F406439
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 322 | 195 | 309 | 416 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10016949|Ga0105239_100169495 |
| Length | 452 |
| Sequence | LRCDGSVLYPHRLRLLRPPWHRERLRVSIRLRLIVLSFLEFFIWGSWLLTIGAYWFQNKHWSGTSFGAIFSTMGIAALFMPSLIGIVADRWINAEKLYGLLQLGGALILFAVPTVDNPSTLFWVMLLNMICYMPTISLERTVAYNALKSEGLDVVRDYPPIRVWGTVGFIAALWTVSLLHLETSAGQFYIASGASLVLGLYAFTLPKCPPRLGKGESGRSLIDVLGLSSFRLFKNRNMAVFLIFAMLLGAALQLTNAYGDTFLHDFANVDAYKDTIAVKYPAIIMSISQVSETLFILAIPFFLRRFGIKTVMVISMLAWFLRFGLFAYGDPGGGLWMIILSCIVYGMAFDFFNISGSLFVETQSDPKIRASAQGLFMVMTNGIGAMLGSSISGVIIDRFFTFADKSKDWHGIWITFALYALATAILFVPLFKHKHDPAMMTRDLHPDVKVGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 3 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 4 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 5 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 6 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 7 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 8 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 9 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 10 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 11 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 12 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 13 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 14 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 19 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 20 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 22 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 23 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 119 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 120 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 121 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 124 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 125 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 131 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 132 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 158 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 159 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 162 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 163 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 164 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 165 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 184 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 185 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 188 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 189 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 190 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 191 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 192 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 193 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.96 |
| Metatranscriptomes | 0 |
| Isolates | 4.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.21 |
| Nodule | 0 |
| Rhizoplane | 2.48 |
| Rhizosphere | 83.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1411852 | 2162886007 | Bacteria | 14549 |
