F405683

General Info

Members Datasets Scaffolds Average Seq Length
320 167 320 267

Family's Representative Sequence

Representative Sequence 3300046539|Ga0495621_0018160|Ga0495621_0018160_767_1636
Length 289
Sequence MTAFFPSACRALDQELRMTSTRKLLTVAILCVLGSGLLAAQASPPAQAIPAKNPLEGDPAAIQTGMGLFRGRCADCHGMDARGVRGPDITQVWASGRTDDGLWKTIKNGVPNTEMPANPRALEHEIWQILAYLRTLAAPAPTDPPRGNAQNGEKLFRANCAGCHRVNVTGGRLGPDLSRVGVARSRDVMVRRIRGSIEDLGAGYEPVTITPESGPAIRGVKKNEDLFSVQVMDTRERIQGYEKDKVKAVVNDTKSAMPAFGVDRLSESDLDDLVRYLQSLRGFDPAVRQ

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.56
Rhizosphere 98.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10004248 3300002459 Unclassified 2907
2 JGI25406J46586_10004292 3300003203 Bacteria 6656
3 Ga0065715_10020194 3300005293 Unclassified 1998
4 Ga0065715_10179374 3300005293 Bacteria 1477
5 Ga0065707_10189734 3300005295 Bacteria 1368
6 Ga0065707_10246082 3300005295 Bacteria 1140
7 Ga0068869_100106040 3300005334 Bacteria 2132
8 Ga0068869_100187793 3300005334 Bacteria 1623
9 Ga0070666_10094072 3300005335 Bacteria 2061
10 Ga0070682_100408709 3300005337 Bacteria 1028
11 Ga0070689_100044920 3300005340 Unclassified 3400
12 Ga0070691_10044529 3300005341 Unclassified 2105
13 Ga0070687_100011022 3300005343 Bacteria 3938
14 Ga0070687_100059875 3300005343 Bacteria 2007
15 Ga0070661_100106542 3300005344 Bacteria 2090
16 Ga0070668_100011905 3300005347 Bacteria 6475
17 Ga0070668_100534405 3300005347 Unclassified 1019
18 Ga0070669_100003406 3300005353 Bacteria 11445
19 Ga0070675_100013113 3300005354 Bacteria 6512
20 Ga0070675_100172591 3300005354 Bacteria 1865
21 Ga0070675_100248815 3300005354 Bacteria 1555
22 Ga0070671_100017672 3300005355 Bacteria 5780
23 Ga0070688_100086267 3300005365 Bacteria 2042
24 Ga0070659_100022118 3300005366 Unclassified 4852
25 Ga0070659_100302317 3300005366 Bacteria 1335
26 Ga0070667_100179177 3300005367 Bacteria 1874
27 Ga0070711_100119356 3300005439 Bacteria 1948
28 Ga0070705_100004053 3300005440 Bacteria 7155
29 Ga0070705_100075851 3300005440 Bacteria 2048
30 Ga0070705_100428478 3300005440 Bacteria 987
31 Ga0070700_100175739 3300005441 Bacteria 1486
32 Ga0070700_100440505 3300005441 Bacteria 989
33 Ga0070694_100000629 3300005444 Bacteria 19395
34 Ga0070694_100009071 3300005444 Bacteria 6098
35 Ga0070694_100045277 3300005444 Bacteria 2949
36 Ga0070694_100184891 3300005444 Bacteria 1544
37 Ga0070708_100069018 3300005445 Unclassified 3178
38 Ga0070708_100287776 3300005445 Unclassified 1547
39 Ga0070708_100337957 3300005445 Bacteria 1419
40 Ga0070708_100588490 3300005445 Bacteria 1049
41 Ga0070678_100646069 3300005456 Bacteria 948
42 Ga0070662_100067817 3300005457 Bacteria 2621
43 Ga0070681_10002151 3300005458 Bacteria 17918
44 Ga0070681_10176734 3300005458 Bacteria 2057
45 Ga0068867_100001524 3300005459 Bacteria 16059
46 Ga0070685_10104317 3300005466 Bacteria 1736
47 Ga0070706_100089882 3300005467 Bacteria 2848
48 Ga0070706_100099753 3300005467 Bacteria 2698
49 Ga0070706_100190008 3300005467 Unclassified 1919
50 Ga0070707_100004319 3300005468 Bacteria 13315
51 Ga0070707_100174307 3300005468 Unclassified 2096
52 Ga0070707_100224264 3300005468 Bacteria 1830
53 Ga0070707_100335937 3300005468 Unclassified 1468
54 Ga0070707_100557554 3300005468 Bacteria 1108
55 Ga0070698_100006218 3300005471 Bacteria 12996
56 Ga0070698_100007952 3300005471 Bacteria 11472
57 Ga0070698_100031341 3300005471 Bacteria 5513
58 Ga0070698_100180635 3300005471 Bacteria 2049
59 Ga0070698_100181365 3300005471 Bacteria 2044
60 Ga0070698_100317999 3300005471 Unclassified 1487
61 Ga0070699_100001931 3300005518 Bacteria 18702
62 Ga0070699_100033413 3300005518 Bacteria 4444
63 Ga0070699_100090199 3300005518 Bacteria 2679
64 Ga0070699_100090536 3300005518 Bacteria 2674
65 Ga0070679_100060879 3300005530 Bacteria 3763
66 Ga0070679_100501219 3300005530 Bacteria 1158
67 Ga0070697_100166382 3300005536 Bacteria 1865
68 Ga0070672_100079018 3300005543 Bacteria 2633
69 Ga0070672_100104228 3300005543 Bacteria 2304
70 Ga0070695_100000112 3300005545 Bacteria 36134
71 Ga0070695_100292059 3300005545 Unclassified 1202
72 Ga0070696_100002188 3300005546 Bacteria 12877
73 Ga0070665_100262753 3300005548 Unclassified 1727
74 Ga0070704_100012749 3300005549 Bacteria 5199
75 Ga0070704_100158181 3300005549 Bacteria 1789
76 Ga0070704_100210657 3300005549 Unclassified 1574
77 Ga0070664_100130614 3300005564 Unclassified 2206
78 Ga0068857_100008228 3300005577 Bacteria 9016
79 Ga0070702_100062665 3300005615 Bacteria 2169
80 Ga0068859_100022461 3300005617 Bacteria 6326
81 Ga0068859_100035274 3300005617 Bacteria 5019
82 Ga0068859_100039063 3300005617 Bacteria 4760
83 Ga0068859_100603002 3300005617 Bacteria 1191
84 Ga0068859_100686895 3300005617 Unclassified 1115
85 Ga0068864_100029950 3300005618 Bacteria 4613
86 Ga0068864_100042576 3300005618 Bacteria 3886
87 Ga0068861_100073776 3300005719 Bacteria 2651
88 Ga0068861_100251987 3300005719 Bacteria 1507
89 Ga0068870_10335115 3300005840 Bacteria 966
90 Ga0068863_100285799 3300005841 Bacteria 1599
91 Ga0068858_100004314 3300005842 Bacteria 13970
92 Ga0068858_100028516 3300005842 Bacteria 5185
93 Ga0068860_100009836 3300005843 Bacteria 9488
