F405676

General Info

Members Datasets Scaffolds Average Seq Length
320 213 320 131

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0031601|Ga0495628_0031601_3475_3870
Length 122
Sequence MSTYAVKRIDEMEAVFGGAFKRARAELGVESFGMQIIDMPPNYDNYPVHDHEQDGQEEVYVTLGGERFPLDADHVVRVGPGVTRKVWPGDAGIRILVLGGKAGEAYDAPDITKLGEPDPMAA

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
90 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 10
Rhizosphere 82.5
Stem 0
Stem Tuber 0
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1033456 3300000546 Bacteria 554
2 rootH2_10016517 3300003320 Bacteria 2239
3 Ga0070683_100162066 3300005329 Bacteria 2122
4 Ga0070680_100523822 3300005336 Bacteria 1015
5 Ga0070682_100000032 3300005337 Bacteria 155141
6 Ga0068868_100000568 3300005338 Bacteria 24761
7 Ga0070691_10000100 3300005341 Bacteria 25275
8 Ga0070661_100000255 3300005344 Bacteria 43552
9 Ga0070671_100751935 3300005355 Bacteria 847
10 Ga0070674_100000001 3300005356 Bacteria 277173
11 Ga0070688_100000747 3300005365 Bacteria 16013
12 Ga0070688_101085685 3300005365 Unclassified 639
13 Ga0070659_100063676 3300005366 Bacteria 2918
14 Ga0070667_100074070 3300005367 Bacteria 2904
15 Ga0070710_10388890 3300005437 Bacteria 932
16 Ga0070711_100023085 3300005439 Bacteria 4041
17 Ga0070711_100454902 3300005439 Bacteria 1049
18 Ga0070705_100130845 3300005440 Bacteria 1637
19 Ga0070694_100485795 3300005444 Bacteria 981
20 Ga0070663_100001196 3300005455 Bacteria 14269
21 Ga0070663_101667486 3300005455 Bacteria 569
22 Ga0070681_10327644 3300005458 Bacteria 1441
23 Ga0068867_100803657 3300005459 Unclassified 839
24 Ga0070685_10001568 3300005466 Bacteria 12047
25 Ga0070679_100001834 3300005530 Bacteria 19119
26 Ga0068853_101809412 3300005539 Bacteria 592
27 Ga0070686_100576001 3300005544 Bacteria 884
28 Ga0070695_100146776 3300005545 Bacteria 1642
29 Ga0070696_100110983 3300005546 Bacteria 1975
30 Ga0070665_100190441 3300005548 Bacteria 2052
31 Ga0070704_100182557 3300005549 Unclassified 1679
32 Ga0068854_100000267 3300005578 Bacteria 35526
33 Ga0068856_100001040 3300005614 Bacteria 29492
34 Ga0068856_100042225 3300005614 Bacteria 4485
35 Ga0070702_100143410 3300005615 Bacteria 1524
36 Ga0068866_10000140 3300005718 Bacteria 32464
37 Ga0068866_10310984 3300005718 Bacteria 987
38 Ga0068851_10000258 3300005834 Bacteria 25137
39 Ga0068863_100000050 3300005841 Bacteria 130200
40 Ga0068860_101421078 3300005843 Bacteria 715
41 Ga0081455_10024963 3300005937 Bacteria 5523
42 Ga0070715_10027378 3300006163 Bacteria 2277
43 Ga0070716_100056239 3300006173 Bacteria 2255
44 Ga0105240_10483408 3300009093 Bacteria 1380
45 Ga0105245_10004472 3300009098 Bacteria 12358
46 Ga0105245_10102937 3300009098 Bacteria 2645
47 Ga0105243_10465026 3300009148 Bacteria 1190
48 Ga0105241_10319644 3300009174 Bacteria 1338
49 Ga0105242_10001159 3300009176 Bacteria 20774
50 Ga0105242_10022159 3300009176 Bacteria 4992
51 Ga0105242_10202272 3300009176 Bacteria 1765
52 Ga0105238_10000016 3300009551 Bacteria 236218
53 Ga0105239_10239865 3300010375 Bacteria 2035
54 Ga0105239_12552404 3300010375 Unclassified 596
55 Ga0105246_12195940 3300011119 Bacteria 537
56 Ga0157370_10002517 3300013104 Bacteria 22034
57 Ga0157370_10974034 3300013104 Archaea 768
58 Ga0157374_10426968 3300013296 Unclassified 1325
59 Ga0163162_10776722 3300013306 Bacteria 1076
60 Ga0157375_10001744 3300013308 Bacteria 18673
61 Ga0157375_10002471 3300013308 Bacteria 15996
62 Ga0157375_10162600 3300013308 Bacteria 2375
63 Ga0157375_10981276 3300013308 Bacteria 985
64 Ga0157375_11016756 3300013308 Bacteria 968
65 Ga0163163_10379483 3300014325 Bacteria 1471
66 Ga0163163_10806215 3300014325 Unclassified 1002
67 Ga0157380_12910350 3300014326 Bacteria 545
68 Ga0157379_10605495 3300014968 Bacteria 1023
69 Ga0157376_10364185 3300014969 Bacteria 1387
70 Ga0163161_10000103 3300017792 Bacteria 81496
71 Ga0206356_10052778 3300020070 Unclassified 707
72 Ga0207656_10001236 3300025321 Bacteria 8446
73 Ga0207692_10293842 3300025898 Bacteria 987
74 Ga0207642_10000066 3300025899 Bacteria 28858
75 Ga0207642_10008240 3300025899 Bacteria 3564
76 Ga0207642_10176559 3300025899 Bacteria 1160
77 Ga0207680_10022098 3300025903 Bacteria 3455
78 Ga0207685_10044252 3300025905 Bacteria 1682
79 Ga0207654_10193600 3300025911 Bacteria 1334
80 Ga0207695_10155010 3300025913 Unclassified 2226
81 Ga0207663_10002757 3300025916 Bacteria 8472
82 Ga0207663_10057704 3300025916 Bacteria 2447
83 Ga0207649_10000015 3300025920 Bacteria 245662
84 Ga0207652_10000513 3300025921 Bacteria 39231
85 Ga0207652_11114722 3300025921 Bacteria 690
86 Ga0207694_10000012 3300025924 Bacteria 411218