| 2 | SwRhRL2b_contig_3065032 | 2162886007 | Bacteria | 1545 |
| 3 | JGI24736J21556_1006391 | 3300001904 | Bacteria | 1984 |
| 4 | JGI24740J21852_10008872 | 3300001979 | Bacteria | 3979 |
| 5 | JGI24739J22299_10005500 | 3300001989 | Bacteria | 4806 |
| 6 | JGI24739J22299_10007925 | 3300001989 | Bacteria | 3974 |
| 7 | JGI24737J22298_10002545 | 3300001990 | Bacteria | 6470 |
| 8 | JGI24735J21928_10000001 | 3300002067 | Bacteria | 650042 |
| 9 | JGI25162J39368_1000024 | 3300002737 | Bacteria | 229507 |
| 10 | JGI25162J39368_1000772 | 3300002737 | Bacteria | 21571 |
| 11 | JGI25162J39368_1000983 | 3300002737 | Bacteria | 18092 |
| 12 | JGI25164J39214_1002143 | 3300002772 | Bacteria | 3313 |
| 13 | JGI25165J46597_1000634 | 3300003214 | Bacteria | 29066 |
| 14 | rootH1_10038419 | 3300003316 | Bacteria | 20328 |
| 15 | rootH2_10005719 | 3300003320 | Bacteria | 108734 |
| 16 | rootH2_10028169 | 3300003320 | Bacteria | 27149 |
| 17 | rootL2_10070215 | 3300003322 | Bacteria | 1721 |
| 18 | rootL2_10070216 | 3300003322 | Bacteria | 4288 |
| 19 | rootH1_10011880 | 3300003323 | Bacteria | 3319 |
| 20 | rootH1_10012862 | 3300003323 | Bacteria | 52977 |
| 21 | rootH1_10025278 | 3300003323 | Bacteria | 5106 |
| 22 | rootH1_10225706 | 3300003323 | Bacteria | 2713 |
| 23 | Ga0065714_10002212 | 3300005288 | Bacteria | 56085 |
| 24 | Ga0065714_10068107 | 3300005288 | Bacteria | 4962 |
| 25 | Ga0065714_10076463 | 3300005288 | Bacteria | 2785 |
| 26 | Ga0065704_10000193 | 3300005289 | Bacteria | 203271 |
| 27 | Ga0070676_10000768 | 3300005328 | Bacteria | 15786 |
| 28 | Ga0070676_10080565 | 3300005328 | Bacteria | 1974 |
| 29 | Ga0070683_100008250 | 3300005329 | Bacteria | 8852 |
| 30 | Ga0070660_100106865 | 3300005339 | Bacteria | 2223 |
| 31 | Ga0070668_100135745 | 3300005347 | Bacteria | 1978 |
| 32 | Ga0070669_100015081 | 3300005353 | Bacteria | 5507 |
| 33 | Ga0070675_100252556 | 3300005354 | Bacteria | 1544 |
| 34 | Ga0070671_100019085 | 3300005355 | Bacteria | 5576 |
| 35 | Ga0070671_100043402 | 3300005355 | Bacteria | 3735 |
| 36 | Ga0070674_100099331 | 3300005356 | Bacteria | 2117 |
| 37 | Ga0070673_100279377 | 3300005364 | Bacteria | 1464 |
| 38 | Ga0070659_100000277 | 3300005366 | Bacteria | 40022 |
| 39 | Ga0070659_100044526 | 3300005366 | Bacteria | 3475 |
| 40 | Ga0070663_100016728 | 3300005455 | Bacteria | 4772 |
| 41 | Ga0070662_100000019 | 3300005457 | Bacteria | 101983 |
| 42 | Ga0070662_100059886 | 3300005457 | Bacteria | 2775 |
| 43 | Ga0068867_100000365 | 3300005459 | Bacteria | 30203 |
| 44 | Ga0070679_100128831 | 3300005530 | Bacteria | 2512 |
| 45 | Ga0068853_100003079 | 3300005539 | Bacteria | 12740 |
| 46 | Ga0068853_100043793 | 3300005539 | Bacteria | 3829 |
| 47 | Ga0070672_100174379 | 3300005543 | Bacteria | 1789 |
| 48 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 49 | Ga0068855_100030112 | 3300005563 | Bacteria | 6491 |
| 50 | Ga0068855_100032782 | 3300005563 | Bacteria | 6202 |
| 51 | Ga0068855_100043872 | 3300005563 | Bacteria | 5295 |
| 52 | Ga0068855_100291929 | 3300005563 | Bacteria | 1807 |
| 53 | Ga0068857_100019572 | 3300005577 | Bacteria | 5946 |