94 Ga0081539_10000090 3300005985 Bacteria 212006
95 Ga0081539_10001115 3300005985 Bacteria 48750
96 Ga0081539_10126887 3300005985 Bacteria 1259
97 Ga0097621_100064686 3300006237 Bacteria 3008
98 Ga0068871_100051841 3300006358 Unclassified 3322
99 Ga0075428_100318313 3300006844 Bacteria 1672
100 Ga0075428_100433126 3300006844 Bacteria 1409
101 Ga0075430_100002230 3300006846 Bacteria 16058
102 Ga0075431_100022999 3300006847 Bacteria 6370
103 Ga0075431_100460360 3300006847 Unclassified 1266
104 Ga0075433_10071703 3300006852 Unclassified 3045
105 Ga0075433_10103039 3300006852 Bacteria 2527
106 Ga0075433_10128781 3300006852 Bacteria 2248
107 Ga0075433_10271748 3300006852 Unclassified 1502
108 Ga0075433_10384014 3300006852 Unclassified 1240
109 Ga0075433_10527253 3300006852 Bacteria 1039
110 Ga0075434_100004491 3300006871 Bacteria 12587
111 Ga0075434_100007675 3300006871 Bacteria 9983
112 Ga0075434_100088953 3300006871 Bacteria 3090
113 Ga0075434_100113889 3300006871 Bacteria 2717
114 Ga0075434_100209574 3300006871 Bacteria 1969
115 Ga0075434_100296425 3300006871 Unclassified 1637
116 Ga0075429_100147877 3300006880 Bacteria 2057
117 Ga0075429_100220132 3300006880 Bacteria 1663
118 Ga0075429_100398590 3300006880 Bacteria 1205
119 Ga0075436_100123135 3300006914 Bacteria 1816
120 Ga0097620_100022461 3300006931 Bacteria 6326
121 Ga0097620_100035276 3300006931 Bacteria 5019
122 Ga0097620_100039063 3300006931 Bacteria 4760
123 Ga0097620_100603121 3300006931 Bacteria 1191
124 Ga0097620_100686982 3300006931 Unclassified 1115
125 Ga0075435_100124860 3300007076 Bacteria 2150
126 Ga0111539_10006795 3300009094 Bacteria 14720
127 Ga0111539_10024849 3300009094 Bacteria 7346
128 Ga0111539_10085845 3300009094 Bacteria 3699
129 Ga0111539_10185836 3300009094 Bacteria 2427
130 Ga0111539_10262041 3300009094 Bacteria 2012
131 Ga0111539_10562554 3300009094 Bacteria 1328
132 Ga0105247_10006313 3300009101 Bacteria 7347
133 Ga0114129_10002873 3300009147 Bacteria 24107
134 Ga0114129_10007966 3300009147 Bacteria 15084
135 Ga0114129_10017762 3300009147 Bacteria 10129
136 Ga0114129_10033176 3300009147 Bacteria 7296
137 Ga0114129_10090105 3300009147 Bacteria 4252
138 Ga0114129_10119472 3300009147 Unclassified 3630
139 Ga0114129_10208022 3300009147 Bacteria 2647
140 Ga0114129_10260809 3300009147 Bacteria 2323
141 Ga0114129_10282084 3300009147 Bacteria 2219
142 Ga0114129_10343238 3300009147 Bacteria 1980
143 Ga0114129_10376471 3300009147 Unclassified 1876
144 Ga0114129_10423423 3300009147 Bacteria 1751
145 Ga0105243_10691030 3300009148 Bacteria 993
146 Ga0105248_10048213 3300009177 Bacteria 4778
147 Ga0105248_10180287 3300009177 Bacteria 2380
148 Ga0105249_10032298 3300009553 Bacteria 4735
149 Ga0105249_10775660 3300009553 Bacteria 1022
150 Ga0105246_10081276 3300011119 Bacteria 2309
151 Ga0157378_10264151 3300013297 Unclassified 1653
152 Ga0163162_10188902 3300013306 Bacteria 2187
153 Ga0157372_10233828 3300013307 Bacteria 2131
154 Ga0157375_10002807 3300013308 Bacteria 15077
155 Ga0157380_10013955 3300014326 Bacteria 5866
156 Ga0157380_10096409 3300014326 Bacteria 2452
157 Ga0157380_10248186 3300014326 Bacteria 1609
158 Ga0157377_10013794 3300014745 Bacteria 4096
159 Ga0157377_10017255 3300014745 Unclassified 3730
160 Ga0157376_10068439 3300014969 Bacteria 3007
161 Ga0157376_10136420 3300014969 Bacteria 2196
162 Ga0207653_10050623 3300025885 Bacteria 1381
163 Ga0207684_10158265 3300025910 Unclassified 1950
164 Ga0207707_10048957 3300025912 Unclassified 3682
165 Ga0207663_10091071 3300025916 Unclassified 2024
166 Ga0207662_10005392 3300025918 Bacteria 6812
167 Ga0207662_10018217 3300025918 Bacteria 3980
168 Ga0207649_10223531 3300025920 Unclassified 1342
169 Ga0207652_10319198 3300025921 Unclassified 1402
170 Ga0207646_10008304 3300025922 Bacteria 10420
171 Ga0207646_10061855 3300025922 Bacteria 3342
172 Ga0207646_10095098 3300025922 Bacteria 2669
173 Ga0207681_10002961 3300025923 Bacteria 10698
174 Ga0207681_10595499 3300025923 Bacteria 913
175 Ga0207659_10038029 3300025926 Unclassified 3344
176 Ga0207706_10052012 3300025933 Bacteria 3617
177 Ga0207706_10397884 3300025933 Unclassified 1194
178 Ga0207670_10081531 3300025936 Bacteria 2265
179 Ga0207704_10262819 3300025938 Bacteria 1302
180 Ga0207691_10023292 3300025940 Bacteria 5829
181 Ga0207691_10250180 3300025940 Bacteria 1530
182 Ga0207711_10031779 3300025941 Bacteria 4459
183 Ga0207711_10052978 3300025941 Bacteria 3479
184 Ga0207711_10081306 3300025941 Bacteria 2831
185 Ga0207689_10068450 3300025942 Bacteria 2918
186 Ga0207689_10141377 3300025942 Bacteria 1982
187 Ga0207679_10216405 3300025945 Unclassified 1610
188 Ga0207712_10192074 3300025961 Unclassified 1612
189 Ga0207658_10100188 3300025986 Bacteria 2268
190 Ga0207703_10068282 3300026035 Bacteria 2929
191 Ga0207708_10006020 3300026075 Bacteria 8990
192 Ga0207708_10038248 3300026075 Unclassified 3655
193 Ga0207641_10044411 3300026088 Bacteria 3737
194 Ga0207648_10003683 3300026089 Bacteria 16035
195 Ga0207675_100079755 3300026118 Bacteria 3068
196 Ga0207675_100289504 3300026118 Unclassified 1593
197 Ga0207683_10145477 3300026121 Bacteria 2137
198 Ga0207683_10363910 3300026121 Bacteria 1328
199 Ga0207428_10000890 3300027907 Bacteria 33538
