F406439

General Info

Members Datasets Scaffolds Average Seq Length
322 195 309 416

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10016949|Ga0105239_100169495
Length 452
Sequence LRCDGSVLYPHRLRLLRPPWHRERLRVSIRLRLIVLSFLEFFIWGSWLLTIGAYWFQNKHWSGTSFGAIFSTMGIAALFMPSLIGIVADRWINAEKLYGLLQLGGALILFAVPTVDNPSTLFWVMLLNMICYMPTISLERTVAYNALKSEGLDVVRDYPPIRVWGTVGFIAALWTVSLLHLETSAGQFYIASGASLVLGLYAFTLPKCPPRLGKGESGRSLIDVLGLSSFRLFKNRNMAVFLIFAMLLGAALQLTNAYGDTFLHDFANVDAYKDTIAVKYPAIIMSISQVSETLFILAIPFFLRRFGIKTVMVISMLAWFLRFGLFAYGDPGGGLWMIILSCIVYGMAFDFFNISGSLFVETQSDPKIRASAQGLFMVMTNGIGAMLGSSISGVIIDRFFTFADKSKDWHGIWITFALYALATAILFVPLFKHKHDPAMMTRDLHPDVKVGA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
5 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
6 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
7 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
8 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
9 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
10 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
11 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
12 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
13 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
14 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
20 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
184 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
192 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.21
Nodule 0
Rhizoplane 2.48
Rhizosphere 83.85
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1411852 2162886007 Bacteria 14549
2 SwRhRL2b_contig_3065032 2162886007 Bacteria 1545
3 JGI24736J21556_1006391 3300001904 Bacteria 1984
4 JGI24740J21852_10008872 3300001979 Bacteria 3979
5 JGI24739J22299_10005500 3300001989 Bacteria 4806
6 JGI24739J22299_10007925 3300001989 Bacteria 3974
7 JGI24737J22298_10002545 3300001990 Bacteria 6470
8 JGI24735J21928_10000001 3300002067 Bacteria 650042
9 JGI25162J39368_1000024 3300002737 Bacteria 229507
10 JGI25162J39368_1000772 3300002737 Bacteria 21571
11 JGI25162J39368_1000983 3300002737 Bacteria 18092
12 JGI25164J39214_1002143 3300002772 Bacteria 3313
13 JGI25165J46597_1000634 3300003214 Bacteria 29066
14 rootH1_10038419 3300003316 Bacteria 20328
15 rootH2_10005719 3300003320 Bacteria 108734
16 rootH2_10028169 3300003320 Bacteria 27149
17 rootL2_10070215 3300003322 Bacteria 1721
18 rootL2_10070216 3300003322 Bacteria 4288
19 rootH1_10011880 3300003323 Bacteria 3319
20 rootH1_10012862 3300003323 Bacteria 52977
21 rootH1_10025278 3300003323 Bacteria 5106
22 rootH1_10225706 3300003323 Bacteria 2713
23 Ga0065714_10002212 3300005288 Bacteria 56085
24 Ga0065714_10068107 3300005288 Bacteria 4962
25 Ga0065714_10076463 3300005288 Bacteria 2785
26 Ga0065704_10000193 3300005289 Bacteria 203271
27 Ga0070676_10000768 3300005328 Bacteria 15786
28 Ga0070676_10080565 3300005328 Bacteria 1974
29 Ga0070683_100008250 3300005329 Bacteria 8852
30 Ga0070660_100106865 3300005339 Bacteria 2223
31 Ga0070668_100135745 3300005347 Bacteria 1978
32 Ga0070669_100015081 3300005353 Bacteria 5507
33 Ga0070675_100252556 3300005354 Bacteria 1544
34 Ga0070671_100019085 3300005355 Bacteria 5576
35 Ga0070671_100043402 3300005355 Bacteria 3735
36 Ga0070674_100099331 3300005356 Bacteria 2117
37 Ga0070673_100279377 3300005364 Bacteria 1464
38 Ga0070659_100000277 3300005366 Bacteria 40022
39 Ga0070659_100044526 3300005366 Bacteria 3475
40 Ga0070663_100016728 3300005455 Bacteria 4772
41 Ga0070662_100000019 3300005457 Bacteria 101983
42 Ga0070662_100059886 3300005457 Bacteria 2775
43 Ga0068867_100000365 3300005459 Bacteria 30203
44 Ga0070679_100128831 3300005530 Bacteria 2512
45 Ga0068853_100003079 3300005539 Bacteria 12740
46 Ga0068853_100043793 3300005539 Bacteria 3829
47 Ga0070672_100174379 3300005543 Bacteria 1789
48 Ga0070665_100000003 3300005548 Bacteria 811857
49 Ga0068855_100030112 3300005563 Bacteria 6491
50 Ga0068855_100032782 3300005563 Bacteria 6202
51 Ga0068855_100043872 3300005563 Bacteria 5295
52 Ga0068855_100291929 3300005563 Bacteria 1807
53 Ga0068857_100019572 3300005577 Bacteria 5946
54 Ga0068856_100002428 3300005614 Bacteria 19174
55 Ga0068856_100016362 3300005614 Bacteria 7176
56 Ga0068856_100028324 3300005614 Bacteria 5470
57 Ga0068852_100006520 3300005616 Bacteria 8439
58 Ga0068864_100242708 3300005618 Bacteria 1669
59 Ga0068866_10026818 3300005718 Bacteria 2726
60 Ga0075366_10000141 3300006195 Bacteria 30278
61 Ga0075366_10038269 3300006195 Bacteria 2833
62 Ga0097621_100000507 3300006237 Bacteria 27254
63 Ga0068871_100000436 3300006358 Bacteria 28724
64 Ga0068865_100000580 3300006881 Bacteria 20503
65 Ga0105240_10000039 3300009093 Bacteria 270117
66 Ga0105240_10005708 3300009093 Bacteria 18466
67 Ga0105240_10030918 3300009093 Bacteria 6954
68 Ga0105241_10001252 3300009174 Bacteria 19362
69 Ga0105241_10053342 3300009174 Bacteria 3091
70 Ga0105241_10160573 3300009174 Bacteria 1847
71 Ga0105242_10527964 3300009176 Bacteria 1127
72 Ga0105237_10000193 3300009545 Bacteria 86593
73 Ga0105237_10000531 3300009545 Bacteria 53648
74 Ga0105237_10010464 3300009545 Bacteria 9863
75 Ga0105237_10014902 3300009545 Bacteria 8109
76 Ga0105237_10034406 3300009545 Bacteria 5130
77 Ga0105237_10046577 3300009545 Bacteria 4361
78 Ga0105237_10273038 3300009545 Bacteria 1693
79 Ga0105238_10007379 3300009551 Bacteria 11014
80 Ga0105239_10000005 3300010375 Bacteria 496066
81 Ga0105239_10000013 3300010375 Bacteria 327371
82 Ga0105239_10001734 3300010375 Bacteria 28748