| 54 | Ga0068856_100002428 | 3300005614 | Bacteria | 19174 |
| 55 | Ga0068856_100016362 | 3300005614 | Bacteria | 7176 |
| 56 | Ga0068856_100028324 | 3300005614 | Bacteria | 5470 |
| 57 | Ga0068852_100006520 | 3300005616 | Bacteria | 8439 |
| 58 | Ga0068864_100242708 | 3300005618 | Bacteria | 1669 |
| 59 | Ga0068866_10026818 | 3300005718 | Bacteria | 2726 |
| 60 | Ga0075366_10000141 | 3300006195 | Bacteria | 30278 |
| 61 | Ga0075366_10038269 | 3300006195 | Bacteria | 2833 |
| 62 | Ga0097621_100000507 | 3300006237 | Bacteria | 27254 |
| 63 | Ga0068871_100000436 | 3300006358 | Bacteria | 28724 |
| 64 | Ga0068865_100000580 | 3300006881 | Bacteria | 20503 |
| 65 | Ga0105240_10000039 | 3300009093 | Bacteria | 270117 |
| 66 | Ga0105240_10005708 | 3300009093 | Bacteria | 18466 |
| 67 | Ga0105240_10030918 | 3300009093 | Bacteria | 6954 |
| 68 | Ga0105241_10001252 | 3300009174 | Bacteria | 19362 |
| 69 | Ga0105241_10053342 | 3300009174 | Bacteria | 3091 |
| 70 | Ga0105241_10160573 | 3300009174 | Bacteria | 1847 |
| 71 | Ga0105242_10527964 | 3300009176 | Bacteria | 1127 |
| 72 | Ga0105237_10000193 | 3300009545 | Bacteria | 86593 |
| 73 | Ga0105237_10000531 | 3300009545 | Bacteria | 53648 |
| 74 | Ga0105237_10010464 | 3300009545 | Bacteria | 9863 |
| 75 | Ga0105237_10014902 | 3300009545 | Bacteria | 8109 |
| 76 | Ga0105237_10034406 | 3300009545 | Bacteria | 5130 |
| 77 | Ga0105237_10046577 | 3300009545 | Bacteria | 4361 |
| 78 | Ga0105237_10273038 | 3300009545 | Bacteria | 1693 |
| 79 | Ga0105238_10007379 | 3300009551 | Bacteria | 11014 |
| 80 | Ga0105239_10000005 | 3300010375 | Bacteria | 496066 |
| 81 | Ga0105239_10000013 | 3300010375 | Bacteria | 327371 |
| 82 | Ga0105239_10001734 | 3300010375 | Bacteria | 28748 |
| 83 | Ga0105239_10016949 | 3300010375 | Bacteria | 8054 |
| 84 | Ga0105239_10017129 | 3300010375 | Bacteria | 8011 |
| 85 | Ga0105239_10020184 | 3300010375 | Bacteria | 7351 |
| 86 | Ga0105239_10021049 | 3300010375 | Bacteria | 7197 |
| 87 | Ga0105239_10163508 | 3300010375 | Bacteria | 2488 |
| 88 | Ga0105246_10013392 | 3300011119 | Bacteria | 5141 |
| 89 | Ga0157373_10000037 | 3300013100 | Bacteria | 121670 |
| 90 | Ga0157373_10000121 | 3300013100 | Bacteria | 60158 |
| 91 | Ga0157373_10010155 | 3300013100 | Bacteria | 6936 |
| 92 | Ga0157373_10013396 | 3300013100 | Bacteria | 6016 |
| 93 | Ga0157371_10000426 | 3300013102 | Bacteria | 51710 |
| 94 | Ga0157371_10002257 | 3300013102 | Bacteria | 18604 |
| 95 | Ga0157371_10002317 | 3300013102 | Bacteria | 18296 |
| 96 | Ga0157371_10008168 | 3300013102 | Bacteria | 8368 |
| 97 | Ga0157370_10006844 | 3300013104 | Bacteria | 12487 |
| 98 | Ga0157370_10010216 | 3300013104 | Bacteria | 9911 |
| 99 | Ga0157370_10011991 | 3300013104 | Bacteria | 9031 |
| 100 | Ga0157370_10028651 | 3300013104 | Bacteria | 5476 |
| 101 | Ga0157370_10036657 | 3300013104 | Bacteria | 4757 |
| 102 | Ga0157369_10068749 | 3300013105 | Bacteria | 3805 |
| 103 | Ga0157374_10003331 | 3300013296 | Bacteria | 13505 |
| 104 | Ga0157374_10012666 | 3300013296 | Bacteria | 7344 |