87 Ga0207694_10811120 3300025924 Unclassified 791
88 Ga0207650_11237305 3300025925 Bacteria 636
89 Ga0207687_10001665 3300025927 Bacteria 15338
90 Ga0207687_10406632 3300025927 Bacteria 1121
91 Ga0207690_10045821 3300025932 Bacteria 2892
92 Ga0207706_10270736 3300025933 Bacteria 1482
93 Ga0207686_10000035 3300025934 Bacteria 130483
94 Ga0207686_10013833 3300025934 Bacteria 4476
95 Ga0207686_10089563 3300025934 Bacteria 2028
96 Ga0207709_10032288 3300025935 Bacteria 3064
97 Ga0207709_10571611 3300025935 Bacteria 892
98 Ga0207709_10651175 3300025935 Bacteria 839
99 Ga0207669_10000002 3300025937 Bacteria 377651
100 Ga0207665_10087244 3300025939 Bacteria 2157
101 Ga0207665_10164847 3300025939 Bacteria 1597
102 Ga0207661_10115082 3300025944 Bacteria 2281
103 Ga0207651_10282881 3300025960 Bacteria 1372
104 Ga0207712_10630159 3300025961 Bacteria 930
105 Ga0207640_10000669 3300025981 Bacteria 19997
106 Ga0207658_10010576 3300025986 Bacteria 6270
107 Ga0207677_10001061 3300026023 Bacteria 15064
108 Ga0207677_12030578 3300026023 Bacteria 535
109 Ga0207639_10402197 3300026041 Bacteria 1234
110 Ga0207678_10002590 3300026067 Bacteria 16479
111 Ga0207678_11004222 3300026067 Bacteria 738
112 Ga0207702_10000349 3300026078 Bacteria 52941
113 Ga0207641_10000295 3300026088 Bacteria 62363
114 Ga0207641_10002521 3300026088 Bacteria 16875
115 Ga0207648_10837551 3300026089 Unclassified 857
116 Ga0268266_10000369 3300028379 Bacteria 69354
117 Ga0268266_10240101 3300028379 Bacteria 1672
118 Ga0268264_10675838 3300028381 Unclassified 1024
119 Ga0265337_1002592 3300028556 Bacteria 8185
120 Ga0265326_10000056 3300028558 Bacteria 64840
121 Ga0265326_10021122 3300028558 Bacteria 1867
122 Ga0265319_1000037 3300028563 Bacteria 115642
123 Ga0265322_10000017 3300028654 Bacteria 114833
124 Ga0265338_10000051 3300028800 Bacteria 211202
125 Ga0265324_10001639 3300029957 Bacteria 12385
126 Ga0265332_10025178 3300031238 Bacteria 2615
127 Ga0265328_10000258 3300031239 Bacteria 24453
128 Ga0265320_10000068 3300031240 Bacteria 91884
129 Ga0265325_10009857 3300031241 Bacteria 5562
130 Ga0265329_10007182 3300031242 Bacteria 4333
131 Ga0265339_10054877 3300031249 Bacteria 2163
132 Ga0265331_10005995 3300031250 Bacteria 7252
133 Ga0265327_10000317 3300031251 Bacteria 92215
134 Ga0265316_10247311 3300031344 Bacteria 1310
135 Ga0265313_10397392 3300031595 Bacteria 541
136 Ga0265314_10000973 3300031711 Bacteria 33669
137 Ga0265342_10132537 3300031712 Bacteria 1395
138 Ga0373935_1261429 3300035692 Bacteria 551
139 Ga0373947_0314641 3300035725 Bacteria 1046
140 Ga0373937_1159080 3300036401 Bacteria 721
141 Ga0451800_1239691 3300041459 Bacteria 1056
142 Ga0451807_1102958 3300041486 Bacteria 1165
143 Ga0451837_0068871 3300041494 Unclassified 840
144 Ga0451839_0214419 3300041496 Bacteria 544
145 Ga0451853_3625586 3300041512 Bacteria 1494
146 Ga0495592_0133213 3300046454 Bacteria 1736
147 Ga0495592_0149611 3300046454 Unclassified 1616
148 Ga0495592_0321645 3300046454 Bacteria 1000
149 Ga0495603_0000085 3300046455 Bacteria 41686
150 Ga0495603_0002488 3300046455 Bacteria 10843
151 Ga0495629_0021272 3300046459 Bacteria 4629
152 Ga0495638_0032677 3300046460 Bacteria 3333
153 Ga0495641_0175638 3300046461 Unclassified 958
154 Ga0495651_0072853 3300046462 Bacteria 2608
155 Ga0495653_0015845 3300046463 Bacteria 6144
156 Ga0495653_0202919 3300046463 Bacteria 1344
157 Ga0495662_0000162 3300046476 Bacteria 26288
158 Ga0495608_0000042 3300046511 Bacteria 115906
159 Ga0495608_0002177 3300046511 Bacteria 14130
160 Ga0495628_0000548 3300046516 Bacteria 34470
161 Ga0495628_0031601 3300046516 Bacteria 4282
162 Ga0495628_0085301 3300046516 Bacteria 2450
163 Ga0495644_0010007 3300046523 Bacteria 3654
164 Ga0495652_0007230 3300046529 Bacteria 10249
165 Ga0495640_0004849 3300046533 Bacteria 10709
166 Ga0495640_0008071 3300046533 Bacteria 8268
167 Ga0495640_0854791 3300046533 Bacteria 540
168 Ga0495586_0001779 3300046535 Bacteria 11781
169 Ga0495587_0723163 3300046536 Bacteria 545
170 Ga0495645_0005133 3300046543 Bacteria 8968
171 Ga0495645_0029697 3300046543 Bacteria 3977
172 Ga0495645_0277455 3300046543 Bacteria 1104
173 Ga0495633_0008184 3300046558 Bacteria 5921
174 Ga0495667_0000019 3300046559 Bacteria 181645
175 Ga0495667_0029763 3300046559 Bacteria 3674
176 Ga0495634_0000050 3300046642 Bacteria 94546
177 Ga0495635_0000017 3300046663 Bacteria 195506
178 Ga0495635_0323092 3300046663 Unclassified 1032
179 Ga0495657_0000040 3300046675 Bacteria 115899
180 Ga0495657_0013724 3300046675 Bacteria 5966
181 Ga0495623_0169208 3300046679 Bacteria 1278
182 Ga0495646_0368912 3300046680 Bacteria 750