83 Ga0105239_10016949 3300010375 Bacteria 8054
84 Ga0105239_10017129 3300010375 Bacteria 8011
85 Ga0105239_10020184 3300010375 Bacteria 7351
86 Ga0105239_10021049 3300010375 Bacteria 7197
87 Ga0105239_10163508 3300010375 Bacteria 2488
88 Ga0105246_10013392 3300011119 Bacteria 5141
89 Ga0157373_10000037 3300013100 Bacteria 121670
90 Ga0157373_10000121 3300013100 Bacteria 60158
91 Ga0157373_10010155 3300013100 Bacteria 6936
92 Ga0157373_10013396 3300013100 Bacteria 6016
93 Ga0157371_10000426 3300013102 Bacteria 51710
94 Ga0157371_10002257 3300013102 Bacteria 18604
95 Ga0157371_10002317 3300013102 Bacteria 18296
96 Ga0157371_10008168 3300013102 Bacteria 8368
97 Ga0157370_10006844 3300013104 Bacteria 12487
98 Ga0157370_10010216 3300013104 Bacteria 9911
99 Ga0157370_10011991 3300013104 Bacteria 9031
100 Ga0157370_10028651 3300013104 Bacteria 5476
101 Ga0157370_10036657 3300013104 Bacteria 4757
102 Ga0157369_10068749 3300013105 Bacteria 3805
103 Ga0157374_10003331 3300013296 Bacteria 13505
104 Ga0157374_10012666 3300013296 Bacteria 7344
105 Ga0157378_10010353 3300013297 Bacteria 8140
106 Ga0157378_10021016 3300013297 Bacteria 5742
107 Ga0163162_10000083 3300013306 Bacteria 86303
108 Ga0163162_10002693 3300013306 Bacteria 16851
109 Ga0163162_10008070 3300013306 Bacteria 10274
110 Ga0157372_10000001 3300013307 Bacteria 791349
111 Ga0157372_10002422 3300013307 Bacteria 20196
112 Ga0157372_10013982 3300013307 Bacteria 8575
113 Ga0157372_10015014 3300013307 Bacteria 8289
114 Ga0157372_10036090 3300013307 Bacteria 5447
115 Ga0157372_10101419 3300013307 Bacteria 3286
116 Ga0157372_10129010 3300013307 Bacteria 2908
117 Ga0157372_10147276 3300013307 Bacteria 2715
118 Ga0157375_10004094 3300013308 Bacteria 12640
119 Ga0157375_10005554 3300013308 Bacteria 10973
120 Ga0157375_10029814 3300013308 Bacteria 5135
121 Ga0157375_10065324 3300013308 Bacteria 3627
122 Ga0157375_10125486 3300013308 Bacteria 2681
123 Ga0163163_10082180 3300014325 Bacteria 3225
124 Ga0182008_10000018 3300014497 Bacteria 230609
125 Ga0182008_10006790 3300014497 Bacteria 6367
126 Ga0182008_10009150 3300014497 Bacteria 5360
127 Ga0157377_10029508 3300014745 Bacteria 2962
128 Ga0182006_1009184 3300015261 Bacteria 4442
129 Ga0182007_10003351 3300015262 Bacteria 7576
130 Ga0182007_10016464 3300015262 Bacteria 2727
131 Ga0182007_10016478 3300015262 Bacteria 2725
132 Ga0207427_100103 3300025231 Bacteria 119618
133 Ga0209437_100017 3300025233 Bacteria 694471
134 Ga0209437_100101 3300025233 Bacteria 226668
135 Ga0209026_1000316 3300025250 Bacteria 51844
136 Ga0209026_1002747 3300025250 Bacteria 6296
137 Ga0209233_1000124 3300025261 Bacteria 226743
138 Ga0209455_1009600 3300025272 Bacteria 2527
139 Ga0207642_10030619 3300025899 Bacteria 2244
140 Ga0207647_10000042 3300025904 Bacteria 91917
141 Ga0207647_10000665 3300025904 Bacteria 26867
142 Ga0207645_10000717 3300025907 Bacteria 27578
143 Ga0207645_10009783 3300025907 Bacteria 6618
144 Ga0207705_10000040 3300025909 Bacteria 185735
145 Ga0207654_10000694 3300025911 Bacteria 18755
146 Ga0207695_10000058 3300025913 Bacteria 366582
147 Ga0207695_10005018 3300025913 Bacteria 17770
148 Ga0207695_10010636 3300025913 Bacteria 11242
149 Ga0207695_10037467 3300025913 Bacteria 5232
150 Ga0207695_10071010 3300025913 Bacteria 3557
151 Ga0207695_10133659 3300025913 Bacteria 2436
152 Ga0207671_10001850 3300025914 Bacteria 23624
153 Ga0207671_10004121 3300025914 Bacteria 14054
154 Ga0207671_10009497 3300025914 Bacteria 8125
155 Ga0207671_10012180 3300025914 Bacteria 6937
156 Ga0207671_10026376 3300025914 Bacteria 4356
157 Ga0207671_10032240 3300025914 Bacteria 3900
158 Ga0207671_10049016 3300025914 Bacteria 3126
159 Ga0207657_10113775 3300025919 Bacteria 2232
160 Ga0207681_10014697 3300025923 Bacteria 4873
161 Ga0207694_10028618 3300025924 Bacteria 4248
162 Ga0207644_10012681 3300025931 Bacteria 5602
163 Ga0207644_10012896 3300025931 Bacteria 5556
164 Ga0207690_10000249 3300025932 Bacteria 39145
165 Ga0207690_10027359 3300025932 Bacteria 3603
166 Ga0207706_10000058 3300025933 Bacteria 112367
167 Ga0207669_10014492 3300025937 Bacteria 3953
168 Ga0207704_10000066 3300025938 Bacteria 68294
169 Ga0207704_10041433 3300025938 Bacteria 2701
170 Ga0207691_10210111 3300025940 Bacteria 1691
171 Ga0207711_10009487 3300025941 Bacteria 8119
172 Ga0207711_10072440 3300025941 Bacteria 2993
173 Ga0207689_10101358 3300025942 Bacteria 2365
174 Ga0207661_10005102 3300025944 Bacteria 9218
175 Ga0207667_10021553 3300025949 Bacteria 7139
176 Ga0207667_10029122 3300025949 Bacteria 5991
177 Ga0207667_10260029 3300025949 Bacteria 1775
178 Ga0207667_10272127 3300025949 Bacteria 1731
179 Ga0207651_10248333 3300025960 Bacteria 1454
180 Ga0207668_10175679 3300025972 Bacteria 1684
181 Ga0207677_10079852 3300026023 Bacteria 2341
182 Ga0207639_10003519 3300026041 Bacteria 10529
183 Ga0207639_10005532 3300026041 Bacteria 8540
184 Ga0207678_10042316 3300026067 Bacteria 3947
185 Ga0207648_10000184 3300026089 Bacteria 66115
186 Ga0207648_10006394 3300026089 Bacteria 11709
187 Ga0207676_10033118 3300026095 Bacteria 3902
188 Ga0207674_10047187 3300026116 Bacteria 4418
189 Ga0207683_10031517 3300026121 Bacteria 4601
190 Ga0207698_10001576 3300026142 Bacteria 13321
191 Ga0209999_1000377 3300027543 Bacteria 6818
192 Ga0209970_1001638 3300027614 Bacteria 3894
193 Ga0209983_1000831 3300027665 Bacteria 6753
194 Ga0209971_1002119 3300027682 Bacteria 4834
195 Ga0209974_10054197 3300027876 Bacteria 1351