200 Ga0207428_10035516 3300027907 Bacteria 4074
201 Ga0207428_10139510 3300027907 Bacteria 1851
202 Ga0207428_10317231 3300027907 Unclassified 1151
203 Ga0268266_10190114 3300028379 Bacteria 1874
204 Ga0268265_10004223 3300028380 Bacteria 10034
205 Ga0268265_10132529 3300028380 Unclassified 2074
206 Ga0268265_10467943 3300028380 Bacteria 1181
207 Ga0268264_10003233 3300028381 Bacteria 14106
208 Ga0373943_0247279 3300035170 Bacteria 1001
209 Ga0373931_0083564 3300035691 Bacteria 1767
210 Ga0373935_0249749 3300035692 Unclassified 1241
211 Ga0373947_0178575 3300035725 Unclassified 1381
212 Ga0373937_0212826 3300036401 Unclassified 1819
213 Ga0373925_0191893 3300037068 Unclassified 1621
214 Ga0439444_0016003 3300042437 Unclassified 1272
215 Ga0453683_0190965 3300044673 Bacteria 1300
216 Ga0451576_0042570 3300045051 Bacteria 4794
217 Ga0451576_0838908 3300045051 Unclassified 965
218 Ga0466967_0289258 3300045976 Bacteria 1574
219 Ga0495592_0171039 3300046454 Bacteria 1488
220 Ga0495584_0185527 3300046491 Bacteria 1057
221 Ga0495663_0124844 3300046525 Unclassified 864
222 Ga0495642_0004165 3300046528 Bacteria 5643
223 Ga0495652_0356660 3300046529 Unclassified 1046
224 Ga0495587_0023982 3300046536 Bacteria 3744
225 Ga0495621_0018160 3300046539 Unclassified 2281
226 Ga0495621_0049250 3300046539 Bacteria 1503
227 Ga0495633_0058741 3300046558 Bacteria 1805
228 Ga0495656_0129991 3300046615 Bacteria 1198
229 Ga0495659_0002279 3300046664 Bacteria 6223
230 Ga0495659_0002611 3300046664 Bacteria 5810
231 Ga0495659_0006091 3300046664 Unclassified 3812
232 Ga0495659_0031720 3300046664 Bacteria 1845
233 Ga0495659_0100803 3300046664 Unclassified 1118
234 Ga0495659_0108463 3300046664 Unclassified 1082
235 Ga0495646_0196924 3300046680 Unclassified 1099
236 Ga0495669_0006951 3300046684 Bacteria 4741
237 Ga0495669_0060202 3300046684 Bacteria 1716
238 Ga0495670_0193125 3300046691 Unclassified 1077
239 Ga0495670_0245031 3300046691 Unclassified 955
240 Ga0495636_0024033 3300047318 Bacteria 2469
241 Ga0495636_0063480 3300047318 Bacteria 1565
242 Ga0495684_0232726 3300047471 Unclassified 1347
243 Ga0496108_0100340 3300048911 Bacteria 2469
244 Ga0496109_0300703 3300048912 Bacteria 1513
245 Ga0496111_0080601 3300048914 Bacteria 2375
246 Ga0496112_0244461 3300048915 Bacteria 1747
247 Ga0496113_0279910 3300048916 Unclassified 1334
248 Ga0501031_0210420 3300049568 Unclassified 1267
249 Ga0501033_0045153 3300049570 Unclassified 3280
250 Ga0501036_0204742 3300049572 Bacteria 1659
251 Ga0501038_0153122 3300049574 Bacteria 1879
252 Ga0501040_0010560 3300049576 Bacteria 6039
253 Ga0501040_0028711 3300049576 Bacteria 3751
254 Ga0501041_0004446 3300049577 Bacteria 8115
255 Ga0501042_0131866 3300049578 Unclassified 1801
256 Ga0501046_0201394 3300049580 Unclassified 1481
257 Ga0501071_0011522 3300049587 Bacteria 5963
258 Ga0501071_0186256 3300049587 Bacteria 1556
259 Ga0501072_0012296 3300049588 Bacteria 6542
260 Ga0501072_0035883 3300049588 Bacteria 3886
261 Ga0501074_0114888 3300049590 Bacteria 1926
262 Ga0501074_0320993 3300049590 Bacteria 1100
263 Ga0501075_0005690 3300049591 Bacteria 8531
264 Ga0501075_0079522 3300049591 Unclassified 2481
265 Ga0501075_0140530 3300049591 Bacteria 1840
266 Ga0501075_0325894 3300049591 Unclassified 1170
267 Ga0501076_0021799 3300049592 Bacteria 4918
268 Ga0501076_0045850 3300049592 Bacteria 3452
269 Ga0501076_0078450 3300049592 Bacteria 2650
270 Ga0501077_0329367 3300049593 Bacteria 974
271 Ga0501079_0021144 3300049741 Bacteria 4975
272 Ga0501079_0092136 3300049741 Bacteria 2348
273 Ga0501080_0348361 3300049742 Bacteria 1338
274 Ga0501081_0046758 3300049743 Bacteria 2976
275 Ga0501081_0118403 3300049743 Bacteria 1884
276 Ga0501083_0357005 3300049744 Unclassified 950
277 nmdc:mga05p37_119363_c1 3300050507 Unclassified 3240
278 nmdc:mga05p37_129510_c1 3300050507 Bacteria 3096
279 nmdc:mga05p37_148302_c1 3300050507 Bacteria 2871
280 nmdc:mga05p37_15595_c1 3300050507 Bacteria 9132
281 nmdc:mga05p37_158600_c1 3300050507 Bacteria 2764
282 nmdc:mga05p37_29057_c1 3300050507 Bacteria 6747
283 nmdc:mga05p37_302145_c1 3300050507 Unclassified 1901
284 nmdc:mga05p37_34108_c1 3300050507 Bacteria 6234
285 nmdc:mga05p37_346219_c1 3300050507 Unclassified 1751
286 nmdc:mga05p37_377819_c1 3300050507 Bacteria 1661
287 nmdc:mga05p37_9516_c1 3300050507 Bacteria 11506
288 nmdc:mga09592_105779_c1 3300050508 Bacteria 2413
289 nmdc:mga09592_567201_c1 3300050508 Unclassified 974
290 nmdc:mga09592_80642_c1 3300050508 Bacteria 2771
291 nmdc:mga0qj67_12453_c1 3300050509 Bacteria 6407
292 nmdc:mga06r32_287048_c1 3300050510 Bacteria 1632
293 nmdc:mga06r32_45002_c1 3300050510 Bacteria 4206
294 nmdc:mga08y16_174834_c1 3300050511 Bacteria 2230
295 nmdc:mga08y16_2170_c1 3300050511 Bacteria 20129
296 nmdc:mga08y16_330835_c1 3300050511 Bacteria 1567
297 nmdc:mga08y16_58165_c1 3300050511 Bacteria 4039
298 nmdc:mga0n895_168176_c1 3300050512 Bacteria 2224
299 nmdc:mga0n895_200773_c1 3300050512 Bacteria 2025
300 nmdc:mga0n895_59997_c1 3300050512 Bacteria 3753
301 nmdc:mga0rr50_163707_c1 3300050513 Bacteria 1807
302 nmdc:mga08x19_110755_c1 3300050514 Bacteria 1831
303 nmdc:mga0a205_231018_c1 3300050515 Bacteria 1733