| 105 | Ga0157378_10010353 | 3300013297 | Bacteria | 8140 |
| 106 | Ga0157378_10021016 | 3300013297 | Bacteria | 5742 |
| 107 | Ga0163162_10000083 | 3300013306 | Bacteria | 86303 |
| 108 | Ga0163162_10002693 | 3300013306 | Bacteria | 16851 |
| 109 | Ga0163162_10008070 | 3300013306 | Bacteria | 10274 |
| 110 | Ga0157372_10000001 | 3300013307 | Bacteria | 791349 |
| 111 | Ga0157372_10002422 | 3300013307 | Bacteria | 20196 |
| 112 | Ga0157372_10013982 | 3300013307 | Bacteria | 8575 |
| 113 | Ga0157372_10015014 | 3300013307 | Bacteria | 8289 |
| 114 | Ga0157372_10036090 | 3300013307 | Bacteria | 5447 |
| 115 | Ga0157372_10101419 | 3300013307 | Bacteria | 3286 |
| 116 | Ga0157372_10129010 | 3300013307 | Bacteria | 2908 |
| 117 | Ga0157372_10147276 | 3300013307 | Bacteria | 2715 |
| 118 | Ga0157375_10004094 | 3300013308 | Bacteria | 12640 |
| 119 | Ga0157375_10005554 | 3300013308 | Bacteria | 10973 |
| 120 | Ga0157375_10029814 | 3300013308 | Bacteria | 5135 |
| 121 | Ga0157375_10065324 | 3300013308 | Bacteria | 3627 |
| 122 | Ga0157375_10125486 | 3300013308 | Bacteria | 2681 |
| 123 | Ga0163163_10082180 | 3300014325 | Bacteria | 3225 |
| 124 | Ga0182008_10000018 | 3300014497 | Bacteria | 230609 |
| 125 | Ga0182008_10006790 | 3300014497 | Bacteria | 6367 |
| 126 | Ga0182008_10009150 | 3300014497 | Bacteria | 5360 |
| 127 | Ga0157377_10029508 | 3300014745 | Bacteria | 2962 |
| 128 | Ga0182006_1009184 | 3300015261 | Bacteria | 4442 |
| 129 | Ga0182007_10003351 | 3300015262 | Bacteria | 7576 |
| 130 | Ga0182007_10016464 | 3300015262 | Bacteria | 2727 |
| 131 | Ga0182007_10016478 | 3300015262 | Bacteria | 2725 |
| 132 | Ga0207427_100103 | 3300025231 | Bacteria | 119618 |
| 133 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 134 | Ga0209437_100101 | 3300025233 | Bacteria | 226668 |
| 135 | Ga0209026_1000316 | 3300025250 | Bacteria | 51844 |
| 136 | Ga0209026_1002747 | 3300025250 | Bacteria | 6296 |
| 137 | Ga0209233_1000124 | 3300025261 | Bacteria | 226743 |
| 138 | Ga0209455_1009600 | 3300025272 | Bacteria | 2527 |
| 139 | Ga0207642_10030619 | 3300025899 | Bacteria | 2244 |
| 140 | Ga0207647_10000042 | 3300025904 | Bacteria | 91917 |
| 141 | Ga0207647_10000665 | 3300025904 | Bacteria | 26867 |
| 142 | Ga0207645_10000717 | 3300025907 | Bacteria | 27578 |
| 143 | Ga0207645_10009783 | 3300025907 | Bacteria | 6618 |
| 144 | Ga0207705_10000040 | 3300025909 | Bacteria | 185735 |
| 145 | Ga0207654_10000694 | 3300025911 | Bacteria | 18755 |
| 146 | Ga0207695_10000058 | 3300025913 | Bacteria | 366582 |
| 147 | Ga0207695_10005018 | 3300025913 | Bacteria | 17770 |
| 148 | Ga0207695_10010636 | 3300025913 | Bacteria | 11242 |
| 149 | Ga0207695_10037467 | 3300025913 | Bacteria | 5232 |
| 150 | Ga0207695_10071010 | 3300025913 | Bacteria | 3557 |
| 151 | Ga0207695_10133659 | 3300025913 | Bacteria | 2436 |
| 152 | Ga0207671_10001850 | 3300025914 | Bacteria | 23624 |
| 153 | Ga0207671_10004121 | 3300025914 | Bacteria | 14054 |
| 154 | Ga0207671_10009497 | 3300025914 | Bacteria | 8125 |
| 155 | Ga0207671_10012180 | 3300025914 | Bacteria | 6937 |
| 156 | Ga0207671_10026376 | 3300025914 | Bacteria | 4356 |
