104 | 3300005336 | Ga0070680_100523822 | Ga0070680_1005238221 | 131 |
| 105 | 3300005341 | Ga0070691_10000100 | Ga0070691_100001004 | 131 |
| 106 | 3300005355 | Ga0070671_100751935 | Ga0070671_1007519352 | 131 |
| 107 | 3300005356 | Ga0070674_100000001 | Ga0070674_100000001278 | 131 |
| 108 | 3300005367 | Ga0070667_100074070 | Ga0070667_1000740705 | 131 |
| 109 | 3300005437 | Ga0070710_10388890 | Ga0070710_103888901 | 131 |
| 110 | 3300005440 | Ga0070705_100130845 | Ga0070705_1001308452 | 131 |
| 111 | 3300005444 | Ga0070694_100485795 | Ga0070694_1004857951 | 131 |
| 112 | 3300005455 | Ga0070663_100001196 | Ga0070663_1000011964 | 131 |
| 113 | 3300005458 | Ga0070681_10327644 | Ga0070681_103276442 | 131 |
| 114 | 3300005459 | Ga0068867_100803657 | Ga0068867_1008036571 | 131 |
| 115 | 3300005530 | Ga0070679_100001834 | Ga0070679_10000183417 | 131 |
| 116 | 3300005539 | Ga0068853_101809412 | Ga0068853_1018094121 | 131 |
| 117 | 3300005544 | Ga0070686_100576001 | Ga0070686_1005760011 | 131 |
| 118 | 3300005545 | Ga0070695_100146776 | Ga0070695_1001467762 | 131 |
| 119 | 3300005546 | Ga0070696_100110983 | Ga0070696_1001109832 | 131 |
| 120 | 3300005548 | Ga0070665_100190441 | Ga0070665_1001904412 | 131 |
| 121 | 3300005549 | Ga0070704_100182557 | Ga0070704_1001825572 | 131 |
| 122 | 3300005614 | Ga0068856_100042225 | Ga0068856_1000422255 | 131 |
| 123 | 3300005615 | Ga0070702_100143410 | Ga0070702_1001434101 | 131 |
| 124 | 3300005718 | Ga0068866_10000140 | Ga0068866_1000014010 | 131 |
| 125 | 3300005718 | Ga0068866_10310984 | Ga0068866_103109842 | 131 |
| 126 | 3300005841 | Ga0068863_100000050 | Ga0068863_10000005094 | 131 |
| 127 | 3300005843 | Ga0068860_101421078 | Ga0068860_1014210782 | 131 |
| 128 | 3300005937 | Ga0081455_10024963 | Ga0081455_100249635 | 131 |
| 129 | 3300006173 | Ga0070716_100056239 | Ga0070716_1000562393 | 131 |
| 130 | 3300009093 | Ga0105240_10483408 | Ga0105240_104834082 | 131 |
| 131 | 3300009098 | Ga0105245_10102937 | Ga0105245_101029374 | 131 |
| 132 | 3300009148 | Ga0105243_10465026 | Ga0105243_104650262 | 131 |
| 133 | 3300009176 | Ga0105242_10001159 | Ga0105242_100011596 | 131 |
| 134 | 3300009176 | Ga0105242_10022159 | Ga0105242_100221596 | 131 |
| 135 | 3300009176 | Ga0105242_10202272 | Ga0105242_102022723 | 131 |
| 136 | 3300009551 | Ga0105238_10000016 | Ga0105238_1000001691 | 131 |
| 137 | 3300010375 | Ga0105239_10239865 | Ga0105239_102398651 | 131 |
| 138 | 3300010375 | Ga0105239_12552404 | Ga0105239_125524042 | 131 |
| 139 | 3300013104 | Ga0157370_10974034 | Ga0157370_109740342 | 131 |
| 140 | 3300013296 | Ga0157374_10426968 | Ga0157374_104269682 | 131 |
| 141 | 3300013306 | Ga0163162_10776722 | Ga0163162_107767222 | 131 |
| 142 | 3300013308 | Ga0157375_10001744 | Ga0157375_100017443 | 131 |
| 143 | 3300013308 | Ga0157375_10162600 | Ga0157375_101626004 | 131 |
| 144 | 3300013308 | Ga0157375_10981276 | Ga0157375_109812762 | 131 |