196 Ga0268266_10000018 3300028379 Bacteria 569141
197 Ga0268264_10006451 3300028381 Bacteria 9876
198 Ga0307515_10004006 3300028794 Bacteria 30751
199 Ga0316181_1187423 3300030744 Bacteria 2134
200 Ga0307509_10071578 3300031507 Bacteria 3616
201 Ga0307516_10006982 3300031730 Bacteria 13094
202 Ga0307412_10000077 3300031911 Bacteria 96375
203 Ga0307414_10002866 3300032004 Bacteria 9107
204 Ga0307414_10008019 3300032004 Bacteria 5970
205 Ga0307414_10018460 3300032004 Bacteria 4295
206 Ga0316583_10046020 3300032133 Unclassified 1540
207 Ga0307510_10031480 3300033180 Bacteria 5994
208 Ga0395899_0000002 3300037312 Bacteria 1324310
209 Ga0395899_0000232 3300037312 Bacteria 75259
210 Ga0395899_0007068 3300037312 Bacteria 8688
211 Ga0395898_0029478 3300037466 Bacteria 5497
212 Ga0395905_0000001 3300037471 Bacteria 2037079
213 Ga0395905_0219807 3300037471 Bacteria 1778
214 Ga0395901_0000794 3300038443 Bacteria 35129
215 Ga0436365_0867315 3300039437 Bacteria 3149
216 Ga0436361_0045275 3300039447 Bacteria 16675
217 Ga0453684_0015909 3300044712 Bacteria 11830
218 Ga0453684_0016572 3300044712 Bacteria 11504
219 Ga0453684_0053865 3300044712 Bacteria 5248
220 Ga0453684_0272306 3300044712 Bacteria 1934
221 Ga0451576_0016818 3300045051 Bacteria 8063
222 Ga0495641_0083585 3300046461 Bacteria 1430
223 Ga0495650_0000013 3300046471 Bacteria 611135
224 Ga0495585_0000570 3300046492 Bacteria 34695
225 Ga0495585_0002315 3300046492 Bacteria 13724
226 Ga0495607_0014830 3300046501 Bacteria 5064
227 Ga0495583_0124002 3300046506 Bacteria 1085
228 Ga0495606_0000002 3300046507 Bacteria 554637
229 Ga0495606_0011907 3300046507 Bacteria 7036
230 Ga0495606_0016588 3300046507 Bacteria 5608
231 Ga0495606_0054375 3300046507 Bacteria 2593
232 Ga0495610_0009641 3300046512 Bacteria 6083
233 Ga0495616_0004230 3300046513 Bacteria 9082
234 Ga0495616_0023579 3300046513 Bacteria 3309
235 Ga0495632_0060715 3300046519 Bacteria 1836
236 Ga0495644_0034324 3300046523 Bacteria 1915
237 Ga0495648_0009093 3300046524 Bacteria 7749
238 Ga0495648_0048354 3300046524 Bacteria 2619
239 Ga0495609_0053878 3300046538 Bacteria 1787
240 Ga0495633_0000014 3300046558 Bacteria 261742
241 Ga0495668_0000003 3300046616 Bacteria 695023
242 Ga0495625_0000030 3300046660 Bacteria 241164
243 Ga0495625_0001288 3300046660 Bacteria 31494
244 Ga0495625_0003593 3300046660 Bacteria 15258
245 Ga0495625_0078877 3300046660 Bacteria 2298
246 Ga0495625_0111321 3300046660 Bacteria 1871
247 Ga0495661_0006905 3300046665 Bacteria 7938
248 Ga0495661_0113848 3300046665 Bacteria 1504
249 Ga0495658_0051505 3300046683 Bacteria 2332
250 Ga0495649_0000041 3300046694 Bacteria 125049
251 Ga0495660_0017062 3300046810 Bacteria 4181
252 Ga0495687_003402 3300047443 Bacteria 11586
253 Ga0495687_007675 3300047443 Bacteria 6307
254 Ga0495686_0000693 3300047472 Bacteria 45522
255 Ga0495686_0003550 3300047472 Bacteria 13418
256 Ga0495686_0005021 3300047472 Bacteria 10625
257 Ga0495614_0011185 3300048089 Bacteria 3949
258 Ga0496101_0059790 3300048904 Bacteria 2763
259 Ga0496104_0000023 3300048907 Bacteria 236818
260 Ga0496105_0000019 3300048908 Bacteria 185293
261 Ga0496108_0100044 3300048911 Bacteria 2472
262 Ga0496109_0039543 3300048912 Bacteria 4269
263 Ga0496113_0071675 3300048916 Bacteria 2635
264 Ga0496115_0000515 3300048918 Bacteria 30051
265 Ga0496118_0017713 3300048921 Bacteria 6467
266 Ga0496126_0000087 3300048929 Bacteria 215031
267 Ga0501032_0011320 3300049569 Bacteria 6406
268 Ga0501032_0068933 3300049569 Bacteria 2360
269 Ga0501033_0001011 3300049570 Bacteria 25534
270 Ga0501034_0000938 3300049571 Bacteria 42430
271 Ga0501034_0020662 3300049571 Bacteria 6725
272 Ga0501034_0140106 3300049571 Bacteria 2398
273 Ga0501034_0311835 3300049571 Bacteria 1507
274 Ga0501037_0034441 3300049573 Bacteria 3737
275 Ga0501038_0006952 3300049574 Bacteria 10445
276 Ga0501039_0018069 3300049575 Bacteria 5411
277 Ga0501043_0019646 3300049579 Bacteria 5304
278 Ga0501047_0029463 3300049581 Bacteria 5292
279 Ga0501047_0043718 3300049581 Bacteria 4327
280 Ga0501068_0010390 3300049584 Bacteria 5229
281 Ga0501069_0009086 3300049585 Bacteria 5244
282 Ga0501070_0007283 3300049586 Bacteria 9393
283 Ga0501070_0026873 3300049586 Bacteria 4827
284 Ga0501072_0011395 3300049588 Bacteria 6796
285 Ga0501073_0001139 3300049589 Bacteria 19341
286 Ga0501074_0021337 3300049590 Bacteria 4703
287 Ga0501074_0131618 3300049590 Bacteria 1789
288 Ga0501223_012834 3300049663 Bacteria 1673
289 Ga0501079_0128309 3300049741 Bacteria 1973
290 Ga0501080_0001231 3300049742 Bacteria 21291
291 Ga0501080_0032883 3300049742 Bacteria 4839
292 Ga0501083_0000496 3300049744 Bacteria 25186
293 Ga0501241_001977 3300049758 Bacteria 4022
294 Ga0501268_002940 3300049765 Bacteria 2291
295 Ga0501035_0046264 3300049822 Bacteria 3914
296 Ga0501035_0103438 3300049822 Bacteria 2498
297 Ga0501044_0005539 3300049823 Bacteria 14015
298 Ga0501044_0026511 3300049823 Bacteria 6134
299 Ga0501044_0060436 3300049823 Bacteria 3880
300 nmdc:mga0k408_1566_c1 3300050493 Bacteria 10893
301 nmdc:mga0k408_450_c1 3300050493 Bacteria 22539
302 nmdc:mga0k408_52922_c1 3300050493 Bacteria 2353
303 Ga0500635_0000656 3300053080 Bacteria 8805
304 Ga0500651_0000127 3300053093 Bacteria 47010
305 Ga0500618_000001 3300053125 Bacteria 538477
306 Ga0500561_0034954 3300053137 Bacteria 1294
307 Ga0500624_000356 3300053157 Bacteria 14836
308 Ga0501084_0104311 3300054114 Bacteria 2381
309 Ga0501082_0291262 3300060353 Bacteria 1421