183 Ga0495647_0128336 3300046681 Bacteria 1072
184 Ga0495669_0123271 3300046684 Bacteria 1216
185 Ga0495669_0357185 3300046684 Unclassified 706
186 Ga0495613_0000067 3300046689 Bacteria 101960
187 Ga0495613_0282568 3300046689 Bacteria 1152
188 Ga0495613_0331419 3300046689 Bacteria 1049
189 Ga0495670_0034498 3300046691 Unclassified 2520
190 Ga0495671_0371028 3300046692 Bacteria 686
191 Ga0495600_0000376 3300046809 Bacteria 23258
192 Ga0495581_0126894 3300047315 Unclassified 1486
193 Ga0495674_0000024 3300047319 Bacteria 141746
194 Ga0495672_0267025 3300047320 Unclassified 823
195 Ga0495676_0000928 3300047321 Bacteria 24577
196 Ga0495676_0004042 3300047321 Bacteria 13356
197 Ga0495676_0756675 3300047321 Unclassified 627
198 Ga0495680_0001106 3300047322 Bacteria 29781
199 Ga0495680_0213008 3300047322 Bacteria 1382
200 Ga0495675_0000036 3300047444 Bacteria 91842
201 Ga0495675_0050692 3300047444 Bacteria 2638
202 Ga0495684_0037579 3300047471 Bacteria 3714
203 Ga0495686_0037368 3300047472 Bacteria 3111
204 Ga0495602_0018543 3300048088 Bacteria 6945
205 Ga0495602_0044758 3300048088 Bacteria 4011
206 Ga0496100_0000019 3300048903 Bacteria 149995
207 Ga0496100_0347873 3300048903 Bacteria 1119
208 Ga0496101_0000005 3300048904 Bacteria 331455
209 Ga0496102_0000021 3300048905 Bacteria 246920
210 Ga0496102_0025778 3300048905 Bacteria 5236
211 Ga0496102_0272015 3300048905 Bacteria 1597
212 Ga0496102_0340675 3300048905 Unclassified 1412
213 Ga0496103_0000001 3300048906 Bacteria 643471
214 Ga0496103_0047447 3300048906 Bacteria 2654
215 Ga0496104_0037124 3300048907 Bacteria 4556
216 Ga0496104_0918592 3300048907 Bacteria 780
217 Ga0496105_0015739 3300048908 Bacteria 6035
218 Ga0496106_0000033 3300048909 Bacteria 131412
219 Ga0496106_0000107 3300048909 Bacteria 64689
220 Ga0496107_0000004 3300048910 Bacteria 297680
221 Ga0496107_0025196 3300048910 Bacteria 4209
222 Ga0496107_0202823 3300048910 Bacteria 1474
223 Ga0496108_0000133 3300048911 Bacteria 72253
224 Ga0496109_0000021 3300048912 Bacteria 189945
225 Ga0496111_0686194 3300048914 Bacteria 746
226 Ga0496112_0000641 3300048915 Bacteria 24272
227 Ga0496113_0000002 3300048916 Bacteria 220193
228 Ga0496113_0550783 3300048916 Bacteria 925
229 Ga0496113_1136917 3300048916 Bacteria 611
230 Ga0496114_0000003 3300048917 Bacteria 630981
231 Ga0496114_0680558 3300048917 Bacteria 903
232 Ga0496115_0000022 3300048918 Bacteria 164224
233 Ga0496115_0000027 3300048918 Bacteria 145505
234 Ga0496115_0028973 3300048918 Bacteria 4345
235 Ga0496115_0166967 3300048918 Bacteria 1820
236 Ga0496116_0000138 3300048919 Bacteria 151606
237 Ga0496117_0002715 3300048920 Bacteria 21760
238 Ga0496118_0005655 3300048921 Bacteria 14094
239 Ga0496118_0095630 3300048921 Bacteria 2027
240 Ga0496118_0218301 3300048921 Bacteria 1112
241 Ga0496119_0004108 3300048922 Bacteria 14674
242 Ga0496119_0079226 3300048922 Bacteria 1898
243 Ga0496120_0001479 3300048923 Bacteria 27945
244 Ga0496121_0065605 3300048924 Bacteria 2953
245 Ga0496121_0081139 3300048924 Bacteria 2568
246 Ga0496121_0234202 3300048924 Bacteria 1284
247 Ga0496124_0260962 3300048927 Bacteria 1275
248 Ga0496124_0429758 3300048927 Bacteria 907
249 Ga0496126_0006956 3300048929 Bacteria 12515
250 Ga0496126_0007385 3300048929 Bacteria 12053
251 Ga0496126_0089751 3300048929 Bacteria 2705
252 Ga0501031_0000140 3300049568 Bacteria 40630
253 Ga0501032_0000313 3300049569 Bacteria 40757
254 Ga0501033_0000417 3300049570 Bacteria 40747
255 Ga0501034_0160597 3300049571 Bacteria 2218
256 Ga0501034_0692063 3300049571 Bacteria 918
257 Ga0501034_0723995 3300049571 Unclassified 892
258 Ga0501036_0000063 3300049572 Bacteria 69495
259 Ga0501037_0026921 3300049573 Bacteria 4247
260 Ga0501038_0000333 3300049574 Bacteria 40732
261 Ga0501039_0339283 3300049575 Bacteria 1181
262 Ga0501040_0051450 3300049576 Bacteria 2818
263 Ga0501042_0032598 3300049578 Bacteria 3690
264 Ga0501042_0045762 3300049578 Bacteria 3119
265 Ga0501043_0000499 3300049579 Bacteria 35234
266 Ga0501046_0000603 3300049580 Bacteria 35274
267 Ga0501047_0000686 3300049581 Bacteria 35325
268 Ga0501047_0002300 3300049581 Bacteria 18279
269 Ga0501047_0249314 3300049581 Bacteria 1624
270 Ga0501047_0279716 3300049581 Unclassified 1513
271 Ga0501047_0388910 3300049581 Bacteria 1228
272 Ga0501048_0000259 3300049582 Bacteria 35312
273 Ga0501068_0008747 3300049584 Bacteria 5648
274 Ga0501069_0107101 3300049585 Bacteria 1589
275 Ga0501069_0298767 3300049585 Bacteria 944
276 Ga0501070_0000408 3300049586 Bacteria 39113
277 Ga0501070_0068718 3300049586 Bacteria 2933
278 Ga0501070_0118191 3300049586 Unclassified 2190
279 Ga0501070_0351820 3300049586 Bacteria 1195