| 145 | 3300013308 | Ga0157375_11016756 | Ga0157375_110167562 | 131 |
| 146 | 3300014325 | Ga0163163_10379483 | Ga0163163_103794832 | 131 |
| 147 | 3300014326 | Ga0157380_12910350 | Ga0157380_129103501 | 131 |
| 148 | 3300014968 | Ga0157379_10605495 | Ga0157379_106054951 | 131 |
| 149 | 3300017792 | Ga0163161_10000103 | Ga0163161_1000010344 | 131 |
| 150 | 3300020070 | Ga0206356_10052778 | Ga0206356_100527781 | 131 |
| 151 | 3300025898 | Ga0207692_10293842 | Ga0207692_102938422 | 131 |
| 152 | 3300025899 | Ga0207642_10000066 | Ga0207642_1000006621 | 131 |
| 153 | 3300025899 | Ga0207642_10008240 | Ga0207642_100082404 | 131 |
| 154 | 3300025899 | Ga0207642_10176559 | Ga0207642_101765592 | 131 |
| 155 | 3300025903 | Ga0207680_10022098 | Ga0207680_100220985 | 131 |
| 156 | 3300025913 | Ga0207695_10155010 | Ga0207695_101550103 | 131 |
| 157 | 3300025921 | Ga0207652_10000513 | Ga0207652_1000051325 | 131 |
| 158 | 3300025921 | Ga0207652_11114722 | Ga0207652_111147221 | 131 |
| 159 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012330 | 131 |
| 160 | 3300025924 | Ga0207694_10811120 | Ga0207694_108111202 | 131 |
| 161 | 3300025925 | Ga0207650_11237305 | Ga0207650_112373051 | 131 |
| 162 | 3300025927 | Ga0207687_10406632 | Ga0207687_104066321 | 131 |
| 163 | 3300025933 | Ga0207706_10270736 | Ga0207706_102707362 | 131 |
| 164 | 3300025934 | Ga0207686_10000035 | Ga0207686_1000003532 | 131 |
| 165 | 3300025934 | Ga0207686_10013833 | Ga0207686_100138336 | 131 |
| 166 | 3300025934 | Ga0207686_10089563 | Ga0207686_100895633 | 131 |
| 167 | 3300025935 | Ga0207709_10032288 | Ga0207709_100322883 | 131 |
| 168 | 3300025935 | Ga0207709_10571611 | Ga0207709_105716111 | 131 |
| 169 | 3300025937 | Ga0207669_10000002 | Ga0207669_1000000272 | 131 |
| 170 | 3300025939 | Ga0207665_10087244 | Ga0207665_100872443 | 131 |
| 171 | 3300025939 | Ga0207665_10164847 | Ga0207665_101648473 | 131 |
| 172 | 3300025944 | Ga0207661_10115082 | Ga0207661_101150824 | 131 |
| 173 | 3300025960 | Ga0207651_10282881 | Ga0207651_102828811 | 131 |
| 174 | 3300025961 | Ga0207712_10630159 | Ga0207712_106301592 | 131 |
| 175 | 3300025986 | Ga0207658_10010576 | Ga0207658_100105767 | 131 |
| 176 | 3300026023 | Ga0207677_12030578 | Ga0207677_120305781 | 131 |
| 177 | 3300026041 | Ga0207639_10402197 | Ga0207639_104021973 | 131 |
| 178 | 3300026067 | Ga0207678_10002590 | Ga0207678_100025902 | 131 |
| 179 | 3300026088 | Ga0207641_10000295 | Ga0207641_1000029515 | 131 |
| 180 | 3300026088 | Ga0207641_10002521 | Ga0207641_100025219 | 131 |
| 181 | 3300026089 | Ga0207648_10837551 | Ga0207648_108375511 | 131 |
| 182 | 3300028379 | Ga0268266_10000369 | Ga0268266_1000036973 | 131 |
| 183 | 3300028379 | Ga0268266_10240101 | Ga0268266_102401013 | 131 |
| 184 | 3300028381 | Ga0268264_10675838 | Ga0268264_106758382 | 131 |
| 185 | 3300028556 | Ga0265337_1002592 | Ga0265337_100259211 | 131 |
| 186 | 3300028558 | Ga0265326_10000056 | Ga0265326_1000005614 | 131 |