| 157 | Ga0207671_10032240 | 3300025914 | Bacteria | 3900 |
| 158 | Ga0207671_10049016 | 3300025914 | Bacteria | 3126 |
| 159 | Ga0207657_10113775 | 3300025919 | Bacteria | 2232 |
| 160 | Ga0207681_10014697 | 3300025923 | Bacteria | 4873 |
| 161 | Ga0207694_10028618 | 3300025924 | Bacteria | 4248 |
| 162 | Ga0207644_10012681 | 3300025931 | Bacteria | 5602 |
| 163 | Ga0207644_10012896 | 3300025931 | Bacteria | 5556 |
| 164 | Ga0207690_10000249 | 3300025932 | Bacteria | 39145 |
| 165 | Ga0207690_10027359 | 3300025932 | Bacteria | 3603 |
| 166 | Ga0207706_10000058 | 3300025933 | Bacteria | 112367 |
| 167 | Ga0207669_10014492 | 3300025937 | Bacteria | 3953 |
| 168 | Ga0207704_10000066 | 3300025938 | Bacteria | 68294 |
| 169 | Ga0207704_10041433 | 3300025938 | Bacteria | 2701 |
| 170 | Ga0207691_10210111 | 3300025940 | Bacteria | 1691 |
| 171 | Ga0207711_10009487 | 3300025941 | Bacteria | 8119 |
| 172 | Ga0207711_10072440 | 3300025941 | Bacteria | 2993 |
| 173 | Ga0207689_10101358 | 3300025942 | Bacteria | 2365 |
| 174 | Ga0207661_10005102 | 3300025944 | Bacteria | 9218 |
| 175 | Ga0207667_10021553 | 3300025949 | Bacteria | 7139 |
| 176 | Ga0207667_10029122 | 3300025949 | Bacteria | 5991 |
| 177 | Ga0207667_10260029 | 3300025949 | Bacteria | 1775 |
| 178 | Ga0207667_10272127 | 3300025949 | Bacteria | 1731 |
| 179 | Ga0207651_10248333 | 3300025960 | Bacteria | 1454 |
| 180 | Ga0207668_10175679 | 3300025972 | Bacteria | 1684 |
| 181 | Ga0207677_10079852 | 3300026023 | Bacteria | 2341 |
| 182 | Ga0207639_10003519 | 3300026041 | Bacteria | 10529 |
| 183 | Ga0207639_10005532 | 3300026041 | Bacteria | 8540 |
| 184 | Ga0207678_10042316 | 3300026067 | Bacteria | 3947 |
| 185 | Ga0207648_10000184 | 3300026089 | Bacteria | 66115 |
| 186 | Ga0207648_10006394 | 3300026089 | Bacteria | 11709 |
| 187 | Ga0207676_10033118 | 3300026095 | Bacteria | 3902 |
| 188 | Ga0207674_10047187 | 3300026116 | Bacteria | 4418 |
| 189 | Ga0207683_10031517 | 3300026121 | Bacteria | 4601 |
| 190 | Ga0207698_10001576 | 3300026142 | Bacteria | 13321 |
| 191 | Ga0209999_1000377 | 3300027543 | Bacteria | 6818 |
| 192 | Ga0209970_1001638 | 3300027614 | Bacteria | 3894 |
| 193 | Ga0209983_1000831 | 3300027665 | Bacteria | 6753 |
| 194 | Ga0209971_1002119 | 3300027682 | Bacteria | 4834 |
| 195 | Ga0209974_10054197 | 3300027876 | Bacteria | 1351 |
| 196 | Ga0268266_10000018 | 3300028379 | Bacteria | 569141 |
| 197 | Ga0268264_10006451 | 3300028381 | Bacteria | 9876 |
| 198 | Ga0307515_10004006 | 3300028794 | Bacteria | 30751 |
| 199 | Ga0316181_1187423 | 3300030744 | Bacteria | 2134 |
| 200 | Ga0307509_10071578 | 3300031507 | Bacteria | 3616 |
| 201 | Ga0307516_10006982 | 3300031730 | Bacteria | 13094 |
| 202 | Ga0307412_10000077 | 3300031911 | Bacteria | 96375 |
| 203 | Ga0307414_10002866 | 3300032004 | Bacteria | 9107 |
| 204 | Ga0307414_10008019 | 3300032004 | Bacteria | 5970 |
| 205 | Ga0307414_10018460 | 3300032004 | Bacteria | 4295 |
| 206 | Ga0316583_10046020 | 3300032133 | Unclassified | 1540 |
| 207 | Ga0307510_10031480 | 3300033180 | Bacteria | 5994 |