280 Ga0501071_0095976 3300049587 Unclassified 2182
281 Ga0501071_0164426 3300049587 Bacteria 1660
282 Ga0501072_0386100 3300049588 Bacteria 1111
283 Ga0501072_0911374 3300049588 Bacteria 686
284 Ga0501073_0019228 3300049589 Bacteria 4934
285 Ga0501074_0028746 3300049590 Bacteria 4027
286 Ga0501074_0328012 3300049590 Bacteria 1087
287 Ga0501074_0601606 3300049590 Unclassified 777
288 Ga0501075_0536791 3300049591 Bacteria 893
289 Ga0501076_0221783 3300049592 Bacteria 1545
290 Ga0501079_0004866 3300049741 Bacteria 9951
291 Ga0501079_0299378 3300049741 Bacteria 1258
292 Ga0501079_0320474 3300049741 Unclassified 1213
293 Ga0501080_0001807 3300049742 Bacteria 18341
294 Ga0501080_0237053 3300049742 Unclassified 1666
295 Ga0501081_0251041 3300049743 Bacteria 1292
296 Ga0501081_1543490 3300049743 Unclassified 505
297 Ga0501083_0006427 3300049744 Bacteria 8334
298 Ga0501035_0000555 3300049822 Bacteria 41488
299 Ga0501035_0066415 3300049822 Bacteria 3201
300 Ga0501035_0373141 3300049822 Bacteria 1191
301 Ga0501044_0000817 3300049823 Bacteria 37447
302 Ga0501044_0097108 3300049823 Bacteria 2968
303 Ga0501044_1140704 3300049823 Unclassified 648
304 Ga0501045_0396378 3300049824 Bacteria 1027
305 Ga0495601_0021535 3300053077 Bacteria 3949
306 Ga0495601_0044289 3300053077 Bacteria 2797
307 Ga0495601_0177225 3300053077 Unclassified 1394
308 Ga0495601_0643229 3300053077 Unclassified 679
309 Ga0495655_0000008 3300053083 Bacteria 153535
310 Ga0495595_0000009 3300053084 Bacteria 193039
311 Ga0495595_0000831 3300053084 Bacteria 11810
312 Ga0495595_0146108 3300053084 Unclassified 1162
313 Ga0495619_0000022 3300053085 Bacteria 184144
314 Ga0495619_0000032 3300053085 Bacteria 139067
315 Ga0495619_0000057 3300053085 Bacteria 93948
316 Ga0500566_0045766 3300053094 Bacteria 2517
317 Ga0500566_0502934 3300053094 Bacteria 521
318 Ga0500641_0009985 3300053096 Bacteria 3422
319 Ga0500628_000023 3300053129 Bacteria 77818
320 Ga0501082_0003663 3300060353 Bacteria 13419

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0031601 Ga0495628_0031601_3475_3870 122
2 3300049568 Ga0501031_0000140 Ga0501031_0000140_40070_40474 122
3 3300049569 Ga0501032_0000313 Ga0501032_0000313_157_561 122
4 3300049570 Ga0501033_0000417 Ga0501033_0000417_40187_40591 122
5 3300049571 Ga0501034_0160597 Ga0501034_0160597_157_561 122
6 3300049572 Ga0501036_0000063 Ga0501036_0000063_40182_40586 122
7 3300049573 Ga0501037_0026921 Ga0501037_0026921_157_561 122
8 3300049574 Ga0501038_0000333 Ga0501038_0000333_40172_40576 122
9 3300049578 Ga0501042_0032598 Ga0501042_0032598_2448_2852 122
10 3300049579 Ga0501043_0000499 Ga0501043_0000499_157_561 122
11 3300049580 Ga0501046_0000603 Ga0501046_0000603_34714_35118 122
12 3300049581 Ga0501047_0000686 Ga0501047_0000686_34765_35169 122
13 3300049582 Ga0501048_0000259 Ga0501048_0000259_34765_35169 122
14 3300049584 Ga0501068_0008747 Ga0501068_0008747_3671_4075 122
15 3300049586 Ga0501070_0000408 Ga0501070_0000408_157_561 122
16 3300049588 Ga0501072_0911374 Ga0501072_0911374_176_580 122
17 3300049589 Ga0501073_0019228 Ga0501073_0019228_3045_3449 122
18 3300049590 Ga0501074_0028746 Ga0501074_0028746_380_784 122
19 3300049741 Ga0501079_0004866 Ga0501079_0004866_129_533 122
20 3300049742 Ga0501080_0001807 Ga0501080_0001807_16404_16808 122
21 3300049822 Ga0501035_0000555 Ga0501035_0000555_157_561 122
22 3300049823 Ga0501044_0000817 Ga0501044_0000817_157_561 122
23 3300060353 Ga0501082_0003663 Ga0501082_0003663_10868_11272 122
24 3300046460 Ga0495638_0032677 Ga0495638_0032677_2536_2916 126
25 3300046516 Ga0495628_0085301 Ga0495628_0085301_1696_2079 126
26 3300046543 Ga0495645_0029697 Ga0495645_0029697_1746_2129 126
27 3300003320 rootH2_10016517 rootH2_100165175 130
28 3300005337 Ga0070682_100000032 Ga0070682_10000003210 130
29 3300005338 Ga0068868_100000568 Ga0068868_1000005688 130
30 3300005344 Ga0070661_100000255 Ga0070661_10000025535 130
31 3300005365 Ga0070688_100000747 Ga0070688_1000007477 130
32 3300005365 Ga0070688_101085685 Ga0070688_1010856852 130
33 3300005366 Ga0070659_100063676 Ga0070659_1000636763 130
34 3300005439 Ga0070711_100023085 Ga0070711_1000230853 130
35 3300005439 Ga0070711_100454902 Ga0070711_1004549022 130
36 3300005455 Ga0070663_101667486 Ga0070663_1016674861 130
37 3300005466 Ga0070685_10001568 Ga0070685_100015686 130
38 3300005578 Ga0068854_100000267 Ga0068854_10000026724 130
39 3300005614 Ga0068856_100001040 Ga0068856_10000104024 130
40 3300005834 Ga0068851_10000258 Ga0068851_1000025810 130
41 3300006163 Ga0070715_10027378 Ga0070715_100273781 130
42 3300009098 Ga0105245_10004472 Ga0105245_100044723 130