| 187 | 3300028558 | Ga0265326_10021122 | Ga0265326_100211222 | 131 |
| 188 | 3300028563 | Ga0265319_1000037 | Ga0265319_100003759 | 131 |
| 189 | 3300028654 | Ga0265322_10000017 | Ga0265322_1000001760 | 131 |
| 190 | 3300028800 | Ga0265338_10000051 | Ga0265338_10000051160 | 131 |
| 191 | 3300029957 | Ga0265324_10001639 | Ga0265324_100016391 | 131 |
| 192 | 3300031238 | Ga0265332_10025178 | Ga0265332_100251783 | 131 |
| 193 | 3300031239 | Ga0265328_10000258 | Ga0265328_1000025812 | 131 |
| 194 | 3300031240 | Ga0265320_10000068 | Ga0265320_1000006864 | 131 |
| 195 | 3300031241 | Ga0265325_10009857 | Ga0265325_100098572 | 131 |
| 196 | 3300031242 | Ga0265329_10007182 | Ga0265329_100071825 | 131 |
| 197 | 3300031249 | Ga0265339_10054877 | Ga0265339_100548772 | 131 |
| 198 | 3300031250 | Ga0265331_10005995 | Ga0265331_100059951 | 131 |
| 199 | 3300031251 | Ga0265327_10000317 | Ga0265327_1000031764 | 131 |
| 200 | 3300031344 | Ga0265316_10247311 | Ga0265316_102473112 | 131 |
| 201 | 3300031595 | Ga0265313_10397392 | Ga0265313_103973921 | 131 |
| 202 | 3300031711 | Ga0265314_10000973 | Ga0265314_1000097320 | 131 |
| 203 | 3300031712 | Ga0265342_10132537 | Ga0265342_101325371 | 131 |
| 204 | 3300035692 | Ga0373935_1261429 | Ga0373935_1261429_134_541 | 131 |
| 205 | 3300035725 | Ga0373947_0314641 | Ga0373947_0314641_270_677 | 131 |
| 206 | 3300036401 | Ga0373937_1159080 | Ga0373937_1159080_191_586 | 131 |
| 207 | 3300041459 | Ga0451800_1239691 | Ga0451800_1239691_106_501 | 131 |
| 208 | 3300041486 | Ga0451807_1102958 | Ga0451807_1102958_264_665 | 131 |
| 209 | 3300041494 | Ga0451837_0068871 | Ga0451837_0068871_337_732 | 131 |
| 210 | 3300041496 | Ga0451839_0214419 | Ga0451839_0214419_81_476 | 131 |
| 211 | 3300041512 | Ga0451853_3625586 | Ga0451853_3625586_812_1213 | 131 |
| 212 | 3300046454 | Ga0495592_0149611 | Ga0495592_0149611_595_993 | 131 |
| 213 | 3300046454 | Ga0495592_0321645 | Ga0495592_0321645_276_671 | 131 |
| 214 | 3300046455 | Ga0495603_0000085 | Ga0495603_0000085_7313_7708 | 131 |
| 215 | 3300046455 | Ga0495603_0002488 | Ga0495603_0002488_4537_4932 | 131 |
| 216 | 3300046459 | Ga0495629_0021272 | Ga0495629_0021272_611_1006 | 131 |
| 217 | 3300046461 | Ga0495641_0175638 | Ga0495641_0175638_200_598 | 131 |
| 218 | 3300046463 | Ga0495653_0202919 | Ga0495653_0202919_830_1225 | 131 |
| 219 | 3300046476 | Ga0495662_0000162 | Ga0495662_0000162_14103_14498 | 131 |
| 220 | 3300046511 | Ga0495608_0002177 | Ga0495608_0002177_7886_8281 | 131 |
| 221 | 3300046516 | Ga0495628_0000548 | Ga0495628_0000548_22082_22477 | 131 |
| 222 | 3300046529 | Ga0495652_0007230 | Ga0495652_0007230_9085_9483 | 131 |
| 223 | 3300046533 | Ga0495640_0004849 | Ga0495640_0004849_1568_1963 | 131 |
| 224 | 3300046533 | Ga0495640_0008071 | Ga0495640_0008071_2056_2451 | 131 |
| 225 | 3300046533 | Ga0495640_0854791 | Ga0495640_0854791_124_522 | 131 |
| 226 | 3300046536 | Ga0495587_0723163 | Ga0495587_0723163_53_448 | 131 |