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0124002 Ga0495583_0124002_22_1059 345
2 3300046683 Ga0495658_0051505 Ga0495658_0051505_27_1064 345
3 3300044712 Ga0453684_0053865 Ga0453684_0053865_62_1321 357
4 3300045051 Ga0451576_0016818 Ga0451576_0016818_5548_6807 361
5 3300009176 Ga0105242_10527964 Ga0105242_105279641 363
6 3300015262 Ga0182007_10016464 Ga0182007_100164643 368
7 3300049569 Ga0501032_0011320 Ga0501032_0011320_14_1132 372
8 3300053137 Ga0500561_0034954 Ga0500561_0034954_111_1232 373
9 3300033180 Ga0307510_10031480 Ga0307510_100314802 393
10 3300005366 Ga0070659_100044526 Ga0070659_1000445263 394
11 3300005577 Ga0068857_100019572 Ga0068857_1000195724 394
12 3300013100 Ga0157373_10010155 Ga0157373_100101557 394
13 3300013102 Ga0157371_10002257 Ga0157371_100022578 394
14 3300013104 Ga0157370_10010216 Ga0157370_100102166 394
15 3300013307 Ga0157372_10013982 Ga0157372_100139823 394
16 3300025904 Ga0207647_10000665 Ga0207647_1000066522 394
17 3300025932 Ga0207690_10027359 Ga0207690_100273593 394
18 3300026116 Ga0207674_10047187 Ga0207674_100471872 394
19 3300037471 Ga0395905_0219807 Ga0395905_0219807_84_1343 394
20 3300053080 Ga0500635_0000656 Ga0500635_0000656_5672_6931 394
21 3300046660 Ga0495625_0078877 Ga0495625_0078877_84_1307 395
22 3300039447 Ga0436361_0045275 Ga0436361_0045275_418_1650 396
23 3300053157 Ga0500624_000356 Ga0500624_000356_8841_10064 396
24 3300046519 Ga0495632_0060715 Ga0495632_0060715_394_1626 397
25 3300050493 nmdc:mga0k408_1566_c1 nmdc:mga0k408_1566_c1_9226_10458 397
26 3300002737 JGI25162J39368_1000024 JGI25162J39368_10000249 398
27 3300005563 Ga0068855_100030112 Ga0068855_1000301123 398
28 3300009093 Ga0105240_10005708 Ga0105240_100057087 398
29 3300009545 Ga0105237_10273038 Ga0105237_102730381 398
30 3300010375 Ga0105239_10001734 Ga0105239_1000173417 398
31 3300010375 Ga0105239_10163508 Ga0105239_101635081 398
32 3300025233 Ga0209437_100017 Ga0209437_1000179 398
33 3300025913 Ga0207695_10005018 Ga0207695_100050185 398
34 3300025914 Ga0207671_10026376 Ga0207671_100263762 398
35 3300025949 Ga0207667_10021553 Ga0207667_100215533 398
36 3300025949 Ga0207667_10260029 Ga0207667_102600291 398
37 3300044712 Ga0453684_0016572 Ga0453684_0016572_1621_2880 399
38 3300049765 Ga0501268_002940 Ga0501268_002940_778_2028 399
39 3300046507 Ga0495606_0016588 Ga0495606_0016588_3842_5101 400
40 3300046810 Ga0495660_0017062 Ga0495660_0017062_1648_2907 400
41 3300046524 Ga0495648_0048354 Ga0495648_0048354_310_1569 401
42 3300046660 Ga0495625_0111321 Ga0495625_0111321_11_1222 403
43 3300046501 Ga0495607_0014830 Ga0495607_0014830_2431_3675 404
44 3300005329 Ga0070683_100008250 Ga0070683_1000082504 405
45 3300013100 Ga0157373_10000037 Ga0157373_1000003761 405
46 3300013307 Ga0157372_10036090 Ga0157372_100360904 405
47 3300025944 Ga0207661_10005102 Ga0207661_100051028 405
48 3300005539 Ga0068853_100043793 Ga0068853_1000437933 407
49 3300037312 Ga0395899_0000002 Ga0395899_0000002_1066338_1067564 407
50 3300046507 Ga0495606_0054375 Ga0495606_0054375_1028_2251 407
51 3300046558 Ga0495633_0000014 Ga0495633_0000014_114833_116056 407
52 3300046665 Ga0495661_0006905 Ga0495661_0006905_2359_3582 407
53 3300046665 Ga0495661_0113848 Ga0495661_0113848_143_1366 407
54 iso_pu_bacteria 2896344016 2896346679 407
55 3300037471 Ga0395905_0000001 Ga0395905_0000001_438572_439825 408
56 3300044712 Ga0453684_0272306 Ga0453684_0272306_614_1840 408
57 iso_pu_bacteria 8002869464 8002869776 408
58 3300005530 Ga0070679_100128831 Ga0070679_1001288313 409
59 3300032133 Ga0316583_10046020 Ga0316583_100460201 409
60 3300044712 Ga0453684_0015909 Ga0453684_0015909_7702_8958 409
61 3300047472 Ga0495686_0005021 Ga0495686_0005021_980_2236 409
62 3300049571 Ga0501034_0020662 Ga0501034_0020662_4138_5394 409
63 3300049573 Ga0501037_0034441 Ga0501037_0034441_1123_2379 409
64 3300049574 Ga0501038_0006952 Ga0501038_0006952_7272_8528 409
65 3300049581 Ga0501047_0029463 Ga0501047_0029463_2338_3594 409
66 3300049584 Ga0501068_0010390 Ga0501068_0010390_1362_2618 409
67 3300049585 Ga0501069_0009086 Ga0501069_0009086_2215_3471 409
68 3300049586 Ga0501070_0026873 Ga0501070_0026873_3494_4750 409
69 3300049588 Ga0501072_0011395 Ga0501072_0011395_2820_4076 409
70 3300049589 Ga0501073_0001139 Ga0501073_0001139_8128_9384 409
71 3300049590 Ga0501074_0131618 Ga0501074_0131618_370_1626 409
72 3300049741 Ga0501079_0128309 Ga0501079_0128309_185_1441 409
73 3300049742 Ga0501080_0001231 Ga0501080_0001231_15830_17086 409
74 3300049744 Ga0501083_0000496 Ga0501083_0000496_14473_15729 409
75 3300049822 Ga0501035_0046264 Ga0501035_0046264_2100_3356 409
76 3300049823 Ga0501044_0005539 Ga0501044_0005539_10403_11659 409
77 3300054114 Ga0501084_0104311 Ga0501084_0104311_989_2245 409
78 3300060353 Ga0501082_0291262 Ga0501082_0291262_179_1408 409
79 3300001904 JGI24736J21556_1006391 JGI24736J21556_10063912 410