43 3300009174 Ga0105241_10319644 Ga0105241_103196442 130
44 3300011119 Ga0105246_12195940 Ga0105246_121959401 130
45 3300013104 Ga0157370_10002517 Ga0157370_1000251717 130
46 3300013308 Ga0157375_10002471 Ga0157375_100024712 130
47 3300014325 Ga0163163_10806215 Ga0163163_108062151 130
48 3300014969 Ga0157376_10364185 Ga0157376_103641852 130
49 3300025321 Ga0207656_10001236 Ga0207656_100012363 130
50 3300025905 Ga0207685_10044252 Ga0207685_100442523 130
51 3300025911 Ga0207654_10193600 Ga0207654_101936002 130
52 3300025916 Ga0207663_10002757 Ga0207663_100027577 130
53 3300025916 Ga0207663_10057704 Ga0207663_100577043 130
54 3300025920 Ga0207649_10000015 Ga0207649_1000001592 130
55 3300025927 Ga0207687_10001665 Ga0207687_1000166515 130
56 3300025932 Ga0207690_10045821 Ga0207690_100458213 130
57 3300025935 Ga0207709_10651175 Ga0207709_106511752 130
58 3300025981 Ga0207640_10000669 Ga0207640_1000066915 130
59 3300026023 Ga0207677_10001061 Ga0207677_100010618 130
60 3300026067 Ga0207678_11004222 Ga0207678_110042222 130
61 3300026078 Ga0207702_10000349 Ga0207702_1000034935 130
62 3300046454 Ga0495592_0133213 Ga0495592_0133213_904_1296 130
63 3300046462 Ga0495651_0072853 Ga0495651_0072853_2151_2543 130
64 3300046463 Ga0495653_0015845 Ga0495653_0015845_5466_5858 130
65 3300046511 Ga0495608_0000042 Ga0495608_0000042_113320_113712 130
66 3300046523 Ga0495644_0010007 Ga0495644_0010007_777_1169 130
67 3300046535 Ga0495586_0001779 Ga0495586_0001779_1316_1708 130
68 3300046558 Ga0495633_0008184 Ga0495633_0008184_104_496 130
69 3300046642 Ga0495634_0000050 Ga0495634_0000050_36973_37365 130
70 3300046675 Ga0495657_0000040 Ga0495657_0000040_113320_113712 130
71 3300046679 Ga0495623_0169208 Ga0495623_0169208_240_632 130
72 3300046689 Ga0495613_0282568 Ga0495613_0282568_734_1126 130
73 3300046691 Ga0495670_0034498 Ga0495670_0034498_1297_1689 130
74 3300047444 Ga0495675_0000036 Ga0495675_0000036_32906_33298 130
75 3300048909 Ga0496106_0000107 Ga0496106_0000107_53736_54128 130
76 3300048910 Ga0496107_0025196 Ga0496107_0025196_139_531 130
77 3300048915 Ga0496112_0000641 Ga0496112_0000641_15982_16374 130
78 3300048916 Ga0496113_0000002 Ga0496113_0000002_195408_195800 130
79 3300048917 Ga0496114_0000003 Ga0496114_0000003_283585_283977 130
80 3300048917 Ga0496114_0680558 Ga0496114_0680558_302_694 130
81 3300048918 Ga0496115_0000027 Ga0496115_0000027_9871_10263 130
82 3300048918 Ga0496115_0028973 Ga0496115_0028973_3092_3484 130
83 3300048924 Ga0496121_0234202 Ga0496121_0234202_224_616 130
84 3300048927 Ga0496124_0260962 Ga0496124_0260962_23_415 130
85 3300048929 Ga0496126_0006956 Ga0496126_0006956_326_718 130
86 3300048929 Ga0496126_0007385 Ga0496126_0007385_10151_10543 130
87 3300049571 Ga0501034_0692063 Ga0501034_0692063_141_533 130
88 3300049571 Ga0501034_0723995 Ga0501034_0723995_34_441 130
89 3300049581 Ga0501047_0279716 Ga0501047_0279716_74_481 130
90 3300049585 Ga0501069_0107101 Ga0501069_0107101_908_1315 130
91 3300049586 Ga0501070_0118191 Ga0501070_0118191_1604_2011 130
92 3300049586 Ga0501070_0351820 Ga0501070_0351820_744_1151 130
93 3300049587 Ga0501071_0095976 Ga0501071_0095976_153_560 130
94 3300049590 Ga0501074_0601606 Ga0501074_0601606_115_522 130
95 3300049591 Ga0501075_0536791 Ga0501075_0536791_72_464 130
96 3300049741 Ga0501079_0320474 Ga0501079_0320474_569_976 130
97 3300049742 Ga0501080_0237053 Ga0501080_0237053_1014_1421 130
98 3300053084 Ga0495595_0000009 Ga0495595_0000009_79328_79720 130
99 3300053084 Ga0495595_0146108 Ga0495595_0146108_221_613 130
100 3300053085 Ga0495619_0000022 Ga0495619_0000022_45993_46385 130
101 3300053085 Ga0495619_0000057 Ga0495619_0000057_2187_2579 130
102 3300000546 LJNas_1033456 LJNas_10334562 131
103 3300005329 Ga0070683_100162066 Ga0070683_1001620664 131
104 3300005336 Ga0070680_100523822 Ga0070680_1005238221 131
105 3300005341 Ga0070691_10000100 Ga0070691_100001004 131
106 3300005355 Ga0070671_100751935 Ga0070671_1007519352 131
107 3300005356 Ga0070674_100000001 Ga0070674_100000001278 131
108 3300005367 Ga0070667_100074070 Ga0070667_1000740705 131
109 3300005437 Ga0070710_10388890 Ga0070710_103888901 131
110 3300005440 Ga0070705_100130845 Ga0070705_1001308452 131
111 3300005444 Ga0070694_100485795 Ga0070694_1004857951 131
112 3300005455 Ga0070663_100001196 Ga0070663_1000011964 131
113 3300005458 Ga0070681_10327644 Ga0070681_103276442 131
114 3300005459 Ga0068867_100803657 Ga0068867_1008036571 131
115 3300005530 Ga0070679_100001834 Ga0070679_10000183417 131
116 3300005539 Ga0068853_101809412 Ga0068853_1018094121 131
117 3300005544 Ga0070686_100576001 Ga0070686_1005760011 131
118 3300005545 Ga0070695_100146776 Ga0070695_1001467762 131