| 227 | 3300046543 | Ga0495645_0005133 | Ga0495645_0005133_2118_2513 | 131 |
| 228 | 3300046543 | Ga0495645_0277455 | Ga0495645_0277455_350_745 | 131 |
| 229 | 3300046559 | Ga0495667_0000019 | Ga0495667_0000019_60385_60780 | 131 |
| 230 | 3300046559 | Ga0495667_0029763 | Ga0495667_0029763_2797_3192 | 131 |
| 231 | 3300046663 | Ga0495635_0000017 | Ga0495635_0000017_50441_50836 | 131 |
| 232 | 3300046663 | Ga0495635_0323092 | Ga0495635_0323092_33_428 | 131 |
| 233 | 3300046675 | Ga0495657_0013724 | Ga0495657_0013724_4666_5061 | 131 |
| 234 | 3300046680 | Ga0495646_0368912 | Ga0495646_0368912_160_576 | 131 |
| 235 | 3300046681 | Ga0495647_0128336 | Ga0495647_0128336_291_689 | 131 |
| 236 | 3300046684 | Ga0495669_0123271 | Ga0495669_0123271_351_749 | 131 |
| 237 | 3300046684 | Ga0495669_0357185 | Ga0495669_0357185_272_667 | 131 |
| 238 | 3300046689 | Ga0495613_0000067 | Ga0495613_0000067_43200_43595 | 131 |
| 239 | 3300046689 | Ga0495613_0331419 | Ga0495613_0331419_143_553 | 131 |
| 240 | 3300046692 | Ga0495671_0371028 | Ga0495671_0371028_102_503 | 131 |
| 241 | 3300046809 | Ga0495600_0000376 | Ga0495600_0000376_14228_14623 | 131 |
| 242 | 3300047315 | Ga0495581_0126894 | Ga0495581_0126894_892_1287 | 131 |
| 243 | 3300047319 | Ga0495674_0000024 | Ga0495674_0000024_108122_108517 | 131 |
| 244 | 3300047320 | Ga0495672_0267025 | Ga0495672_0267025_32_427 | 131 |
| 245 | 3300047321 | Ga0495676_0000928 | Ga0495676_0000928_2664_3059 | 131 |
| 246 | 3300047321 | Ga0495676_0004042 | Ga0495676_0004042_260_655 | 131 |
| 247 | 3300047321 | Ga0495676_0756675 | Ga0495676_0756675_102_500 | 131 |
| 248 | 3300047322 | Ga0495680_0001106 | Ga0495680_0001106_27590_27985 | 131 |
| 249 | 3300047322 | Ga0495680_0213008 | Ga0495680_0213008_332_727 | 131 |
| 250 | 3300047444 | Ga0495675_0050692 | Ga0495675_0050692_2207_2602 | 131 |
| 251 | 3300047471 | Ga0495684_0037579 | Ga0495684_0037579_1691_2086 | 131 |
| 252 | 3300047472 | Ga0495686_0037368 | Ga0495686_0037368_2397_2792 | 131 |
| 253 | 3300048088 | Ga0495602_0018543 | Ga0495602_0018543_627_1022 | 131 |
| 254 | 3300048088 | Ga0495602_0044758 | Ga0495602_0044758_2304_2699 | 131 |
| 255 | 3300048903 | Ga0496100_0000019 | Ga0496100_0000019_107706_108101 | 131 |
| 256 | 3300048903 | Ga0496100_0347873 | Ga0496100_0347873_101_496 | 131 |
| 257 | 3300048904 | Ga0496101_0000005 | Ga0496101_0000005_107706_108101 | 131 |
| 258 | 3300048905 | Ga0496102_0000021 | Ga0496102_0000021_41441_41836 | 131 |
| 259 | 3300048905 | Ga0496102_0025778 | Ga0496102_0025778_2681_3076 | 131 |
| 260 | 3300048905 | Ga0496102_0272015 | Ga0496102_0272015_692_1087 | 131 |
| 261 | 3300048905 | Ga0496102_0340675 | Ga0496102_0340675_681_1082 | 131 |
| 262 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_554071_554466 | 131 |
| 263 | 3300048906 | Ga0496103_0047447 | Ga0496103_0047447_1422_1817 | 131 |
| 264 | 3300048907 | Ga0496104_0037124 | Ga0496104_0037124_4131_4526 | 131 |