80 3300001979 JGI24740J21852_10008872 JGI24740J21852_100088722 410
81 3300001989 JGI24739J22299_10005500 JGI24739J22299_100055003 410
82 3300001989 JGI24739J22299_10007925 JGI24739J22299_100079253 410
83 3300001990 JGI24737J22298_10002545 JGI24737J22298_100025458 410
84 3300002067 JGI24735J21928_10000001 JGI24735J21928_100000019 410
85 3300002737 JGI25162J39368_1000772 JGI25162J39368_10007728 410
86 3300002737 JGI25162J39368_1000983 JGI25162J39368_10009839 410
87 3300002772 JGI25164J39214_1002143 JGI25164J39214_10021433 410
88 3300003214 JGI25165J46597_1000634 JGI25165J46597_10006348 410
89 3300003316 rootH1_10038419 rootH1_1003841914 410
90 3300003320 rootH2_10005719 rootH2_100057198 410
91 3300003320 rootH2_10028169 rootH2_1002816910 410
92 3300003322 rootL2_10070215 rootL2_100702151 410
93 3300003322 rootL2_10070216 rootL2_100702163 410
94 3300003323 rootH1_10011880 rootH1_100118802 410
95 3300003323 rootH1_10012862 rootH1_1001286211 410
96 3300003323 rootH1_10025278 rootH1_100252782 410
97 3300003323 rootH1_10225706 rootH1_102257061 410
98 3300005288 Ga0065714_10076463 Ga0065714_100764632 410
99 3300005328 Ga0070676_10000768 Ga0070676_100007684 410
100 3300005339 Ga0070660_100106865 Ga0070660_1001068652 410
101 3300005355 Ga0070671_100019085 Ga0070671_1000190852 410
102 3300005356 Ga0070674_100099331 Ga0070674_1000993311 410
103 3300005364 Ga0070673_100279377 Ga0070673_1002793771 410
104 3300005455 Ga0070663_100016728 Ga0070663_1000167283 410
105 3300005457 Ga0070662_100000019 Ga0070662_10000001937 410
106 3300005459 Ga0068867_100000365 Ga0068867_1000003656 410
107 3300005539 Ga0068853_100003079 Ga0068853_1000030797 410
108 3300005548 Ga0070665_100000003 Ga0070665_100000003766 410
109 3300005563 Ga0068855_100032782 Ga0068855_1000327823 410
110 3300005563 Ga0068855_100043872 Ga0068855_1000438723 410
111 3300005614 Ga0068856_100016362 Ga0068856_1000163625 410
112 3300005614 Ga0068856_100028324 Ga0068856_1000283244 410
113 3300005616 Ga0068852_100006520 Ga0068852_1000065204 410
114 3300005718 Ga0068866_10026818 Ga0068866_100268183 410
115 3300006195 Ga0075366_10000141 Ga0075366_1000014126 410
116 3300006195 Ga0075366_10038269 Ga0075366_100382692 410
117 3300006237 Ga0097621_100000507 Ga0097621_1000005076 410
118 3300006358 Ga0068871_100000436 Ga0068871_10000043611 410
119 3300006881 Ga0068865_100000580 Ga0068865_1000005803 410
120 3300009093 Ga0105240_10000039 Ga0105240_10000039170 410
121 3300009174 Ga0105241_10001252 Ga0105241_100012526 410
122 3300009174 Ga0105241_10053342 Ga0105241_100533423 410
123 3300009174 Ga0105241_10160573 Ga0105241_101605731 410
124 3300009545 Ga0105237_10000193 Ga0105237_1000019320 410
125 3300009545 Ga0105237_10000531 Ga0105237_100005312 410
126 3300009545 Ga0105237_10010464 Ga0105237_100104646 410
127 3300009545 Ga0105237_10014902 Ga0105237_100149024 410
128 3300009545 Ga0105237_10034406 Ga0105237_100344064 410
129 3300009545 Ga0105237_10046577 Ga0105237_100465773 410
130 3300009551 Ga0105238_10007379 Ga0105238_100073796 410
131 3300010375 Ga0105239_10000013 Ga0105239_1000001390 410
132 3300010375 Ga0105239_10017129 Ga0105239_100171296 410
133 3300010375 Ga0105239_10020184 Ga0105239_100201843 410
134 3300011119 Ga0105246_10013392 Ga0105246_100133923 410
135 3300013100 Ga0157373_10013396 Ga0157373_100133967 410
136 3300013102 Ga0157371_10008168 Ga0157371_100081688 410
137 3300013105 Ga0157369_10068749 Ga0157369_100687492 410
138 3300013296 Ga0157374_10003331 Ga0157374_100033318 410
139 3300013297 Ga0157378_10010353 Ga0157378_100103534 410
140 3300013297 Ga0157378_10021016 Ga0157378_100210162 410
141 3300013306 Ga0163162_10000083 Ga0163162_1000008348 410
142 3300013306 Ga0163162_10008070 Ga0163162_100080702 410
143 3300013307 Ga0157372_10000001 Ga0157372_10000001128 410
144 3300013307 Ga0157372_10002422 Ga0157372_100024223 410
145 3300013307 Ga0157372_10015014 Ga0157372_100150144 410
146 3300013307 Ga0157372_10101419 Ga0157372_101014192 410
147 3300013307 Ga0157372_10147276 Ga0157372_101472763 410
148 3300013308 Ga0157375_10065324 Ga0157375_100653242 410
149 3300013308 Ga0157375_10125486 Ga0157375_101254862 410
150 3300014745 Ga0157377_10029508 Ga0157377_100295082 410
151 3300025231 Ga0207427_100103 Ga0207427_100103131 410
152 3300025233 Ga0209437_100101 Ga0209437_100101152 410
153 3300025250 Ga0209026_1002747 Ga0209026_10027476 410
154 3300025261 Ga0209233_1000124 Ga0209233_100012485 410
155 3300025272 Ga0209455_1009600 Ga0209455_10096003 410
156 3300025899 Ga0207642_10030619 Ga0207642_100306191 410
157 3300025904 Ga0207647_10000042 Ga0207647_1000004213 410
158 3300025907 Ga0207645_10000717 Ga0207645_1000071710 410
159 3300025909 Ga0207705_10000040 Ga0207705_1000004097 410
160 3300025911 Ga0207654_10000694 Ga0207654_1000069411 410
161 3300025913 Ga0207695_10000058 Ga0207695_1000005834 410