119 3300005546 Ga0070696_100110983 Ga0070696_1001109832 131
120 3300005548 Ga0070665_100190441 Ga0070665_1001904412 131
121 3300005549 Ga0070704_100182557 Ga0070704_1001825572 131
122 3300005614 Ga0068856_100042225 Ga0068856_1000422255 131
123 3300005615 Ga0070702_100143410 Ga0070702_1001434101 131
124 3300005718 Ga0068866_10000140 Ga0068866_1000014010 131
125 3300005718 Ga0068866_10310984 Ga0068866_103109842 131
126 3300005841 Ga0068863_100000050 Ga0068863_10000005094 131
127 3300005843 Ga0068860_101421078 Ga0068860_1014210782 131
128 3300005937 Ga0081455_10024963 Ga0081455_100249635 131
129 3300006173 Ga0070716_100056239 Ga0070716_1000562393 131
130 3300009093 Ga0105240_10483408 Ga0105240_104834082 131
131 3300009098 Ga0105245_10102937 Ga0105245_101029374 131
132 3300009148 Ga0105243_10465026 Ga0105243_104650262 131
133 3300009176 Ga0105242_10001159 Ga0105242_100011596 131
134 3300009176 Ga0105242_10022159 Ga0105242_100221596 131
135 3300009176 Ga0105242_10202272 Ga0105242_102022723 131
136 3300009551 Ga0105238_10000016 Ga0105238_1000001691 131
137 3300010375 Ga0105239_10239865 Ga0105239_102398651 131
138 3300010375 Ga0105239_12552404 Ga0105239_125524042 131
139 3300013104 Ga0157370_10974034 Ga0157370_109740342 131
140 3300013296 Ga0157374_10426968 Ga0157374_104269682 131
141 3300013306 Ga0163162_10776722 Ga0163162_107767222 131
142 3300013308 Ga0157375_10001744 Ga0157375_100017443 131
143 3300013308 Ga0157375_10162600 Ga0157375_101626004 131
144 3300013308 Ga0157375_10981276 Ga0157375_109812762 131
145 3300013308 Ga0157375_11016756 Ga0157375_110167562 131
146 3300014325 Ga0163163_10379483 Ga0163163_103794832 131
147 3300014326 Ga0157380_12910350 Ga0157380_129103501 131
148 3300014968 Ga0157379_10605495 Ga0157379_106054951 131
149 3300017792 Ga0163161_10000103 Ga0163161_1000010344 131
150 3300020070 Ga0206356_10052778 Ga0206356_100527781 131
151 3300025898 Ga0207692_10293842 Ga0207692_102938422 131
152 3300025899 Ga0207642_10000066 Ga0207642_1000006621 131
153 3300025899 Ga0207642_10008240 Ga0207642_100082404 131
154 3300025899 Ga0207642_10176559 Ga0207642_101765592 131
155 3300025903 Ga0207680_10022098 Ga0207680_100220985 131
156 3300025913 Ga0207695_10155010 Ga0207695_101550103 131
157 3300025921 Ga0207652_10000513 Ga0207652_1000051325 131
158 3300025921 Ga0207652_11114722 Ga0207652_111147221 131
159 3300025924 Ga0207694_10000012 Ga0207694_10000012330 131
160 3300025924 Ga0207694_10811120 Ga0207694_108111202 131
161 3300025925 Ga0207650_11237305 Ga0207650_112373051 131
162 3300025927 Ga0207687_10406632 Ga0207687_104066321 131
163 3300025933 Ga0207706_10270736 Ga0207706_102707362 131
164 3300025934 Ga0207686_10000035 Ga0207686_1000003532 131
165 3300025934 Ga0207686_10013833 Ga0207686_100138336 131
166 3300025934 Ga0207686_10089563 Ga0207686_100895633 131
167 3300025935 Ga0207709_10032288 Ga0207709_100322883 131
168 3300025935 Ga0207709_10571611 Ga0207709_105716111 131
169 3300025937 Ga0207669_10000002 Ga0207669_1000000272 131
170 3300025939 Ga0207665_10087244 Ga0207665_100872443 131
171 3300025939 Ga0207665_10164847 Ga0207665_101648473 131
172 3300025944 Ga0207661_10115082 Ga0207661_101150824 131
173 3300025960 Ga0207651_10282881 Ga0207651_102828811 131
174 3300025961 Ga0207712_10630159 Ga0207712_106301592 131
175 3300025986 Ga0207658_10010576 Ga0207658_100105767 131
176 3300026023 Ga0207677_12030578 Ga0207677_120305781 131
177 3300026041 Ga0207639_10402197 Ga0207639_104021973 131
178 3300026067 Ga0207678_10002590 Ga0207678_100025902 131
179 3300026088 Ga0207641_10000295 Ga0207641_1000029515 131
180 3300026088 Ga0207641_10002521 Ga0207641_100025219 131
181 3300026089 Ga0207648_10837551 Ga0207648_108375511 131
182 3300028379 Ga0268266_10000369 Ga0268266_1000036973 131
183 3300028379 Ga0268266_10240101 Ga0268266_102401013 131
184 3300028381 Ga0268264_10675838 Ga0268264_106758382 131
185 3300028556 Ga0265337_1002592 Ga0265337_100259211 131
186 3300028558 Ga0265326_10000056 Ga0265326_1000005614 131
187 3300028558 Ga0265326_10021122 Ga0265326_100211222 131
188 3300028563 Ga0265319_1000037 Ga0265319_100003759 131
189 3300028654 Ga0265322_10000017 Ga0265322_1000001760 131
190 3300028800 Ga0265338_10000051 Ga0265338_10000051160 131
191 3300029957 Ga0265324_10001639 Ga0265324_100016391 131
192 3300031238 Ga0265332_10025178 Ga0265332_100251783 131
193 3300031239 Ga0265328_10000258 Ga0265328_1000025812 131
194 3300031240 Ga0265320_10000068 Ga0265320_1000006864 131
195 3300031241 Ga0265325_10009857 Ga0265325_100098572 131
196 3300031242 Ga0265329_10007182 Ga0265329_100071825 131
197 3300031249 Ga0265339_10054877 Ga0265339_100548772 131
198 3300031250 Ga0265331_10005995 Ga0265331_100059951 131
199 3300031251 Ga0265327_10000317 Ga0265327_1000031764 131
200 3300031344 Ga0265316_10247311 Ga0265316_102473112 131
201 3300031595 Ga0265313_10397392 Ga0265313_103973921 131
202 3300031711 Ga0265314_10000973 Ga0265314_1000097320 131
203 3300031712 Ga0265342_10132537 Ga0265342_101325371 131
204 3300035692 Ga0373935_1261429 Ga0373935_1261429_134_541 131
205 3300035725 Ga0373947_0314641 Ga0373947_0314641_270_677 131
206 3300036401 Ga0373937_1159080 Ga0373937_1159080_191_586 131
207 3300041459 Ga0451800_1239691 Ga0451800_1239691_106_501 131
208 3300041486 Ga0451807_1102958 Ga0451807_1102958_264_665 131
209 3300041494 Ga0451837_0068871 Ga0451837_0068871_337_732 131
210 3300041496 Ga0451839_0214419 Ga0451839_0214419_81_476 131
211 3300041512 Ga0451853_3625586 Ga0451853_3625586_812_1213 131
212 3300046454 Ga0495592_0149611 Ga0495592_0149611_595_993 131
213 3300046454 Ga0495592_0321645 Ga0495592_0321645_276_671 131
214 3300046455 Ga0495603_0000085 Ga0495603_0000085_7313_7708 131
215 3300046455 Ga0495603_0002488 Ga0495603_0002488_4537_4932 131
216 3300046459 Ga0495629_0021272 Ga0495629_0021272_611_1006 131
217 3300046461 Ga0495641_0175638 Ga0495641_0175638_200_598 131
218 3300046463 Ga0495653_0202919 Ga0495653_0202919_830_1225 131
219 3300046476 Ga0495662_0000162 Ga0495662_0000162_14103_14498 131
220 3300046511 Ga0495608_0002177 Ga0495608_0002177_7886_8281 131
221 3300046516 Ga0495628_0000548 Ga0495628_0000548_22082_22477 131
222 3300046529 Ga0495652_0007230 Ga0495652_0007230_9085_9483 131
223 3300046533 Ga0495640_0004849 Ga0495640_0004849_1568_1963 131
224 3300046533 Ga0495640_0008071 Ga0495640_0008071_2056_2451 131
225 3300046533 Ga0495640_0854791 Ga0495640_0854791_124_522 131
226 3300046536 Ga0495587_0723163 Ga0495587_0723163_53_448 131
227 3300046543 Ga0495645_0005133 Ga0495645_0005133_2118_2513 131
228 3300046543 Ga0495645_0277455 Ga0495645_0277455_350_745 131
229 3300046559 Ga0495667_0000019 Ga0495667_0000019_60385_60780 131
230 3300046559 Ga0495667_0029763 Ga0495667_0029763_2797_3192 131
231 3300046663 Ga0495635_0000017 Ga0495635_0000017_50441_50836 131
232 3300046663 Ga0495635_0323092 Ga0495635_0323092_33_428 131
233 3300046675 Ga0495657_0013724 Ga0495657_0013724_4666_5061 131
234 3300046680 Ga0495646_0368912 Ga0495646_0368912_160_576 131
235 3300046681 Ga0495647_0128336 Ga0495647_0128336_291_689 131
236 3300046684 Ga0495669_0123271 Ga0495669_0123271_351_749 131
237 3300046684 Ga0495669_0357185 Ga0495669_0357185_272_667 131
238 3300046689 Ga0495613_0000067 Ga0495613_0000067_43200_43595 131
239 3300046689 Ga0495613_0331419 Ga0495613_0331419_143_553 131
240 3300046692 Ga0495671_0371028 Ga0495671_0371028_102_503 131
241 3300046809 Ga0495600_0000376 Ga0495600_0000376_14228_14623 131
242 3300047315 Ga0495581_0126894 Ga0495581_0126894_892_1287 131
243 3300047319 Ga0495674_0000024 Ga0495674_0000024_108122_108517 131
244 3300047320 Ga0495672_0267025 Ga0495672_0267025_32_427 131
245 3300047321 Ga0495676_0000928 Ga0495676_0000928_2664_3059 131
246 3300047321 Ga0495676_0004042 Ga0495676_0004042_260_655 131
247 3300047321 Ga0495676_0756675 Ga0495676_0756675_102_500 131
248 3300047322 Ga0495680_0001106 Ga0495680_0001106_27590_27985 131
249 3300047322 Ga0495680_0213008 Ga0495680_0213008_332_727 131
250 3300047444 Ga0495675_0050692 Ga0495675_0050692_2207_2602 131
251 3300047471 Ga0495684_0037579 Ga0495684_0037579_1691_2086 131
252 3300047472 Ga0495686_0037368 Ga0495686_0037368_2397_2792 131
253 3300048088 Ga0495602_0018543 Ga0495602_0018543_627_1022 131
254 3300048088 Ga0495602_0044758 Ga0495602_0044758_2304_2699 131
255 3300048903 Ga0496100_0000019 Ga0496100_0000019_107706_108101 131
256 3300048903 Ga0496100_0347873 Ga0496100_0347873_101_496 131
257 3300048904 Ga0496101_0000005 Ga0496101_0000005_107706_108101 131
258 3300048905 Ga0496102_0000021 Ga0496102_0000021_41441_41836 131
259 3300048905 Ga0496102_0025778 Ga0496102_0025778_2681_3076 131
260 3300048905 Ga0496102_0272015 Ga0496102_0272015_692_1087 131
261 3300048905 Ga0496102_0340675 Ga0496102_0340675_681_1082 131
262 3300048906 Ga0496103_0000001 Ga0496103_0000001_554071_554466 131
263 3300048906 Ga0496103_0047447 Ga0496103_0047447_1422_1817 131
264 3300048907 Ga0496104_0037124 Ga0496104_0037124_4131_4526 131
265 3300048907 Ga0496104_0918592 Ga0496104_0918592_230_628 131
266 3300048908 Ga0496105_0015739 Ga0496105_0015739_4853_5248 131
267 3300048909 Ga0496106_0000033 Ga0496106_0000033_57695_58090 131
268 3300048910 Ga0496107_0000004 Ga0496107_0000004_107923_108318 131
269 3300048910 Ga0496107_0202823 Ga0496107_0202823_517_918 131