| 208 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 209 | Ga0395899_0000232 | 3300037312 | Bacteria | 75259 |
| 210 | Ga0395899_0007068 | 3300037312 | Bacteria | 8688 |
| 211 | Ga0395898_0029478 | 3300037466 | Bacteria | 5497 |
| 212 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 213 | Ga0395905_0219807 | 3300037471 | Bacteria | 1778 |
| 214 | Ga0395901_0000794 | 3300038443 | Bacteria | 35129 |
| 215 | Ga0436365_0867315 | 3300039437 | Bacteria | 3149 |
| 216 | Ga0436361_0045275 | 3300039447 | Bacteria | 16675 |
| 217 | Ga0453684_0015909 | 3300044712 | Bacteria | 11830 |
| 218 | Ga0453684_0016572 | 3300044712 | Bacteria | 11504 |
| 219 | Ga0453684_0053865 | 3300044712 | Bacteria | 5248 |
| 220 | Ga0453684_0272306 | 3300044712 | Bacteria | 1934 |
| 221 | Ga0451576_0016818 | 3300045051 | Bacteria | 8063 |
| 222 | Ga0495641_0083585 | 3300046461 | Bacteria | 1430 |
| 223 | Ga0495650_0000013 | 3300046471 | Bacteria | 611135 |
| 224 | Ga0495585_0000570 | 3300046492 | Bacteria | 34695 |
| 225 | Ga0495585_0002315 | 3300046492 | Bacteria | 13724 |
| 226 | Ga0495607_0014830 | 3300046501 | Bacteria | 5064 |
| 227 | Ga0495583_0124002 | 3300046506 | Bacteria | 1085 |
| 228 | Ga0495606_0000002 | 3300046507 | Bacteria | 554637 |
| 229 | Ga0495606_0011907 | 3300046507 | Bacteria | 7036 |
| 230 | Ga0495606_0016588 | 3300046507 | Bacteria | 5608 |
| 231 | Ga0495606_0054375 | 3300046507 | Bacteria | 2593 |
| 232 | Ga0495610_0009641 | 3300046512 | Bacteria | 6083 |
| 233 | Ga0495616_0004230 | 3300046513 | Bacteria | 9082 |
| 234 | Ga0495616_0023579 | 3300046513 | Bacteria | 3309 |
| 235 | Ga0495632_0060715 | 3300046519 | Bacteria | 1836 |
| 236 | Ga0495644_0034324 | 3300046523 | Bacteria | 1915 |
| 237 | Ga0495648_0009093 | 3300046524 | Bacteria | 7749 |
| 238 | Ga0495648_0048354 | 3300046524 | Bacteria | 2619 |
| 239 | Ga0495609_0053878 | 3300046538 | Bacteria | 1787 |
| 240 | Ga0495633_0000014 | 3300046558 | Bacteria | 261742 |
| 241 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 242 | Ga0495625_0000030 | 3300046660 | Bacteria | 241164 |
| 243 | Ga0495625_0001288 | 3300046660 | Bacteria | 31494 |
| 244 | Ga0495625_0003593 | 3300046660 | Bacteria | 15258 |
| 245 | Ga0495625_0078877 | 3300046660 | Bacteria | 2298 |
| 246 | Ga0495625_0111321 | 3300046660 | Bacteria | 1871 |
| 247 | Ga0495661_0006905 | 3300046665 | Bacteria | 7938 |
| 248 | Ga0495661_0113848 | 3300046665 | Bacteria | 1504 |
| 249 | Ga0495658_0051505 | 3300046683 | Bacteria | 2332 |
| 250 | Ga0495649_0000041 | 3300046694 | Bacteria | 125049 |
| 251 | Ga0495660_0017062 | 3300046810 | Bacteria | 4181 |
| 252 | Ga0495687_003402 | 3300047443 | Bacteria | 11586 |
| 253 | Ga0495687_007675 | 3300047443 | Bacteria | 6307 |
| 254 | Ga0495686_0000693 | 3300047472 | Bacteria | 45522 |
| 255 | Ga0495686_0003550 | 3300047472 | Bacteria | 13418 |
| 256 | Ga0495686_0005021 | 3300047472 | Bacteria | 10625 |
| 257 | Ga0495614_0011185 | 3300048089 | Bacteria | 3949 |
| 258 | Ga0496101_0059790 | 3300048904 | Bacteria | 2763 |
| 259 | Ga0496104_0000023 | 3300048907 | Bacteria | 236818 |