162 3300025913 Ga0207695_10010636 Ga0207695_100106368 410
163 3300025913 Ga0207695_10071010 Ga0207695_100710103 410
164 3300025913 Ga0207695_10133659 Ga0207695_101336591 410
165 3300025914 Ga0207671_10001850 Ga0207671_100018505 410
166 3300025914 Ga0207671_10004121 Ga0207671_100041217 410
167 3300025914 Ga0207671_10009497 Ga0207671_100094972 410
168 3300025914 Ga0207671_10012180 Ga0207671_100121802 410
169 3300025914 Ga0207671_10049016 Ga0207671_100490161 410
170 3300025919 Ga0207657_10113775 Ga0207657_101137752 410
171 3300025924 Ga0207694_10028618 Ga0207694_100286184 410
172 3300025931 Ga0207644_10012681 Ga0207644_100126816 410
173 3300025931 Ga0207644_10012896 Ga0207644_100128963 410
174 3300025933 Ga0207706_10000058 Ga0207706_1000005837 410
175 3300025937 Ga0207669_10014492 Ga0207669_100144922 410
176 3300025938 Ga0207704_10000066 Ga0207704_1000006633 410
177 3300025949 Ga0207667_10029122 Ga0207667_100291225 410
178 3300025949 Ga0207667_10272127 Ga0207667_102721272 410
179 3300025960 Ga0207651_10248333 Ga0207651_102483332 410
180 3300026041 Ga0207639_10003519 Ga0207639_100035199 410
181 3300026041 Ga0207639_10005532 Ga0207639_100055325 410
182 3300026067 Ga0207678_10042316 Ga0207678_100423163 410
183 3300026089 Ga0207648_10000184 Ga0207648_100001847 410
184 3300026142 Ga0207698_10001576 Ga0207698_100015768 410
185 3300028379 Ga0268266_10000018 Ga0268266_1000001886 410
186 3300028794 Ga0307515_10004006 Ga0307515_1000400615 410
187 3300031507 Ga0307509_10071578 Ga0307509_100715783 410
188 3300037312 Ga0395899_0000232 Ga0395899_0000232_39805_41064 410
189 3300037312 Ga0395899_0007068 Ga0395899_0007068_5786_7018 410
190 3300037466 Ga0395898_0029478 Ga0395898_0029478_1304_2536 410
191 3300038443 Ga0395901_0000794 Ga0395901_0000794_23982_25214 410
192 3300046461 Ga0495641_0083585 Ga0495641_0083585_75_1334 410
193 3300046471 Ga0495650_0000013 Ga0495650_0000013_513074_514333 410
194 3300046492 Ga0495585_0000570 Ga0495585_0000570_22656_23915 410
195 3300046492 Ga0495585_0002315 Ga0495585_0002315_7269_8528 410
196 3300046507 Ga0495606_0000002 Ga0495606_0000002_71717_72976 410
197 3300046507 Ga0495606_0011907 Ga0495606_0011907_4357_5589 410
198 3300046512 Ga0495610_0009641 Ga0495610_0009641_932_2164 410
199 3300046513 Ga0495616_0004230 Ga0495616_0004230_3837_5096 410
200 3300046513 Ga0495616_0023579 Ga0495616_0023579_962_2221 410
201 3300046523 Ga0495644_0034324 Ga0495644_0034324_311_1543 410
202 3300046524 Ga0495648_0009093 Ga0495648_0009093_4896_6155 410
203 3300046538 Ga0495609_0053878 Ga0495609_0053878_427_1686 410
204 3300046616 Ga0495668_0000003 Ga0495668_0000003_501943_503202 410
205 3300046660 Ga0495625_0000030 Ga0495625_0000030_142782_144041 410
206 3300046660 Ga0495625_0001288 Ga0495625_0001288_23570_24829 410
207 3300046660 Ga0495625_0003593 Ga0495625_0003593_10129_11388 410
208 3300046694 Ga0495649_0000041 Ga0495649_0000041_97162_98421 410
209 3300047443 Ga0495687_003402 Ga0495687_003402_3351_4610 410
210 3300047443 Ga0495687_007675 Ga0495687_007675_2541_3800 410
211 3300047472 Ga0495686_0000693 Ga0495686_0000693_36810_38042 410
212 3300047472 Ga0495686_0003550 Ga0495686_0003550_3661_4893 410
213 3300048089 Ga0495614_0011185 Ga0495614_0011185_1894_3153 410
214 3300048904 Ga0496101_0059790 Ga0496101_0059790_835_2127 410
215 3300048911 Ga0496108_0100044 Ga0496108_0100044_685_1977 410
216 3300048912 Ga0496109_0039543 Ga0496109_0039543_736_2028 410
217 3300048916 Ga0496113_0071675 Ga0496113_0071675_591_1883 410
218 3300049663 Ga0501223_012834 Ga0501223_012834_243_1526 410
219 3300050493 nmdc:mga0k408_450_c1 nmdc:mga0k408_450_c1_13636_14895 410
220 3300050493 nmdc:mga0k408_52922_c1 nmdc:mga0k408_52922_c1_1057_2289 410
221 3300053125 Ga0500618_000001 Ga0500618_000001_201598_202857 410
222 iso_pu_bacteria 2599185184 2599477589 410
223 iso_pu_bacteria 2852623160 2852623505 410
224 iso_pu_bacteria 2884933994 2884937594 410
225 iso_pu_bacteria 2919437846 2919440953 410
226 iso_pu_bacteria 2928078545 2928079500 410
227 iso_pu_bacteria 2928147474 2928148016 410
228 iso_pu_bacteria 2932082852 2932083909 410
229 iso_pu_bacteria 2977232053 2977232815 410
230 3300005328 Ga0070676_10080565 Ga0070676_100805651 411
231 3300005353 Ga0070669_100015081 Ga0070669_1000150812 411
232 3300005354 Ga0070675_100252556 Ga0070675_1002525562 411
233 3300005457 Ga0070662_100059886 Ga0070662_1000598861 411
234 3300005563 Ga0068855_100291929 Ga0068855_1002919292 411
235 3300005614 Ga0068856_100002428 Ga0068856_10000242812 411
236 3300005618 Ga0068864_100242708 Ga0068864_1002427082 411
237 3300010375 Ga0105239_10021049 Ga0105239_100210495 411
238 3300013104 Ga0157370_10028651 Ga0157370_100286514 411
239 3300013296 Ga0157374_10012666 Ga0157374_100126665 411
240 3300013308 Ga0157375_10005554 Ga0157375_100055542 411
241 3300025914 Ga0207671_10032240 Ga0207671_100322403 411