304 nmdc:mga0a205_289227_c1 3300050515 Unclassified 1513
305 nmdc:mga0a205_387444_c1 3300050515 Bacteria 1262
306 nmdc:mga0a205_424792_c1 3300050515 Unclassified 1191
307 nmdc:mga0a205_56636_c2 3300050515 Bacteria 2108
308 nmdc:mga0a205_59789_c1 3300050515 Bacteria 3681
309 nmdc:mga0a205_91433_c1 3300050515 Unclassified 2940
310 Ga0495601_0155488 3300053077 Unclassified 1493
311 Ga0495612_0016893 3300053078 Unclassified 2924
312 Ga0495619_0024320 3300053085 Bacteria 3884
313 Ga0501084_0009551 3300054114 Bacteria 8029
314 Ga0501084_0028923 3300054114 Bacteria 4633
315 Ga0501084_0115230 3300054114 Bacteria 2259
316 Ga0501082_0013035 3300060353 Bacteria 7145
317 Ga0501082_0133565 3300060353 Bacteria 2153
318 Ga0530510_0007251 3300061734 Bacteria 7714
319 Ga0530510_0016901 3300061734 Bacteria 5168
320 Ga0530510_0026845 3300061734 Bacteria 4125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046615 Ga0495656_0129991 Ga0495656_0129991_19_789 218
2 3300049574 Ga0501038_0153122 Ga0501038_0153122_52_732 224
3 3300049741 Ga0501079_0092136 Ga0501079_0092136_49_738 224
4 3300035725 Ga0373947_0178575 Ga0373947_0178575_47_847 226
5 3300037068 Ga0373925_0191893 Ga0373925_0191893_287_1087 226
6 3300035170 Ga0373943_0247279 Ga0373943_0247279_227_973 232
7 3300005549 Ga0070704_100158181 Ga0070704_1001581812 233
8 3300025923 Ga0207681_10595499 Ga0207681_105954991 233
9 3300048912 Ga0496109_0300703 Ga0496109_0300703_729_1436 233
10 3300046529 Ga0495652_0356660 Ga0495652_0356660_196_999 242
11 3300046536 Ga0495587_0023982 Ga0495587_0023982_2032_2835 242
12 3300046680 Ga0495646_0196924 Ga0495646_0196924_190_993 242
13 3300053077 Ga0495601_0155488 Ga0495601_0155488_392_1195 242
14 3300053085 Ga0495619_0024320 Ga0495619_0024320_332_1135 242
15 3300005293 Ga0065715_10179374 Ga0065715_101793741 243
16 3300005564 Ga0070664_100130614 Ga0070664_1001306143 246
17 3300025945 Ga0207679_10216405 Ga0207679_102164051 246
18 3300046454 Ga0495592_0171039 Ga0495592_0171039_701_1447 246
19 3300049593 Ga0501077_0329367 Ga0501077_0329367_103_906 246
20 3300005337 Ga0070682_100408709 Ga0070682_1004087091 247
21 3300005471 Ga0070698_100180635 Ga0070698_1001806352 247
22 3300048915 Ga0496112_0244461 Ga0496112_0244461_522_1328 247
23 3300005468 Ga0070707_100557554 Ga0070707_1005575541 248
24 3300006237 Ga0097621_100064686 Ga0097621_1000646862 248
25 3300006852 Ga0075433_10071703 Ga0075433_100717033 248
26 3300009147 Ga0114129_10002873 Ga0114129_100028734 248
27 3300009177 Ga0105248_10048213 Ga0105248_100482133 248
28 3300025941 Ga0207711_10052978 Ga0207711_100529783 248
29 3300035691 Ga0373931_0083564 Ga0373931_0083564_930_1757 248
30 3300045051 Ga0451576_0042570 Ga0451576_0042570_3254_4081 248
31 3300050507 nmdc:mga05p37_9516_c1 nmdc:mga05p37_9516_c1_7915_8727 248
32 3300050515 nmdc:mga0a205_91433_c1 nmdc:mga0a205_91433_c1_52_864 248
33 3300005518 Ga0070699_100090536 Ga0070699_1000905362 249
34 3300014969 Ga0157376_10136420 Ga0157376_101364202 249
35 3300009148 Ga0105243_10691030 Ga0105243_106910301 250
36 3300009177 Ga0105248_10180287 Ga0105248_101802872 250
37 3300025941 Ga0207711_10031779 Ga0207711_100317792 250
38 3300053078 Ga0495612_0016893 Ga0495612_0016893_1510_2310 250
39 3300006852 Ga0075433_10103039 Ga0075433_101030392 251
40 3300006871 Ga0075434_100007675 Ga0075434_1000076754 251
41 3300006871 Ga0075434_100113889 Ga0075434_1001138891 251
42 3300009147 Ga0114129_10260809 Ga0114129_102608092 251
43 3300044673 Ga0453683_0190965 Ga0453683_0190965_378_1205 251
44 3300046664 Ga0495659_0002279 Ga0495659_0002279_1518_2345 251
45 3300049576 Ga0501040_0010560 Ga0501040_0010560_3505_4308 251
46 3300049587 Ga0501071_0011522 Ga0501071_0011522_2668_3471 251
47 3300049590 Ga0501074_0320993 Ga0501074_0320993_109_912 251
48 3300049591 Ga0501075_0005690 Ga0501075_0005690_3456_4259 251
49 3300049592 Ga0501076_0021799 Ga0501076_0021799_888_1691 251
50 3300050507 nmdc:mga05p37_29057_c1 nmdc:mga05p37_29057_c1_1059_1886 251
51 3300050512 nmdc:mga0n895_168176_c1 nmdc:mga0n895_168176_c1_87_923 251
52 3300050515 nmdc:mga0a205_231018_c1 nmdc:mga0a205_231018_c1_734_1561 251
53 3300054114 Ga0501084_0009551 Ga0501084_0009551_5226_6029 251
54 3300060353 Ga0501082_0013035 Ga0501082_0013035_4238_5041 251
55 3300061734 Ga0530510_0016901 Ga0530510_0016901_3337_4140 251
56 3300003203 JGI25406J46586_10004292 JGI25406J46586_100042923 252
57 3300005985 Ga0081539_10000090 Ga0081539_1000009072 252
58 3300005354 Ga0070675_100248815 Ga0070675_1002488152 253
59 3300005355 Ga0070671_100017672 Ga0070671_1000176721 253
60 3300005543 Ga0070672_100104228 Ga0070672_1001042282 253
61 3300006358 Ga0068871_100051841 Ga0068871_1000518413 253
62 3300009147 Ga0114129_10423423 Ga0114129_104234232 253
63 3300013297 Ga0157378_10264151 Ga0157378_102641512 253
64 3300025940 Ga0207691_10250180 Ga0207691_102501802 253
65 3300026088 Ga0207641_10044411 Ga0207641_100444112 253
66 3300026121 Ga0207683_10363910 Ga0207683_103639101 253
67 3300045051 Ga0451576_0838908 Ga0451576_0838908_106_933 253
68 3300046558 Ga0495633_0058741 Ga0495633_0058741_681_1508 253
69 3300046684 Ga0495669_0006951 Ga0495669_0006951_2442_3269 253
70 3300050507 nmdc:mga05p37_346219_c1 nmdc:mga05p37_346219_c1_589_1353 253