| 265 | 3300048907 | Ga0496104_0918592 | Ga0496104_0918592_230_628 | 131 |
| 266 | 3300048908 | Ga0496105_0015739 | Ga0496105_0015739_4853_5248 | 131 |
| 267 | 3300048909 | Ga0496106_0000033 | Ga0496106_0000033_57695_58090 | 131 |
| 268 | 3300048910 | Ga0496107_0000004 | Ga0496107_0000004_107923_108318 | 131 |
| 269 | 3300048910 | Ga0496107_0202823 | Ga0496107_0202823_517_918 | 131 |
| 270 | 3300048911 | Ga0496108_0000133 | Ga0496108_0000133_53932_54327 | 131 |
| 271 | 3300048912 | Ga0496109_0000021 | Ga0496109_0000021_166478_166873 | 131 |
| 272 | 3300048914 | Ga0496111_0686194 | Ga0496111_0686194_241_639 | 131 |
| 273 | 3300048916 | Ga0496113_0550783 | Ga0496113_0550783_397_795 | 131 |
| 274 | 3300048916 | Ga0496113_1136917 | Ga0496113_1136917_162_557 | 131 |
| 275 | 3300048918 | Ga0496115_0000022 | Ga0496115_0000022_8999_9394 | 131 |
| 276 | 3300048918 | Ga0496115_0166967 | Ga0496115_0166967_504_920 | 131 |
| 277 | 3300048919 | Ga0496116_0000138 | Ga0496116_0000138_18011_18406 | 131 |
| 278 | 3300048920 | Ga0496117_0002715 | Ga0496117_0002715_2850_3245 | 131 |
| 279 | 3300048921 | Ga0496118_0005655 | Ga0496118_0005655_2819_3214 | 131 |
| 280 | 3300048921 | Ga0496118_0095630 | Ga0496118_0095630_281_676 | 131 |
| 281 | 3300048921 | Ga0496118_0218301 | Ga0496118_0218301_646_1041 | 131 |
| 282 | 3300048922 | Ga0496119_0004108 | Ga0496119_0004108_3031_3426 | 131 |
| 283 | 3300048922 | Ga0496119_0079226 | Ga0496119_0079226_477_872 | 131 |
| 284 | 3300048923 | Ga0496120_0001479 | Ga0496120_0001479_13862_14257 | 131 |
| 285 | 3300048924 | Ga0496121_0065605 | Ga0496121_0065605_613_1008 | 131 |
| 286 | 3300048924 | Ga0496121_0081139 | Ga0496121_0081139_534_935 | 131 |
| 287 | 3300048927 | Ga0496124_0429758 | Ga0496124_0429758_333_734 | 131 |
| 288 | 3300048929 | Ga0496126_0089751 | Ga0496126_0089751_1286_1687 | 131 |
| 289 | 3300049575 | Ga0501039_0339283 | Ga0501039_0339283_694_1098 | 131 |
| 290 | 3300049576 | Ga0501040_0051450 | Ga0501040_0051450_124_528 | 131 |
| 291 | 3300049578 | Ga0501042_0045762 | Ga0501042_0045762_2660_3055 | 131 |
| 292 | 3300049581 | Ga0501047_0002300 | Ga0501047_0002300_15831_16232 | 131 |
| 293 | 3300049581 | Ga0501047_0249314 | Ga0501047_0249314_598_993 | 131 |
| 294 | 3300049581 | Ga0501047_0388910 | Ga0501047_0388910_300_704 | 131 |
| 295 | 3300049585 | Ga0501069_0298767 | Ga0501069_0298767_412_816 | 131 |
| 296 | 3300049586 | Ga0501070_0068718 | Ga0501070_0068718_1379_1774 | 131 |
| 297 | 3300049587 | Ga0501071_0164426 | Ga0501071_0164426_170_574 | 131 |
| 298 | 3300049588 | Ga0501072_0386100 | Ga0501072_0386100_305_709 | 131 |
| 299 | 3300049590 | Ga0501074_0328012 | Ga0501074_0328012_491_895 | 131 |
| 300 | 3300049592 | Ga0501076_0221783 | Ga0501076_0221783_687_1091 | 131 |
| 301 | 3300049741 | Ga0501079_0299378 | Ga0501079_0299378_81_485 | 131 |
| 302 | 3300049743 | Ga0501081_0251041 | Ga0501081_0251041_620_1024 | 131 |
| 303 | 3300049743 | Ga0501081_1543490 | Ga0501081_1543490_38_433 | 131 |