242 3300025923 Ga0207681_10014697 Ga0207681_100146973 411
243 3300026089 Ga0207648_10006394 Ga0207648_100063949 411
244 3300026095 Ga0207676_10033118 Ga0207676_100331182 411
245 3300027543 Ga0209999_1000377 Ga0209999_10003774 411
246 3300027614 Ga0209970_1001638 Ga0209970_10016382 411
247 3300027665 Ga0209983_1000831 Ga0209983_10008311 411
248 3300027682 Ga0209971_1002119 Ga0209971_10021193 411
249 3300027876 Ga0209974_10054197 Ga0209974_100541971 411
250 3300028381 Ga0268264_10006451 Ga0268264_100064517 411
251 3300031730 Ga0307516_10006982 Ga0307516_100069827 411
252 3300039437 Ga0436365_0867315 Ga0436365_0867315_615_1919 411
253 3300048918 Ga0496115_0000515 Ga0496115_0000515_22500_23846 411
254 3300048921 Ga0496118_0017713 Ga0496118_0017713_2476_3750 411
255 3300048929 Ga0496126_0000087 Ga0496126_0000087_122883_124229 411
256 3300049569 Ga0501032_0068933 Ga0501032_0068933_765_2042 411
257 3300049570 Ga0501033_0001011 Ga0501033_0001011_23959_25248 411
258 3300049571 Ga0501034_0140106 Ga0501034_0140106_722_1972 411
259 3300049571 Ga0501034_0311835 Ga0501034_0311835_24_1301 411
260 3300049575 Ga0501039_0018069 Ga0501039_0018069_536_1813 411
261 3300049579 Ga0501043_0019646 Ga0501043_0019646_2169_3419 411
262 3300049581 Ga0501047_0043718 Ga0501047_0043718_722_1972 411
263 3300049586 Ga0501070_0007283 Ga0501070_0007283_282_1532 411
264 3300049590 Ga0501074_0021337 Ga0501074_0021337_581_1831 411
265 3300049742 Ga0501080_0032883 Ga0501080_0032883_3035_4285 411
266 3300049822 Ga0501035_0103438 Ga0501035_0103438_864_2141 411
267 3300049823 Ga0501044_0026511 Ga0501044_0026511_1385_2635 411
268 3300049823 Ga0501044_0060436 Ga0501044_0060436_2011_3288 411
269 2162886007 SwRhRL2b_contig_1411852 SwRhRL2b_0097.00004820 412
270 2162886007 SwRhRL2b_contig_3065032 SwRhRL2b_0791.00004310 412
271 3300005288 Ga0065714_10002212 Ga0065714_1000221240 412
272 3300005288 Ga0065714_10068107 Ga0065714_100681072 412
273 3300005289 Ga0065704_10000193 Ga0065704_1000019338 412
274 3300005347 Ga0070668_100135745 Ga0070668_1001357452 412
275 3300005355 Ga0070671_100043402 Ga0070671_1000434022 412
276 3300005366 Ga0070659_100000277 Ga0070659_1000002779 412
277 3300005543 Ga0070672_100174379 Ga0070672_1001743792 412
278 3300009093 Ga0105240_10030918 Ga0105240_100309186 412
279 3300010375 Ga0105239_10000005 Ga0105239_10000005111 412
280 3300010375 Ga0105239_10016949 Ga0105239_100169495 412
281 3300013100 Ga0157373_10000121 Ga0157373_1000012139 412
282 3300013102 Ga0157371_10000426 Ga0157371_100004264 412
283 3300013102 Ga0157371_10002317 Ga0157371_1000231711 412
284 3300013104 Ga0157370_10006844 Ga0157370_100068443 412
285 3300013104 Ga0157370_10011991 Ga0157370_100119918 412
286 3300013104 Ga0157370_10036657 Ga0157370_100366572 412
287 3300013306 Ga0163162_10002693 Ga0163162_100026936 412
288 3300013307 Ga0157372_10129010 Ga0157372_101290103 412
289 3300013308 Ga0157375_10004094 Ga0157375_100040949 412
290 3300013308 Ga0157375_10029814 Ga0157375_100298143 412
291 3300014325 Ga0163163_10082180 Ga0163163_100821802 412
292 3300014497 Ga0182008_10000018 Ga0182008_10000018163 412
293 3300014497 Ga0182008_10006790 Ga0182008_100067903 412
294 3300014497 Ga0182008_10009150 Ga0182008_100091503 412
295 3300015261 Ga0182006_1009184 Ga0182006_10091846 412
296 3300015262 Ga0182007_10003351 Ga0182007_100033512 412
297 3300015262 Ga0182007_10016478 Ga0182007_100164783 412
298 3300025250 Ga0209026_1000316 Ga0209026_100031622 412
299 3300025907 Ga0207645_10009783 Ga0207645_100097836 412
300 3300025913 Ga0207695_10037467 Ga0207695_100374674 412
301 3300025932 Ga0207690_10000249 Ga0207690_1000024933 412
302 3300025938 Ga0207704_10041433 Ga0207704_100414331 412
303 3300025940 Ga0207691_10210111 Ga0207691_102101112 412
304 3300025941 Ga0207711_10009487 Ga0207711_100094871 412
305 3300025941 Ga0207711_10072440 Ga0207711_100724402 412
306 3300025942 Ga0207689_10101358 Ga0207689_101013581 412
307 3300025972 Ga0207668_10175679 Ga0207668_101756792 412
308 3300026023 Ga0207677_10079852 Ga0207677_100798522 412
309 3300026121 Ga0207683_10031517 Ga0207683_100315173 412
310 3300030744 Ga0316181_1187423 Ga0316181_11874232 412
311 3300031911 Ga0307412_10000077 Ga0307412_1000007751 412
312 3300032004 Ga0307414_10002866 Ga0307414_100028662 412
313 3300032004 Ga0307414_10008019 Ga0307414_100080192 412
314 3300032004 Ga0307414_10018460 Ga0307414_100184602 412
315 3300048907 Ga0496104_0000023 Ga0496104_0000023_70058_71338 412
316 3300048908 Ga0496105_0000019 Ga0496105_0000019_70057_71337 412
317 3300049571 Ga0501034_0000938 Ga0501034_0000938_29962_31239 412
318 3300049758 Ga0501241_001977 Ga0501241_001977_696_1961 412
319 3300053093 Ga0500651_0000127 Ga0500651_0000127_21964_23202 412
320 iso_pu_bacteria 2738541284 2738760972 412
321 iso_pu_bacteria 2775506987 2776613159 412
322 iso_pu_bacteria 2852627209 2852631309 412