270 3300048911 Ga0496108_0000133 Ga0496108_0000133_53932_54327 131
271 3300048912 Ga0496109_0000021 Ga0496109_0000021_166478_166873 131
272 3300048914 Ga0496111_0686194 Ga0496111_0686194_241_639 131
273 3300048916 Ga0496113_0550783 Ga0496113_0550783_397_795 131
274 3300048916 Ga0496113_1136917 Ga0496113_1136917_162_557 131
275 3300048918 Ga0496115_0000022 Ga0496115_0000022_8999_9394 131
276 3300048918 Ga0496115_0166967 Ga0496115_0166967_504_920 131
277 3300048919 Ga0496116_0000138 Ga0496116_0000138_18011_18406 131
278 3300048920 Ga0496117_0002715 Ga0496117_0002715_2850_3245 131
279 3300048921 Ga0496118_0005655 Ga0496118_0005655_2819_3214 131
280 3300048921 Ga0496118_0095630 Ga0496118_0095630_281_676 131
281 3300048921 Ga0496118_0218301 Ga0496118_0218301_646_1041 131
282 3300048922 Ga0496119_0004108 Ga0496119_0004108_3031_3426 131
283 3300048922 Ga0496119_0079226 Ga0496119_0079226_477_872 131
284 3300048923 Ga0496120_0001479 Ga0496120_0001479_13862_14257 131
285 3300048924 Ga0496121_0065605 Ga0496121_0065605_613_1008 131
286 3300048924 Ga0496121_0081139 Ga0496121_0081139_534_935 131
287 3300048927 Ga0496124_0429758 Ga0496124_0429758_333_734 131
288 3300048929 Ga0496126_0089751 Ga0496126_0089751_1286_1687 131
289 3300049575 Ga0501039_0339283 Ga0501039_0339283_694_1098 131
290 3300049576 Ga0501040_0051450 Ga0501040_0051450_124_528 131
291 3300049578 Ga0501042_0045762 Ga0501042_0045762_2660_3055 131
292 3300049581 Ga0501047_0002300 Ga0501047_0002300_15831_16232 131
293 3300049581 Ga0501047_0249314 Ga0501047_0249314_598_993 131
294 3300049581 Ga0501047_0388910 Ga0501047_0388910_300_704 131
295 3300049585 Ga0501069_0298767 Ga0501069_0298767_412_816 131
296 3300049586 Ga0501070_0068718 Ga0501070_0068718_1379_1774 131
297 3300049587 Ga0501071_0164426 Ga0501071_0164426_170_574 131
298 3300049588 Ga0501072_0386100 Ga0501072_0386100_305_709 131
299 3300049590 Ga0501074_0328012 Ga0501074_0328012_491_895 131
300 3300049592 Ga0501076_0221783 Ga0501076_0221783_687_1091 131
301 3300049741 Ga0501079_0299378 Ga0501079_0299378_81_485 131
302 3300049743 Ga0501081_0251041 Ga0501081_0251041_620_1024 131
303 3300049743 Ga0501081_1543490 Ga0501081_1543490_38_433 131
304 3300049744 Ga0501083_0006427 Ga0501083_0006427_7065_7460 131
305 3300049822 Ga0501035_0066415 Ga0501035_0066415_1542_1943 131
306 3300049822 Ga0501035_0373141 Ga0501035_0373141_517_918 131
307 3300049823 Ga0501044_0097108 Ga0501044_0097108_2145_2540 131
308 3300049823 Ga0501044_1140704 Ga0501044_1140704_54_458 131
309 3300049824 Ga0501045_0396378 Ga0501045_0396378_369_773 131
310 3300053077 Ga0495601_0021535 Ga0495601_0021535_1877_2272 131
311 3300053077 Ga0495601_0044289 Ga0495601_0044289_1409_1804 131
312 3300053077 Ga0495601_0177225 Ga0495601_0177225_892_1287 131
313 3300053077 Ga0495601_0643229 Ga0495601_0643229_213_611 131
314 3300053083 Ga0495655_0000008 Ga0495655_0000008_102119_102514 131
315 3300053084 Ga0495595_0000831 Ga0495595_0000831_3115_3510 131
316 3300053085 Ga0495619_0000032 Ga0495619_0000032_107619_108014 131
317 3300053094 Ga0500566_0045766 Ga0500566_0045766_1855_2250 131
318 3300053094 Ga0500566_0502934 Ga0500566_0502934_60_455 131
319 3300053096 Ga0500641_0009985 Ga0500641_0009985_2433_2855 131
320 3300053129 Ga0500628_000023 Ga0500628_000023_57033_57428 131

Structural Annotation

Top 5 Hits

ID Description Score Start End
2phd-assembly1.cif.gz_B crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.902 31 107
4fbf-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant 0.8939 31 107
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.8935 31 106
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.892 30 110
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.8917 31 111
ID Description Score Start End Superfamily
5jspB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8911 31 111 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8909 29 107 2.60.120.10
3rnsA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8896 31 107 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8873 31 107 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8853 29 110 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538D490-F1-model_v4 Cupin domain-containing protein 0.9377 1 109
AF-A0A538A090-F1-model_v4 Cupin domain-containing protein 0.9357 1 130
AF-A0A838V4N6-F1-model_v4 Cupin domain-containing protein 0.9339 1 131
AF-A0A537W3R4-F1-model_v4 Cupin domain-containing protein 0.9317 1 123
AF-A0A7C6Z1M3-F1-model_v4 Cupin domain-containing protein 0.9293 32 108

Feature Viewer

pLDDT pTM Quality
91.65 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map