71 3300009147 Ga0114129_10017762 Ga0114129_100177626 254
72 3300009147 Ga0114129_10090105 Ga0114129_100901052 254
73 3300046525 Ga0495663_0124844 Ga0495663_0124844_11_778 254
74 3300046664 Ga0495659_0006091 Ga0495659_0006091_2680_3447 254
75 3300050507 nmdc:mga05p37_34108_c1 nmdc:mga05p37_34108_c1_196_963 254
76 3300050507 nmdc:mga05p37_377819_c1 nmdc:mga05p37_377819_c1_343_1110 254
77 3300050508 nmdc:mga09592_567201_c1 nmdc:mga09592_567201_c1_133_900 254
78 3300050510 nmdc:mga06r32_287048_c1 nmdc:mga06r32_287048_c1_808_1575 254
79 3300005841 Ga0068863_100285799 Ga0068863_1002857992 255
80 3300006852 Ga0075433_10527253 Ga0075433_105272531 255
81 3300049591 Ga0501075_0140530 Ga0501075_0140530_89_886 255
82 3300049743 Ga0501081_0118403 Ga0501081_0118403_917_1696 255
83 3300060353 Ga0501082_0133565 Ga0501082_0133565_572_1351 255
84 3300006852 Ga0075433_10128781 Ga0075433_101287812 256
85 3300006880 Ga0075429_100220132 Ga0075429_1002201322 256
86 3300009147 Ga0114129_10007966 Ga0114129_100079668 256
87 3300009147 Ga0114129_10033176 Ga0114129_100331763 256
88 3300049568 Ga0501031_0210420 Ga0501031_0210420_443_1252 256
89 3300049588 Ga0501072_0035883 Ga0501072_0035883_155_964 256
90 3300049591 Ga0501075_0325894 Ga0501075_0325894_137_946 256
91 3300049592 Ga0501076_0045850 Ga0501076_0045850_2005_2814 256
92 3300049741 Ga0501079_0021144 Ga0501079_0021144_1328_2137 256
93 3300049744 Ga0501083_0357005 Ga0501083_0357005_122_931 256
94 3300050507 nmdc:mga05p37_148302_c1 nmdc:mga05p37_148302_c1_1253_2053 256
95 3300050507 nmdc:mga05p37_15595_c1 nmdc:mga05p37_15595_c1_278_1117 256
96 3300050508 nmdc:mga09592_80642_c1 nmdc:mga09592_80642_c1_1861_2661 256
97 3300050515 nmdc:mga0a205_59789_c1 nmdc:mga0a205_59789_c1_1283_2122 256
98 3300054114 Ga0501084_0115230 Ga0501084_0115230_1418_2227 256
99 3300061734 Ga0530510_0026845 Ga0530510_0026845_1025_1834 256
100 3300005367 Ga0070667_100179177 Ga0070667_1001791773 257
101 3300005445 Ga0070708_100588490 Ga0070708_1005884901 257
102 3300005467 Ga0070706_100099753 Ga0070706_1000997532 257
103 3300005471 Ga0070698_100181365 Ga0070698_1001813652 257
104 3300005618 Ga0068864_100042576 Ga0068864_1000425762 257
105 3300036401 Ga0373937_0212826 Ga0373937_0212826_38_817 257
106 3300046528 Ga0495642_0004165 Ga0495642_0004165_2215_3036 257
107 3300047471 Ga0495684_0232726 Ga0495684_0232726_30_809 257
108 3300005445 Ga0070708_100069018 Ga0070708_1000690184 258
109 3300005468 Ga0070707_100174307 Ga0070707_1001743073 258
110 3300005471 Ga0070698_100317999 Ga0070698_1003179992 258
111 3300006852 Ga0075433_10271748 Ga0075433_102717481 258
112 3300009147 Ga0114129_10119472 Ga0114129_101194724 258
113 3300025942 Ga0207689_10068450 Ga0207689_100684502 258
114 3300042437 Ga0439444_0016003 Ga0439444_0016003_416_1225 258
115 3300046691 Ga0495670_0245031 Ga0495670_0245031_127_909 258
116 3300050507 nmdc:mga05p37_119363_c1 nmdc:mga05p37_119363_c1_1372_2172 258
117 3300050515 nmdc:mga0a205_289227_c1 nmdc:mga0a205_289227_c1_247_1047 258
118 3300005444 Ga0070694_100184891 Ga0070694_1001848912 259
119 3300005842 Ga0068858_100004314 Ga0068858_1000043149 259
120 3300009094 Ga0111539_10006795 Ga0111539_1000679512 259
121 3300009101 Ga0105247_10006313 Ga0105247_100063135 259
122 3300026035 Ga0207703_10068282 Ga0207703_100682822 259
123 3300027907 Ga0207428_10000890 Ga0207428_1000089027 259
124 3300046691 Ga0495670_0193125 Ga0495670_0193125_176_973 259
125 3300050511 nmdc:mga08y16_2170_c1 nmdc:mga08y16_2170_c1_7351_8145 259
126 3300005295 Ga0065707_10246082 Ga0065707_102460821 260
127 3300005334 Ga0068869_100187793 Ga0068869_1001877932 260
128 3300005340 Ga0070689_100044920 Ga0070689_1000449202 260
129 3300005341 Ga0070691_10044529 Ga0070691_100445292 260
130 3300005343 Ga0070687_100011022 Ga0070687_1000110221 260
131 3300005343 Ga0070687_100059875 Ga0070687_1000598752 260
132 3300005347 Ga0070668_100011905 Ga0070668_1000119051 260
133 3300005353 Ga0070669_100003406 Ga0070669_1000034065 260
134 3300005354 Ga0070675_100013113 Ga0070675_1000131132 260
135 3300005354 Ga0070675_100172591 Ga0070675_1001725912 260
136 3300005365 Ga0070688_100086267 Ga0070688_1000862672 260
137 3300005366 Ga0070659_100302317 Ga0070659_1003023172 260
138 3300005440 Ga0070705_100004053 Ga0070705_1000040532 260
139 3300005440 Ga0070705_100075851 Ga0070705_1000758512 260
140 3300005440 Ga0070705_100428478 Ga0070705_1004284781 260
141 3300005441 Ga0070700_100175739 Ga0070700_1001757392 260
142 3300005444 Ga0070694_100000629 Ga0070694_10000062911 260
143 3300005444 Ga0070694_100009071 Ga0070694_1000090712 260
144 3300005444 Ga0070694_100045277 Ga0070694_1000452772 260
145 3300005456 Ga0070678_100646069 Ga0070678_1006460691 260
146 3300005457 Ga0070662_100067817 Ga0070662_1000678172 260
147 3300005458 Ga0070681_10176734 Ga0070681_101767342 260
148 3300005459 Ga0068867_100001524 Ga0068867_1000015242 260
149 3300005466 Ga0070685_10104317 Ga0070685_101043172 260
150 3300005467 Ga0070706_100089882 Ga0070706_1000898822 260
151 3300005471 Ga0070698_100007952 Ga0070698_1000079526 260
152 3300005518 Ga0070699_100033413 Ga0070699_1000334132 260
153 3300005530 Ga0070679_100501219 Ga0070679_1005012192 260
154 3300005536 Ga0070697_100166382 Ga0070697_1001663822 260
155 3300005543 Ga0070672_100079018 Ga0070672_1000790182 260
156 3300005545 Ga0070695_100000112 Ga0070695_10000011219 260
157 3300005546 Ga0070696_100002188 Ga0070696_1000021888 260
158 3300005549 Ga0070704_100210657 Ga0070704_1002106572 260
159 3300005577 Ga0068857_100008228 Ga0068857_1000082286 260
160 3300005615 Ga0070702_100062665 Ga0070702_1000626652 260
161 3300005617 Ga0068859_100035274 Ga0068859_1000352742 260
162 3300005617 Ga0068859_100039063 Ga0068859_1000390632 260
163 3300005617 Ga0068859_100686895 Ga0068859_1006868952 260
164 3300005618 Ga0068864_100029950 Ga0068864_1000299502 260
165 3300005719 Ga0068861_100073776 Ga0068861_1000737762 260
166 3300005842 Ga0068858_100028516 Ga0068858_1000285162 260
167 3300005843 Ga0068860_100009836 Ga0068860_1000098365 260
168 3300006846 Ga0075430_100002230 Ga0075430_1000022302 260
169 3300006847 Ga0075431_100022999 Ga0075431_1000229992 260
170 3300006880 Ga0075429_100147877 Ga0075429_1001478772 260
171 3300006931 Ga0097620_100035276 Ga0097620_1000352762 260
172 3300006931 Ga0097620_100039063 Ga0097620_1000390632 260
173 3300006931 Ga0097620_100686982 Ga0097620_1006869822 260
174 3300007076 Ga0075435_100124860 Ga0075435_1001248602 260
175 3300009094 Ga0111539_10085845 Ga0111539_100858452 260
176 3300009094 Ga0111539_10185836 Ga0111539_101858362 260
177 3300009094 Ga0111539_10262041 Ga0111539_102620412 260
178 3300009147 Ga0114129_10208022 Ga0114129_102080222 260
179 3300009147 Ga0114129_10282084 Ga0114129_102820841 260
180 3300009553 Ga0105249_10032298 Ga0105249_100322982 260
181 3300013306 Ga0163162_10188902 Ga0163162_101889021 260
182 3300013308 Ga0157375_10002807 Ga0157375_100028072 260
183 3300014326 Ga0157380_10096409 Ga0157380_100964092 260
184 3300014745 Ga0157377_10013794 Ga0157377_100137942 260
185 3300014745 Ga0157377_10017255 Ga0157377_100172553 260
186 3300014969 Ga0157376_10068439 Ga0157376_100684392 260
187 3300025885 Ga0207653_10050623 Ga0207653_100506232 260
188 3300025918 Ga0207662_10005392 Ga0207662_100053923 260
189 3300025918 Ga0207662_10018217 Ga0207662_100182173 260
190 3300025923 Ga0207681_10002961 Ga0207681_100029616 260
191 3300025926 Ga0207659_10038029 Ga0207659_100380293 260
192 3300025933 Ga0207706_10052012 Ga0207706_100520122 260
193 3300025936 Ga0207670_10081531 Ga0207670_100815312 260
194 3300025938 Ga0207704_10262819 Ga0207704_102628192 260
195 3300025940 Ga0207691_10023292 Ga0207691_100232922 260
196 3300025942 Ga0207689_10141377 Ga0207689_101413771 260
197 3300025986 Ga0207658_10100188 Ga0207658_101001881 260
198 3300026075 Ga0207708_10038248 Ga0207708_100382482 260
199 3300026089 Ga0207648_10003683 Ga0207648_100036834 260
200 3300026118 Ga0207675_100079755 Ga0207675_1000797552 260
201 3300027907 Ga0207428_10035516 Ga0207428_100355161 260
202 3300027907 Ga0207428_10139510 Ga0207428_101395102 260
203 3300027907 Ga0207428_10317231 Ga0207428_103172311 260
204 3300028380 Ga0268265_10004223 Ga0268265_100042233 260
205 3300028381 Ga0268264_10003233 Ga0268264_100032336 260
206 3300046664 Ga0495659_0002611 Ga0495659_0002611_4455_5285 260
207 3300046664 Ga0495659_0031720 Ga0495659_0031720_969_1796 260
208 3300046664 Ga0495659_0100803 Ga0495659_0100803_27_854 260
209 3300046684 Ga0495669_0060202 Ga0495669_0060202_85_912 260
210 3300047318 Ga0495636_0024033 Ga0495636_0024033_443_1273 260
211 3300047318 Ga0495636_0063480 Ga0495636_0063480_667_1494 260
212 3300049570 Ga0501033_0045153 Ga0501033_0045153_1764_2582 260
213 3300049572 Ga0501036_0204742 Ga0501036_0204742_625_1443 260
214 3300049576 Ga0501040_0028711 Ga0501040_0028711_1744_2562 260
215 3300049577 Ga0501041_0004446 Ga0501041_0004446_5977_6795 260
216 3300049578 Ga0501042_0131866 Ga0501042_0131866_17_835 260
217 3300049580 Ga0501046_0201394 Ga0501046_0201394_555_1373 260
218 3300049587 Ga0501071_0186256 Ga0501071_0186256_173_991 260
219 3300049588 Ga0501072_0012296 Ga0501072_0012296_4401_5219 260
220 3300049590 Ga0501074_0114888 Ga0501074_0114888_668_1486 260
221 3300049591 Ga0501075_0079522 Ga0501075_0079522_904_1722 260
222 3300049592 Ga0501076_0078450 Ga0501076_0078450_1555_2373 260
223 3300049742 Ga0501080_0348361 Ga0501080_0348361_427_1245 260
224 3300049743 Ga0501081_0046758 Ga0501081_0046758_1738_2556 260
225 3300050507 nmdc:mga05p37_158600_c1 nmdc:mga05p37_158600_c1_1230_2060 260
226 3300050507 nmdc:mga05p37_302145_c1 nmdc:mga05p37_302145_c1_23_850 260
227 3300050508 nmdc:mga09592_105779_c1 nmdc:mga09592_105779_c1_475_1302 260
228 3300050509 nmdc:mga0qj67_12453_c1 nmdc:mga0qj67_12453_c1_5526_6353 260
229 3300050510 nmdc:mga06r32_45002_c1 nmdc:mga06r32_45002_c1_2087_2914 260
230 3300050511 nmdc:mga08y16_330835_c1 nmdc:mga08y16_330835_c1_505_1332 260
231 3300050515 nmdc:mga0a205_56636_c2 nmdc:mga0a205_56636_c2_577_1407 260
232 3300054114 Ga0501084_0028923 Ga0501084_0028923_2495_3313 260
233 3300061734 Ga0530510_0007251 Ga0530510_0007251_4327_5145 260
234 3300005293 Ga0065715_10020194 Ga0065715_100201942 261
235 3300005334 Ga0068869_100106040 Ga0068869_1001060402 261
236 3300005468 Ga0070707_100224264 Ga0070707_1002242642 261
237 3300005518 Ga0070699_100090199 Ga0070699_1000901991 261
238 3300005617 Ga0068859_100603002 Ga0068859_1006030022 261
239 3300005840 Ga0068870_10335115 Ga0068870_103351152 261
240 3300006844 Ga0075428_100433126 Ga0075428_1004331262 261
241 3300006931 Ga0097620_100603121 Ga0097620_1006031212 261
242 3300009094 Ga0111539_10024849 Ga0111539_1002484911 261
243 3300009553 Ga0105249_10775660 Ga0105249_107756601 261
244 3300046491 Ga0495584_0185527 Ga0495584_0185527_208_1008 261
245 3300050511 nmdc:mga08y16_58165_c1 nmdc:mga08y16_58165_c1_1754_2548 261
246 3300005295 Ga0065707_10189734 Ga0065707_101897342 262
247 3300005335 Ga0070666_10094072 Ga0070666_100940722 262
248 3300005439 Ga0070711_100119356 Ga0070711_1001193562 262
249 3300005441 Ga0070700_100440505 Ga0070700_1004405051 262
250 3300005445 Ga0070708_100287776 Ga0070708_1002877762 262
251 3300005445 Ga0070708_100337957 Ga0070708_1003379572 262
252 3300005467 Ga0070706_100190008 Ga0070706_1001900082 262
253 3300005468 Ga0070707_100004319 Ga0070707_10000431911 262
254 3300005468 Ga0070707_100335937 Ga0070707_1003359372 262
255 3300005471 Ga0070698_100006218 Ga0070698_1000062188 262
256 3300005471 Ga0070698_100031341 Ga0070698_1000313412 262
257 3300005518 Ga0070699_100001931 Ga0070699_10000193118 262
258 3300005548 Ga0070665_100262753 Ga0070665_1002627532 262
259 3300005549 Ga0070704_100012749 Ga0070704_1000127492 262
260 3300005719 Ga0068861_100251987 Ga0068861_1002519872 262
261 3300005985 Ga0081539_10001115 Ga0081539_1000111541 262
262 3300005985 Ga0081539_10126887 Ga0081539_101268872 262
263 3300006844 Ga0075428_100318313 Ga0075428_1003183132 262
264 3300006852 Ga0075433_10384014 Ga0075433_103840142 262
265 3300006871 Ga0075434_100004491 Ga0075434_1000044913 262
266 3300006871 Ga0075434_100088953 Ga0075434_1000889532 262
267 3300006880 Ga0075429_100398590 Ga0075429_1003985902 262
268 3300006914 Ga0075436_100123135 Ga0075436_1001231351 262
269 3300009094 Ga0111539_10562554 Ga0111539_105625542 262
270 3300009147 Ga0114129_10343238 Ga0114129_103432383 262
271 3300009147 Ga0114129_10376471 Ga0114129_103764712 262
272 3300014326 Ga0157380_10013955 Ga0157380_100139552 262
273 3300025910 Ga0207684_10158265 Ga0207684_101582652 262
274 3300025916 Ga0207663_10091071 Ga0207663_100910711 262
275 3300025922 Ga0207646_10008304 Ga0207646_100083046 262
276 3300025922 Ga0207646_10061855 Ga0207646_100618552 262
277 3300025922 Ga0207646_10095098 Ga0207646_100950982 262
278 3300025933 Ga0207706_10397884 Ga0207706_103978842 262
279 3300025941 Ga0207711_10081306 Ga0207711_100813062 262
280 3300026075 Ga0207708_10006020 Ga0207708_100060205 262
281 3300026121 Ga0207683_10145477 Ga0207683_101454772 262
282 3300028379 Ga0268266_10190114 Ga0268266_101901142 262
283 3300028380 Ga0268265_10467943 Ga0268265_104679432 262
284 3300045976 Ga0466967_0289258 Ga0466967_0289258_20_859 262
285 3300046539 Ga0495621_0049250 Ga0495621_0049250_28_828 262
286 3300046664 Ga0495659_0108463 Ga0495659_0108463_182_982 262
287 3300050507 nmdc:mga05p37_129510_c1 nmdc:mga05p37_129510_c1_688_1488 262
288 3300050511 nmdc:mga08y16_174834_c1 nmdc:mga08y16_174834_c1_1003_1806 262
289 3300050512 nmdc:mga0n895_59997_c1 nmdc:mga0n895_59997_c1_2897_3697 262
290 3300050514 nmdc:mga08x19_110755_c1 nmdc:mga08x19_110755_c1_840_1640 262
291 3300050515 nmdc:mga0a205_387444_c1 nmdc:mga0a205_387444_c1_383_1183 262
292 3300050515 nmdc:mga0a205_424792_c1 nmdc:mga0a205_424792_c1_270_1070 262
293 3300005347 Ga0070668_100534405 Ga0070668_1005344051 263
294 3300005617 Ga0068859_100022461 Ga0068859_1000224612 263
295 3300006847 Ga0075431_100460360 Ga0075431_1004603602 263
296 3300006931 Ga0097620_100022461 Ga0097620_1000224618 263
297 3300026118 Ga0207675_100289504 Ga0207675_1002895042 263
298 3300048911 Ga0496108_0100340 Ga0496108_0100340_369_1160 263
299 3300048914 Ga0496111_0080601 Ga0496111_0080601_1089_1880 263
300 3300005545 Ga0070695_100292059 Ga0070695_1002920591 265
301 3300006871 Ga0075434_100209574 Ga0075434_1002095742 265
302 3300014326 Ga0157380_10248186 Ga0157380_102481861 265
303 3300035692 Ga0373935_0249749 Ga0373935_0249749_91_891 265
304 3300046539 Ga0495621_0018160 Ga0495621_0018160_767_1636 265
305 3300050512 nmdc:mga0n895_200773_c1 nmdc:mga0n895_200773_c1_926_1741 265
306 3300050513 nmdc:mga0rr50_163707_c1 nmdc:mga0rr50_163707_c1_946_1761 265
307 3300002459 JGI24751J29686_10004248 JGI24751J29686_100042482 266
308 3300005344 Ga0070661_100106542 Ga0070661_1001065422 266
309 3300005366 Ga0070659_100022118 Ga0070659_1000221183 266
310 3300005458 Ga0070681_10002151 Ga0070681_100021513 266
311 3300005530 Ga0070679_100060879 Ga0070679_1000608793 266
312 3300006871 Ga0075434_100296425 Ga0075434_1002964252 266
313 3300011119 Ga0105246_10081276 Ga0105246_100812763 266
314 3300013307 Ga0157372_10233828 Ga0157372_102338282 266
315 3300025912 Ga0207707_10048957 Ga0207707_100489572 266
316 3300025920 Ga0207649_10223531 Ga0207649_102235312 266
317 3300025921 Ga0207652_10319198 Ga0207652_103191982 266
318 3300025961 Ga0207712_10192074 Ga0207712_101920742 266
319 3300028380 Ga0268265_10132529 Ga0268265_101325292 266
320 3300048916 Ga0496113_0279910 Ga0496113_0279910_427_1227 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