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03825

Nuc_H_symport

Nucleoside H+ symporter

27

436

0.96

PF07690

MFS_1

Major Facilitator Superfamily

275

446

0.9

PF12832

MFS_1_like

MFS_1 like family

31

403

0.77

PF01306

LacY_symp

LacY proton/sugar symporter

29

423

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dla-assembly1.cif.gz_A crystal structure of nucleoside transporter nupg (d323a mutant) 0.9703 2 396
7dla-assembly1.cif.gz_A crystal structure of nucleoside transporter nupg (d323a mutant) 0.9467 2 396
7dl9-assembly2.cif.gz_B crystal structure of nucleoside transporter nupg 0.9367 2 398
7dl9-assembly2.cif.gz_B crystal structure of nucleoside transporter nupg 0.9122 2 398
1pv6-assembly2.cif.gz_B crystal structure of lactose permease 0.7929 2 412
ID Description Score Start End Superfamily
af_P45562_195_403_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9855 189 396 1.20.1250.20
af_P0AFF4_5_189_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9727 2 182 1.20.1250.20
af_P45562_195_403_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9715 189 396 1.20.1250.20
af_P45562_4_189_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9635 1 184 1.20.1250.20
af_P0AFF4_5_189_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9368 2 182 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2N5A2Y4-F1-model_v4 MFS transporter 0.9812 2 163 GO:0005886
GO:0015212
GO:0015213
AF-A0A2G6LS05-F1-model_v4 MFS transporter 0.9811 1 400 GO:0005886
GO:0015212
GO:0015213
AF-A0A831DPN5-F1-model_v4 deleted 0.9803 2 175
AF-A0A645A6M0-F1-model_v4 Xanthosine permease 0.98 190 412 GO:0005886
GO:0015212
GO:0015213
AF-A0A6G3HQX5-F1-model_v4 deleted 0.9781 2 352

Feature Viewer

pLDDT pTM Quality
84.5 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map