| 304 | 3300049744 | Ga0501083_0006427 | Ga0501083_0006427_7065_7460 | 131 |
| 305 | 3300049822 | Ga0501035_0066415 | Ga0501035_0066415_1542_1943 | 131 |
| 306 | 3300049822 | Ga0501035_0373141 | Ga0501035_0373141_517_918 | 131 |
| 307 | 3300049823 | Ga0501044_0097108 | Ga0501044_0097108_2145_2540 | 131 |
| 308 | 3300049823 | Ga0501044_1140704 | Ga0501044_1140704_54_458 | 131 |
| 309 | 3300049824 | Ga0501045_0396378 | Ga0501045_0396378_369_773 | 131 |
| 310 | 3300053077 | Ga0495601_0021535 | Ga0495601_0021535_1877_2272 | 131 |
| 311 | 3300053077 | Ga0495601_0044289 | Ga0495601_0044289_1409_1804 | 131 |
| 312 | 3300053077 | Ga0495601_0177225 | Ga0495601_0177225_892_1287 | 131 |
| 313 | 3300053077 | Ga0495601_0643229 | Ga0495601_0643229_213_611 | 131 |
| 314 | 3300053083 | Ga0495655_0000008 | Ga0495655_0000008_102119_102514 | 131 |
| 315 | 3300053084 | Ga0495595_0000831 | Ga0495595_0000831_3115_3510 | 131 |
| 316 | 3300053085 | Ga0495619_0000032 | Ga0495619_0000032_107619_108014 | 131 |
| 317 | 3300053094 | Ga0500566_0045766 | Ga0500566_0045766_1855_2250 | 131 |
| 318 | 3300053094 | Ga0500566_0502934 | Ga0500566_0502934_60_455 | 131 |
| 319 | 3300053096 | Ga0500641_0009985 | Ga0500641_0009985_2433_2855 | 131 |
| 320 | 3300053129 | Ga0500628_000023 | Ga0500628_000023_57033_57428 | 131 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2phd-assembly1.cif.gz_B | crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans | 0.902 | 31 | 107 |
| 4fbf-assembly1.cif.gz_A | crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant | 0.8939 | 31 | 107 |
| 3rns-assembly1.cif.gz_A | cupin 2 conserved barrel domain protein from leptotrichia buccalis | 0.8935 | 31 | 106 |
| 4e2g-assembly2.cif.gz_C | crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus | 0.892 | 30 | 110 |
| 4la3-assembly2.cif.gz_B | crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp | 0.8917 | 31 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5jspB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8911 | 31 | 111 | 2.60.120.10 |
| 5fpxA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8909 | 29 | 107 | 2.60.120.10 |
| 3rnsA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8896 | 31 | 107 | 2.60.120.10 |
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8873 | 31 | 107 | 2.60.120.10 |
| 4e2gD00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8853 | 29 | 110 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538D490-F1-model_v4 | Cupin domain-containing protein | 0.9377 | 1 | 109 |
|
| AF-A0A538A090-F1-model_v4 | Cupin domain-containing protein | 0.9357 | 1 | 130 |
|
| AF-A0A838V4N6-F1-model_v4 | Cupin domain-containing protein | 0.9339 | 1 | 131 |
|
| AF-A0A537W3R4-F1-model_v4 | Cupin domain-containing protein | 0.9317 | 1 | 123 |
|
| AF-A0A7C6Z1M3-F1-model_v4 | Cupin domain-containing protein | 0.9293 | 32 | 108 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar