F405702

General Info

Members Datasets Scaffolds Average Seq Length
320 194 640 285

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0371391|Ga0496106_0371391_110_1081
Length 323
Sequence MLAAAREIAAGLTPPHRLYINDHRPSRSCMTAINAGQAEVHLPQGTIRYRDAGSGEPIVFVHGLLVNGALWRKVTPLLEGKHRCIVPDLPLGSHRIPMEAGADLSPPGVARLISDFLDALELDVVTLVGNDTGGAICQLVAAHHPERLGRLVLTPCDAYENFLPPAFRPLQYGAHVPGLITALIQAARIGAIRRGPLGFGLLIKRRPMDDEALRGYLAPFLADHGVRRDALKVLRGISNRQTIEAAERLRRFDRPTLIAWAPEDRFFKLRFGERLASDIPNARLVRIEDSLTFVPEDQPERLAEEIAEFITETKESAGAVSSK

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
192 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
193 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
194 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 15.31
Rhizosphere 79.06
Stem 0
Stem Tuber 0
Unclassified 3.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0371391 3300048909 Bacteria 1149
2 Ga0070683_100030457 3300005329 Bacteria 4899
3 Ga0070670_100166918 3300005331 Bacteria 1909
4 Ga0070682_100001319 3300005337 Bacteria 14039
5 Ga0070682_100005699 3300005337 Bacteria 6940
6 Ga0070682_100036113 3300005337 Bacteria 3020
7 Ga0068868_100000264 3300005338 Bacteria 35465
8 Ga0068868_100061069 3300005338 Bacteria 2985
9 Ga0068868_100166295 3300005338 Bacteria 1824
10 Ga0070661_100000599 3300005344 Bacteria 26985
11 Ga0070661_100025647 3300005344 Bacteria 4238
12 Ga0070668_100024433 3300005347 Bacteria 4579
13 Ga0070668_100257969 3300005347 Bacteria 1449
14 Ga0070675_100000053 3300005354 Bacteria 70601
15 Ga0070671_100028943 3300005355 Bacteria 4566
16 Ga0070674_100019963 3300005356 Bacteria 4270
17 Ga0070674_100039482 3300005356 Bacteria 3188
18 Ga0070673_100174201 3300005364 Bacteria 1838
19 Ga0070688_100000012 3300005365 Bacteria 79406
20 Ga0070688_100000492 3300005365 Bacteria 20007
21 Ga0070659_100018042 3300005366 Bacteria 5321
22 Ga0070659_100087543 3300005366 Bacteria 2494
23 Ga0070709_10026286 3300005434 Bacteria 3449
24 Ga0070714_100085505 3300005435 Bacteria 2755
25 Ga0070714_100206768 3300005435 Bacteria 1798
26 Ga0070713_100000009 3300005436 Bacteria 153056
27 Ga0070713_100112169 3300005436 Bacteria 2379
28 Ga0070713_100249317 3300005436 Bacteria 1619
29 Ga0070711_100003694 3300005439 Bacteria 8959
30 Ga0070711_100028605 3300005439 Bacteria 3669
31 Ga0070711_100129564 3300005439 Bacteria 1877
32 Ga0070711_100145345 3300005439 Bacteria 1783
33 Ga0070663_100033074 3300005455 Bacteria 3569
34 Ga0070678_100012815 3300005456 Bacteria 5229
35 Ga0070662_100056007 3300005457 Bacteria 2862
36 Ga0070681_10521223 3300005458 Bacteria 1102
37 Ga0070685_10000018 3300005466 Bacteria 110132
38 Ga0070685_10000460 3300005466 Bacteria 23676
39 Ga0070685_10102840 3300005466 Bacteria 1747
40 Ga0070685_10391096 3300005466 Bacteria 961
41 Ga0070684_100001296 3300005535 Bacteria 17931
42 Ga0070684_100080220 3300005535 Bacteria 2887
43 Ga0068853_100013514 3300005539 Bacteria 6669
44 Ga0068853_100015679 3300005539 Bacteria 6223
45 Ga0068853_100248393 3300005539 Bacteria 1632
46 Ga0070672_100000030 3300005543 Bacteria 62612
47 Ga0070672_100222615 3300005543 Bacteria 1583
48 Ga0070686_100245906 3300005544 Bacteria 1304
49 Ga0070695_100277891 3300005545 Bacteria 1229
50 Ga0070704_100014804 3300005549 Bacteria 4880
51 Ga0070704_100036252 3300005549 Bacteria 3359
52 Ga0070664_100035350 3300005564 Bacteria 4195
53 Ga0068857_100137883 3300005577 Bacteria 2204
54 Ga0068854_100000031 3300005578 Bacteria 107298
55 Ga0068856_100005853 3300005614 Bacteria 12117
56 Ga0068856_100006734 3300005614 Bacteria 11259
57 Ga0068852_100000012 3300005616 Bacteria 140734
58 Ga0068852_100039820 3300005616 Bacteria 3960
59 Ga0068864_100008506 3300005618 Bacteria 8468
60 Ga0068866_10055378 3300005718 Bacteria 2036
61 Ga0068866_10106358 3300005718 Bacteria 1557
62 Ga0068851_10000333 3300005834 Bacteria 21364
63 Ga0068851_10035845 3300005834 Bacteria 2482
64 Ga0068862_100252960 3300005844 Bacteria 1606
65 Ga0081455_10005991 3300005937 Bacteria 13183
66 Ga0081455_10011106 3300005937 Bacteria 9065
67 Ga0081455_10021847 3300005937 Bacteria 5994
68 Ga0081455_10027598 3300005937 Bacteria 5202
69 Ga0081455_10028155 3300005937 Bacteria 5137
70 Ga0081455_10049351 3300005937 Bacteria 3629
71 Ga0081538_10011997 3300005981 Bacteria 6981
72 Ga0081539_10011023 3300005985 Bacteria 7231
73 Ga0070717_10080680 3300006028 Bacteria 2730
74 Ga0075365_10000477 3300006038 Bacteria 15128
75 Ga0075365_10010102 3300006038 Bacteria 5476
76 Ga0075363_100151103 3300006048 Bacteria 1311
77 Ga0075363_100327686 3300006048 Unclassified 892
78 Ga0070716_100035034 3300006173 Bacteria 2757
79 Ga0070712_100002097 3300006175 Bacteria 12255
80 Ga0070712_100004037 3300006175 Bacteria 9007
81 Ga0070712_100010171 3300006175 Bacteria 5929
82 Ga0070712_100029532 3300006175 Bacteria 3676
83 Ga0075431_100000548 3300006847 Bacteria 31565
84 Ga0075431_100012056 3300006847 Bacteria 8724
85 Ga0075433_10071584 3300006852 Bacteria 3048
86 Ga0075433_10430602 3300006852 Unclassified 1163
87 Ga0068865_100000402 3300006881 Bacteria 24075
88 Ga0068865_100064509 3300006881 Bacteria 2578
89 Ga0075436_100025434 3300006914 Bacteria 4074
90 Ga0075436_100207900 3300006914 Unclassified 1387
91 Ga0075435_100344149 3300007076 Unclassified 1278
92 Ga0111539_10012827 3300009094 Bacteria 10490
93 Ga0111539_10427106 3300009094 Unclassified 1543
94 Ga0105245_10000180 3300009098 Bacteria 59695
95 Ga0105245_10004079 3300009098 Bacteria 12967
96 Ga0105245_10009667 3300009098 Bacteria 8411
97 Ga0105245_10017386 3300009098 Bacteria 6273
98 Ga0114129_10011633 3300009147 Bacteria 12527
99 Ga0114129_10179675 3300009147 Bacteria 2880
100 Ga0114129_10453157 3300009147 Bacteria 1682
101 Ga0105243_10059859 3300009148 Bacteria 3041
102 Ga0105243_10091921 3300009148 Bacteria 2500
103 Ga0105241_10040249 3300009174 Bacteria 3528
104 Ga0105242_10011988 3300009176 Bacteria 6675
105 Ga0105242_10109501 3300009176 Bacteria 2352
106 Ga0105248_10000118 3300009177 Bacteria 90018
107 Ga0105248_10036189 3300009177 Bacteria 5520
108 Ga0105237_10000733 3300009545 Bacteria 45233
109 Ga0105249_10037284 3300009553 Bacteria 4412
110 Ga0105249_10071152 3300009553 Bacteria 3213
111 Ga0105239_10033048 3300010375 Bacteria 5682
112 Ga0105246_10116040 3300011119 Bacteria 1976
113 Ga0157371_10200625 3300013102 Bacteria 1430
114 Ga0157370_10164185 3300013104 Bacteria 2066
115 Ga0157369_10000142 3300013105 Bacteria 101760
116 Ga0157369_10302248 3300013105 Bacteria 1664
117 Ga0157374_10020072 3300013296 Bacteria 5925
118 Ga0157378_10019730 3300013297 Bacteria 5928
119 Ga0157372_10003159 3300013307 Bacteria 17764
120 Ga0157372_10042346 3300013307 Bacteria 5036
121 Ga0157375_10025972 3300013308 Bacteria 5452
122 Ga0157375_10551180 3300013308 Bacteria 1315
123 Ga0157380_10000059 3300014326 Bacteria 62280
124 Ga0157377_10006199 3300014745 Bacteria 5687
125 Ga0207656_10000537 3300025321 Bacteria 12555
126 Ga0207688_10002667 3300025901 Bacteria 9664
127 Ga0207688_10145579 3300025901 Unclassified 1397
128 Ga0207654_10092411 3300025911 Bacteria 1847
129 Ga0207707_10660263 3300025912 Bacteria 881
130 Ga0207671_10001821 3300025914 Bacteria 23783
131 Ga0207693_10007405 3300025915 Bacteria 9028
132 Ga0207693_10022041 3300025915 Bacteria 5065
133 Ga0207693_10023092 3300025915 Bacteria 4940
134 Ga0207693_10029339 3300025915 Bacteria 4346
135 Ga0207663_10127474 3300025916 Bacteria 1753
136 Ga0207649_10000076 3300025920 Bacteria 83824
137 Ga0207649_10337124 3300025920 Bacteria 1112
138 Ga0207650_10015474 3300025925 Bacteria 5314
139 Ga0207659_10000010 3300025926 Bacteria 286639
140 Ga0207687_10000007 3300025927 Bacteria 604185
141 Ga0207687_10002621 3300025927 Bacteria 12190
142 Ga0207700_10000025 3300025928 Bacteria 147429
143 Ga0207664_10003199 3300025929 Bacteria 10885
144 Ga0207664_10087301 3300025929 Bacteria 2550
145 Ga0207664_10286440 3300025929 Bacteria 1447
146 Ga0207690_10129870 3300025932 Bacteria 1843
147 Ga0207706_10051758 3300025933 Bacteria 3626
148 Ga0207686_10001146 3300025934 Bacteria 15295
149 Ga0207686_10064287 3300025934 Bacteria 2336
150 Ga0207709_10004754 3300025935 Bacteria 7793
151 Ga0207670_10075763 3300025936 Bacteria 2340
152 Ga0207670_10254067 3300025936 Bacteria 1360
153 Ga0207669_10096761 3300025937 Bacteria 1939
154 Ga0207704_10000190 3300025938 Bacteria 32246
155 Ga0207665_10071187 3300025939 Bacteria 2374
156 Ga0207665_10377864 3300025939 Bacteria 1075
157 Ga0207691_10000190 3300025940 Bacteria 58438
158 Ga0207711_10000020 3300025941 Bacteria 363325
159 Ga0207711_10059507 3300025941 Bacteria 3289
160 Ga0207661_10000403 3300025944 Bacteria 27999
161 Ga0207661_10162394 3300025944 Bacteria 1939
162 Ga0207679_10005707 3300025945 Bacteria 7807
163 Ga0207651_10342182 3300025960 Bacteria 1257
164 Ga0207712_10325928 3300025961 Bacteria 1269
165 Ga0207712_10384191 3300025961 Bacteria 1176
166 Ga0207668_10016723 3300025972 Bacteria 4584
167 Ga0207668_10032109 3300025972 Bacteria 3466
168 Ga0207640_10000015 3300025981 Bacteria 215411
169 Ga0207677_10000991 3300026023 Bacteria 15648
170 Ga0207677_10238236 3300026023 Bacteria 1470
171 Ga0207677_10614686 3300026023 Bacteria 955
172 Ga0207703_10393285 3300026035 Bacteria 1285
173 Ga0207639_10003640 3300026041 Bacteria 10355
174 Ga0207639_10059687 3300026041 Bacteria 2939
175 Ga0207678_10039331 3300026067 Bacteria 4106
176 Ga0207708_10000288 3300026075 Bacteria 39571
177 Ga0207702_10000016 3300026078 Bacteria 226633
178 Ga0207676_10028123 3300026095 Bacteria 4197
179 Ga0207674_10037394 3300026116 Bacteria 5049
180 Ga0207675_100084792 3300026118 Bacteria 2973
181 Ga0207683_10009270 3300026121 Bacteria 8387
182 Ga0207698_10000012 3300026142 Bacteria 260061
183 Ga0207698_10422017 3300026142 Bacteria 1280
184 Ga0207428_10012413 3300027907 Bacteria 7486
185 Ga0268265_10219307 3300028380 Bacteria 1663
186 Ga0307511_10000693 3300030521 Bacteria 35967
187 Ga0307408_100144235 3300031548 Bacteria 1872
188 Ga0307413_10010328 3300031824 Bacteria 4521
189 Ga0307410_10009995 3300031852 Bacteria 5353
190 Ga0307406_10013448 3300031901 Bacteria 4688
191 Ga0307412_10016011 3300031911 Bacteria 4456
192 Ga0307409_100011222 3300031995 Bacteria 5632
193 Ga0307411_10063077 3300032005 Bacteria 2475
194 Ga0307415_100017513 3300032126 Bacteria 4299
195 Ga0307415_100050865 3300032126 Bacteria 2810
196 Ga0307415_100077787 3300032126 Unclassified 2357
197 Ga0373925_0517092 3300037068 Bacteria 981
198 Ga0395898_0009629 3300037466 Bacteria 10142
199 Ga0395905_0069011 3300037471 Bacteria 3311
200 Ga0395901_0002589 3300038443 Bacteria 18335
201 Ga0395901_0353862 3300038443 Unclassified 1515
202 Ga0395901_0405738 3300038443 Bacteria 1400
203 Ga0395901_0428218 3300038443 Bacteria 1356
204 Ga0436363_0412688 3300039450 Bacteria 1491
205 Ga0451839_0035730 3300041496 Bacteria 1189
206 Ga0466969_0005455 3300044656 Bacteria 6766
207 Ga0466966_0003488 3300044684 Bacteria 10368
208 Ga0466971_0178789 3300044719 Bacteria 997
209 Ga0466957_0000501 3300044842 Bacteria 19646
210 Ga0466957_0103609 3300044842 Bacteria 1797
211 Ga0466960_0124967 3300044901 Unclassified 1351
212 Ga0466960_0187448 3300044901 Bacteria 1124
213 Ga0466959_0004837 3300045049 Bacteria 9103
214 Ga0466959_0006610 3300045049 Bacteria 8050
215 Ga0466959_0061872 3300045049 Bacteria 2722
216 Ga0466958_0031527 3300045836 Bacteria 3151
217 Ga0466958_0066138 3300045836 Bacteria 2207
218 Ga0466958_0133441 3300045836 Bacteria 1560
219 Ga0466967_0000027 3300045976 Bacteria 64265
220 Ga0466967_0000561 3300045976 Bacteria 18185
221 Ga0466967_0105524 3300045976 Bacteria 2581
222 Ga0466967_0337357 3300045976 Bacteria 1457
223 Ga0495629_0001440 3300046459 Bacteria 18770
224 Ga0495629_0081933 3300046459 Bacteria 2252
225 Ga0495641_0007891 3300046461 Bacteria 6574
226 Ga0495606_0000221 3300046507 Bacteria 101157
227 Ga0495628_0321252 3300046516 Unclassified 1142
228 Ga0495628_0417387 3300046516 Bacteria 978
229 Ga0495645_0013442 3300046543 Bacteria 5787
230 Ga0495658_0004046 3300046683 Bacteria 7223
231 Ga0495613_0000073 3300046689 Bacteria 98688
232 Ga0495624_0000037 3300046690 Bacteria 83796
233 Ga0495600_0016757 3300046809 Bacteria 4657
234 Ga0495581_0047606 3300047315 Bacteria 2478
235 Ga0495604_0003874 3300047317 Bacteria 11917
236 Ga0495676_0114574 3300047321 Bacteria 1972
237 Ga0495684_0002161 3300047471 Bacteria 15742
238 Ga0495593_0038411 3300047673 Bacteria 2586
239 Ga0495602_0000021 3300048088 Bacteria 168585
240 Ga0496100_0137206 3300048903 Bacteria 1729
241 Ga0496100_0464805 3300048903 Bacteria 971
242 Ga0496101_0000361 3300048904 Bacteria 30335
243 Ga0496101_0007549 3300048904 Bacteria 7052
244 Ga0496101_0029241 3300048904 Bacteria 3854
245 Ga0496101_0383532 3300048904 Bacteria 1106
246 Ga0496102_0008647 3300048905 Bacteria 8738
247 Ga0496102_0040748 3300048905 Bacteria 4203
248 Ga0496102_0157423 3300048905 Bacteria 2136
249 Ga0496103_0006058 3300048906 Bacteria 7224
250 Ga0496103_0071254 3300048906 Bacteria 2175
251 Ga0496104_0000033 3300048907 Bacteria 189758
252 Ga0496104_0004818 3300048907 Bacteria 11762
253 Ga0496104_0048791 3300048907 Bacteria 3992
254 Ga0496104_0122611 3300048907 Bacteria 2495
255 Ga0496105_0046567 3300048908 Bacteria 3579
256 Ga0496105_0089497 3300048908 Bacteria 2543
257 Ga0496105_0104852 3300048908 Bacteria 2334
258 Ga0496106_0409806 3300048909 Bacteria 1089
259 Ga0496107_0049422 3300048910 Bacteria 3030
260 Ga0496108_0000132 3300048911 Bacteria 73888
261 Ga0496108_0013883 3300048911 Bacteria 6569
262 Ga0496108_0038951 3300048911 Bacteria 3962
263 Ga0496108_0047488 3300048911 Bacteria 3588
264 Ga0496109_0000007 3300048912 Bacteria 247554
265 Ga0496109_0000028 3300048912 Bacteria 168138
266 Ga0496109_0022628 3300048912 Bacteria 5567
267 Ga0496109_0098036 3300048912 Bacteria 2717
268 Ga0496110_0000034 3300048913 Bacteria 65177
269 Ga0496110_0000484 3300048913 Bacteria 27040
270 Ga0496110_0001163 3300048913 Bacteria 18670
271 Ga0496110_0005255 3300048913 Bacteria 10131
272 Ga0496110_0069074 3300048913 Bacteria 3128
273 Ga0496110_0179023 3300048913 Bacteria 1925
274 Ga0496111_0000372 3300048914 Bacteria 22335
275 Ga0496111_0000889 3300048914 Bacteria 16258
276 Ga0496111_0003411 3300048914 Bacteria 9836
277 Ga0496111_0285778 3300048914 Bacteria 1223
278 Ga0496112_0008008 3300048915 Bacteria 9429
279 Ga0496112_0016191 3300048915 Bacteria 6977
280 Ga0496112_0072544 3300048915 Bacteria 3403
281 Ga0496112_0123037 3300048915 Bacteria 2565
282 Ga0496113_0000234 3300048916 Bacteria 26164
283 Ga0496113_0254032 3300048916 Bacteria 1404
284 Ga0496114_0030729 3300048917 Bacteria 4420
285 Ga0496114_0119413 3300048917 Bacteria 2266
286 Ga0496115_0008751 3300048918 Bacteria 7504
287 Ga0496115_0231131 3300048918 Bacteria 1525
288 Ga0496116_0000769 3300048919 Bacteria 40716
289 Ga0496118_0037203 3300048921 Bacteria 3922
290 Ga0496119_0002017 3300048922 Bacteria 22987
291 Ga0496126_0138844 3300048929 Bacteria 2094
292 Ga0501047_0080687 3300049581 Bacteria 3127
293 Ga0501069_0004447 3300049585 Bacteria 7240
294 Ga0501080_0000568 3300049742 Bacteria 29197
295 Ga0501081_0093525 3300049743 Bacteria 2117
296 nmdc:mga03n38_63692_c1 3300050490 Bacteria 1685
297 nmdc:mga00v17_198849_c1 3300050491 Bacteria 1295
298 nmdc:mga0yw44_108578_c1 3300050492 Bacteria 1776
299 nmdc:mga05p37_12014_c1 3300050507 Bacteria 10330
300 nmdc:mga06r32_121064_c1 3300050510 Bacteria 2582
301 nmdc:mga06r32_2921_c1 3300050510 Bacteria 15326
302 nmdc:mga08y16_12684_c1 3300050511 Bacteria 8865
303 nmdc:mga0n895_41546_c1 3300050512 Bacteria 4472
304 nmdc:mga0rr50_123972_c1 3300050513 Bacteria 2060
305 nmdc:mga0rr50_89127_c1 3300050513 Bacteria 2398
306 nmdc:mga08x19_216391_c1 3300050514 Bacteria 1316
307 nmdc:mga0a205_372220_c1 3300050515 Unclassified 1294
308 nmdc:mga0a205_95268_c1 3300050515 Bacteria 2875
309 Ga0495601_0000039 3300053077 Bacteria 79594
310 Ga0495612_0007562 3300053078 Bacteria 4440
311 Ga0495655_0001391 3300053083 Bacteria 3715
312 Ga0495619_0000055 3300053085 Bacteria 95570
313 Ga0495619_0037616 3300053085 Bacteria 3155
314 Ga0500595_065319 3300053119 Bacteria 1089
315 Ga0466962_0065993 3300061719 Bacteria 1728
316 Ga0530510_0142113 3300061734 Bacteria 1769
317 2526061072 2524614857 Bacteria 4146328
318 2558909370 2558860112 Bacteria 9931328
319 2645725647 2643221962 Bacteria 3874254
320 2740062536 2739367875 Bacteria 4157290
321 Ga0496106_0371391
322 Ga0070683_100030457
323 Ga0070670_100166918
324 Ga0070682_100001319
325 Ga0070682_100005699
326 Ga0070682_100036113
327 Ga0068868_100000264
328 Ga0068868_100061069
329 Ga0068868_100166295
330 Ga0070661_100000599
331 Ga0070661_100025647
332 Ga0070668_100024433
333 Ga0070668_100257969
334 Ga0070675_100000053
335 Ga0070671_100028943
336 Ga0070674_100019963
337 Ga0070674_100039482
338 Ga0070673_100174201
339 Ga0070688_100000012
340 Ga0070688_100000492
341 Ga0070659_100018042
342 Ga0070659_100087543
343 Ga0070709_10026286
344 Ga0070714_100085505
345 Ga0070714_100206768
346 Ga0070713_100000009
347 Ga0070713_100112169
348 Ga0070713_100249317
349 Ga0070711_100003694
350 Ga0070711_100028605
351 Ga0070711_100129564
352 Ga0070711_100145345
353 Ga0070663_100033074
354 Ga0070678_100012815
355 Ga0070662_100056007
356 Ga0070681_10521223
357 Ga0070685_10000018
358 Ga0070685_10000460
359 Ga0070685_10102840
360 Ga0070685_10391096
361 Ga0070684_100001296
362 Ga0070684_100080220
363 Ga0068853_100013514
364 Ga0068853_100015679
365 Ga0068853_100248393
366 Ga0070672_100000030
367 Ga0070672_100222615
368 Ga0070686_100245906
369 Ga0070695_100277891
370 Ga0070704_100014804
371 Ga0070704_100036252
372 Ga0070664_100035350
373 Ga0068857_100137883
374 Ga0068854_100000031
375 Ga0068856_100005853
376 Ga0068856_100006734
377 Ga0068852_100000012
378 Ga0068852_100039820
379 Ga0068864_100008506
380 Ga0068866_10055378
381 Ga0068866_10106358
382 Ga0068851_10000333
383 Ga0068851_10035845
384 Ga0068862_100252960
385 Ga0081455_10005991
386 Ga0081455_10011106
387 Ga0081455_10021847
388 Ga0081455_10027598
389 Ga0081455_10028155
390 Ga0081455_10049351
391 Ga0081538_10011997
392 Ga0081539_10011023
393 Ga0070717_10080680
394 Ga0075365_10000477
395 Ga0075365_10010102
396 Ga0075363_100151103
397 Ga0075363_100327686
398 Ga0070716_100035034
399 Ga0070712_100002097
400 Ga0070712_100004037
401 Ga0070712_100010171
402 Ga0070712_100029532
403 Ga0075431_100000548
404 Ga0075431_100012056
405 Ga0075433_10071584
406 Ga0075433_10430602
407 Ga0068865_100000402
408 Ga0068865_100064509
409 Ga0075436_100025434
410 Ga0075436_100207900
411 Ga0075435_100344149
412 Ga0111539_10012827
413 Ga0111539_10427106
414 Ga0105245_10000180
415 Ga0105245_10004079
416 Ga0105245_10009667
417 Ga0105245_10017386
418 Ga0114129_10011633
419 Ga0114129_10179675
420 Ga0114129_10453157
421 Ga0105243_10059859
422 Ga0105243_10091921
423 Ga0105241_10040249
424 Ga0105242_10011988
425 Ga0105242_10109501
426 Ga0105248_10000118
427 Ga0105248_10036189
428 Ga0105237_10000733
429 Ga0105249_10037284
430 Ga0105249_10071152
431 Ga0105239_10033048
432 Ga0105246_10116040
433 Ga0157371_10200625
434 Ga0157370_10164185
435 Ga0157369_10000142
436 Ga0157369_10302248
437 Ga0157374_10020072
438 Ga0157378_10019730
439 Ga0157372_10003159
440 Ga0157372_10042346
441 Ga0157375_10025972
442 Ga0157375_10551180
443 Ga0157380_10000059
444 Ga0157377_10006199
445 Ga0207656_10000537
446 Ga0207688_10002667
447 Ga0207688_10145579
448 Ga0207654_10092411
449 Ga0207707_10660263
450 Ga0207671_10001821
451 Ga0207693_10007405
452 Ga0207693_10022041
453 Ga0207693_10023092
454 Ga0207693_10029339
455 Ga0207663_10127474
456 Ga0207649_10000076
457 Ga0207649_10337124
458 Ga0207650_10015474
459 Ga0207659_10000010
460 Ga0207687_10000007
461 Ga0207687_10002621
462 Ga0207700_10000025
463 Ga0207664_10003199
464 Ga0207664_10087301
465 Ga0207664_10286440
466 Ga0207690_10129870
467 Ga0207706_10051758
468 Ga0207686_10001146
469 Ga0207686_10064287
470 Ga0207709_10004754
471 Ga0207670_10075763
472 Ga0207670_10254067
473 Ga0207669_10096761
474 Ga0207704_10000190
475 Ga0207665_10071187
476 Ga0207665_10377864
477 Ga0207691_10000190
478 Ga0207711_10000020
479 Ga0207711_10059507
480 Ga0207661_10000403
481 Ga0207661_10162394
482 Ga0207679_10005707
483 Ga0207651_10342182
484 Ga0207712_10325928
485 Ga0207712_10384191
486 Ga0207668_10016723
487 Ga0207668_10032109
488 Ga0207640_10000015
489 Ga0207677_10000991
490 Ga0207677_10238236
491 Ga0207677_10614686
492 Ga0207703_10393285
493 Ga0207639_10003640
494 Ga0207639_10059687
495 Ga0207678_10039331
496 Ga0207708_10000288
497 Ga0207702_10000016
498 Ga0207676_10028123
499 Ga0207674_10037394
500 Ga0207675_100084792
501 Ga0207683_10009270
502 Ga0207698_10000012
503 Ga0207698_10422017
504 Ga0207428_10012413
505 Ga0268265_10219307
506 Ga0307511_10000693
507 Ga0307408_100144235
508 Ga0307413_10010328
509 Ga0307410_10009995
510 Ga0307406_10013448
511 Ga0307412_10016011
512 Ga0307409_100011222
513 Ga0307411_10063077
514 Ga0307415_100017513
515 Ga0307415_100050865
516 Ga0307415_100077787
517 Ga0373925_0517092
518 Ga0395898_0009629
519 Ga0395905_0069011
520 Ga0395901_0002589
521 Ga0395901_0353862
522 Ga0395901_0405738
523 Ga0395901_0428218
524 Ga0436363_0412688
525 Ga0451839_0035730
526 Ga0466969_0005455
527 Ga0466966_0003488
528 Ga0466971_0178789
529 Ga0466957_0000501
530 Ga0466957_0103609
531 Ga0466960_0124967
532 Ga0466960_0187448
533 Ga0466959_0004837
534 Ga0466959_0006610
535 Ga0466959_0061872
536 Ga0466958_0031527
537 Ga0466958_0066138
538 Ga0466958_0133441
539 Ga0466967_0000027
540 Ga0466967_0000561
541 Ga0466967_0105524
542 Ga0466967_0337357
543 Ga0495629_0001440
544 Ga0495629_0081933
545 Ga0495641_0007891
546 Ga0495606_0000221
547 Ga0495628_0321252
548 Ga0495628_0417387
549 Ga0495645_0013442
550 Ga0495658_0004046
551 Ga0495613_0000073
552 Ga0495624_0000037
553 Ga0495600_0016757
554 Ga0495581_0047606
555 Ga0495604_0003874
556 Ga0495676_0114574
557 Ga0495684_0002161
558 Ga0495593_0038411
559 Ga0495602_0000021
560 Ga0496100_0137206
561 Ga0496100_0464805
562 Ga0496101_0000361
563 Ga0496101_0007549
564 Ga0496101_0029241
565 Ga0496101_0383532
566 Ga0496102_0008647
567 Ga0496102_0040748
568 Ga0496102_0157423
569 Ga0496103_0006058
570 Ga0496103_0071254
571 Ga0496104_0000033
572 Ga0496104_0004818
573 Ga0496104_0048791
574 Ga0496104_0122611
575 Ga0496105_0046567
576 Ga0496105_0089497
577 Ga0496105_0104852
578 Ga0496106_0409806
579 Ga0496107_0049422
580 Ga0496108_0000132
581 Ga0496108_0013883
582 Ga0496108_0038951
583 Ga0496108_0047488
584 Ga0496109_0000007
585 Ga0496109_0000028
586 Ga0496109_0022628
587 Ga0496109_0098036
588 Ga0496110_0000034
589 Ga0496110_0000484
590 Ga0496110_0001163
591 Ga0496110_0005255
592 Ga0496110_0069074
593 Ga0496110_0179023
594 Ga0496111_0000372
595 Ga0496111_0000889
596 Ga0496111_0003411
597 Ga0496111_0285778
598 Ga0496112_0008008
599 Ga0496112_0016191
600 Ga0496112_0072544
601 Ga0496112_0123037
602 Ga0496113_0000234
603 Ga0496113_0254032
604 Ga0496114_0030729
605 Ga0496114_0119413
606 Ga0496115_0008751
607 Ga0496115_0231131
608 Ga0496116_0000769
609 Ga0496118_0037203
610 Ga0496119_0002017
611 Ga0496126_0138844
612 Ga0501047_0080687
613 Ga0501069_0004447
614 Ga0501080_0000568
615 Ga0501081_0093525
616 nmdc:mga03n38_63692_c1
617 nmdc:mga00v17_198849_c1
618 nmdc:mga0yw44_108578_c1
619 nmdc:mga05p37_12014_c1
620 nmdc:mga06r32_121064_c1
621 nmdc:mga06r32_2921_c1
622 nmdc:mga08y16_12684_c1
623 nmdc:mga0n895_41546_c1
624 nmdc:mga0rr50_123972_c1
625 nmdc:mga0rr50_89127_c1
626 nmdc:mga08x19_216391_c1
627 nmdc:mga0a205_372220_c1
628 nmdc:mga0a205_95268_c1
629 Ga0495601_0000039
630 Ga0495612_0007562
631 Ga0495655_0001391
632 Ga0495619_0000055
633 Ga0495619_0037616
634 Ga0500595_065319
635 Ga0466962_0065993
636 Ga0530510_0142113
637 2526061072
638 2558909370
639 2645725647
640 2740062536

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

56

172

0.92

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

58

305

0.59

Structural Annotation

Top 5 Hits

ID Description Score Start End
4psu-assembly1.cif.gz_A crystal structure of alpha/beta hydrolase from rhodopseudomonas palustris cga009 0.8618 5 275
7jqy-assembly1.cif.gz_B crystal structure of cfl1-d123s from burkholderia cenocepacia 0.8578 4 277
7jqx-assembly1.cif.gz_A crystal structure of cfl1 wild-type from burkholderia cenocepacia 0.8547 4 277
5w15-assembly1.cif.gz_D-3 crystal structure of an alpha/beta hydrolase fold protein from burkholderia ambifaria. 0.8516 6 273
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8506 4 124
ID Description Score Start End Superfamily
af_O53622_2_273_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.931 6 274 3.40.50.1820
af_O53622_2_273_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9178 6 274 3.40.50.1820
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.874 17 125 3.40.50.1820
af_P53750_3_288_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8584 4 274 3.40.50.1820
af_Q6NL07_73_332_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8478 21 275 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A535USJ1-F1-model_v4 Alpha/beta hydrolase 0.9764 3 274 GO:0016787
AF-A0A0N9HW40-F1-model_v4 Alpha/beta hydrolase 0.9663 4 278 GO:0016787
AF-A0A3D2MLI3-F1-model_v4 Alpha/beta hydrolase 0.9616 6 116 GO:0016787
AF-A0A316TM31-F1-model_v4 Alpha/beta hydrolase 0.9528 3 277 GO:0016787
AF-A0A0N9HW40-F1-model_v4 Alpha/beta hydrolase 0.9527 4 278 GO:0016787

Map