149

281

0.9

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

210

277

0.88

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

60

133

0.85

PF00034

Cytochrom_C

Cytochrome c

62

137

0.78

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

147

206

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c90-assembly1.cif.gz_C crystal structure of cytochrome cl from the marine methylotrophic bacterium methylophaga aminisulfidivorans mpt (ma-cytcl) 0.9117 29 112
6tfl-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8626 183 227
2c8s-assembly1.cif.gz_A cytochrome cl from methylobacterium extorquens 0.8606 32 117
1c75-assembly1.cif.gz_A "0.97 a ""ab initio"" crystal structure of cytochrome c-553 from bacillus pasteurii" 0.8578 44 110
1k3g-assembly1.cif.gz_A nmr solution structure of oxidized cytochrome c-553 from bacillus pasteurii 0.8552 42 112
ID Description Score Start End Superfamily
af_Q7JPE3_651_806_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.927 196 219 3.40.1110.10
2c8sA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8606 32 117 1.10.760.10
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8552 42 112 1.10.760.10
af_P9WGY9_643_706_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8539 196 219 2.40.50.100
af_A4HRD7_2_71_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8509 182 229 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A2V8HH65-F1-model_v4 Cytochrome c domain-containing protein 0.8987 24 260 GO:0009055
GO:0020037
GO:0046872
AF-A0A7Y5MPL0-F1-model_v4 C-type cytochrome 0.8911 123 255 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V8KT35-F1-model_v4 Cytochrome c domain-containing protein 0.8825 21 134 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A517TZA8-F1-model_v4 Cytochrome c 0.882 123 255 GO:0009055
GO:0020037
GO:0046872
AF-A0A7V3RSZ9-F1-model_v4 C-type cytochrome 0.8795 123 255 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
78.1 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map