| 260 | Ga0496105_0000019 | 3300048908 | Bacteria | 185293 |
| 261 | Ga0496108_0100044 | 3300048911 | Bacteria | 2472 |
| 262 | Ga0496109_0039543 | 3300048912 | Bacteria | 4269 |
| 263 | Ga0496113_0071675 | 3300048916 | Bacteria | 2635 |
| 264 | Ga0496115_0000515 | 3300048918 | Bacteria | 30051 |
| 265 | Ga0496118_0017713 | 3300048921 | Bacteria | 6467 |
| 266 | Ga0496126_0000087 | 3300048929 | Bacteria | 215031 |
| 267 | Ga0501032_0011320 | 3300049569 | Bacteria | 6406 |
| 268 | Ga0501032_0068933 | 3300049569 | Bacteria | 2360 |
| 269 | Ga0501033_0001011 | 3300049570 | Bacteria | 25534 |
| 270 | Ga0501034_0000938 | 3300049571 | Bacteria | 42430 |
| 271 | Ga0501034_0020662 | 3300049571 | Bacteria | 6725 |
| 272 | Ga0501034_0140106 | 3300049571 | Bacteria | 2398 |
| 273 | Ga0501034_0311835 | 3300049571 | Bacteria | 1507 |
| 274 | Ga0501037_0034441 | 3300049573 | Bacteria | 3737 |
| 275 | Ga0501038_0006952 | 3300049574 | Bacteria | 10445 |
| 276 | Ga0501039_0018069 | 3300049575 | Bacteria | 5411 |
| 277 | Ga0501043_0019646 | 3300049579 | Bacteria | 5304 |
| 278 | Ga0501047_0029463 | 3300049581 | Bacteria | 5292 |
| 279 | Ga0501047_0043718 | 3300049581 | Bacteria | 4327 |
| 280 | Ga0501068_0010390 | 3300049584 | Bacteria | 5229 |
| 281 | Ga0501069_0009086 | 3300049585 | Bacteria | 5244 |
| 282 | Ga0501070_0007283 | 3300049586 | Bacteria | 9393 |
| 283 | Ga0501070_0026873 | 3300049586 | Bacteria | 4827 |
| 284 | Ga0501072_0011395 | 3300049588 | Bacteria | 6796 |
| 285 | Ga0501073_0001139 | 3300049589 | Bacteria | 19341 |
| 286 | Ga0501074_0021337 | 3300049590 | Bacteria | 4703 |
| 287 | Ga0501074_0131618 | 3300049590 | Bacteria | 1789 |
| 288 | Ga0501223_012834 | 3300049663 | Bacteria | 1673 |
| 289 | Ga0501079_0128309 | 3300049741 | Bacteria | 1973 |
| 290 | Ga0501080_0001231 | 3300049742 | Bacteria | 21291 |
| 291 | Ga0501080_0032883 | 3300049742 | Bacteria | 4839 |
| 292 | Ga0501083_0000496 | 3300049744 | Bacteria | 25186 |
| 293 | Ga0501241_001977 | 3300049758 | Bacteria | 4022 |
| 294 | Ga0501268_002940 | 3300049765 | Bacteria | 2291 |
| 295 | Ga0501035_0046264 | 3300049822 | Bacteria | 3914 |
| 296 | Ga0501035_0103438 | 3300049822 | Bacteria | 2498 |
| 297 | Ga0501044_0005539 | 3300049823 | Bacteria | 14015 |
| 298 | Ga0501044_0026511 | 3300049823 | Bacteria | 6134 |
| 299 | Ga0501044_0060436 | 3300049823 | Bacteria | 3880 |
| 300 | nmdc:mga0k408_1566_c1 | 3300050493 | Bacteria | 10893 |
| 301 | nmdc:mga0k408_450_c1 | 3300050493 | Bacteria | 22539 |
| 302 | nmdc:mga0k408_52922_c1 | 3300050493 | Bacteria | 2353 |
| 303 | Ga0500635_0000656 | 3300053080 | Bacteria | 8805 |
| 304 | Ga0500651_0000127 | 3300053093 | Bacteria | 47010 |
| 305 | Ga0500618_000001 | 3300053125 | Bacteria | 538477 |
| 306 | Ga0500561_0034954 | 3300053137 | Bacteria | 1294 |
| 307 | Ga0500624_000356 | 3300053157 | Bacteria | 14836 |
| 308 | Ga0501084_0104311 | 3300054114 | Bacteria | 2381 |
| 309 | Ga0501082_0291262 | 3300060353 | Bacteria | 1421 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046506 | Ga0495583_0124002 | Ga0495583_0124002_22_1059 | 345 |
| 2 | 3300046683 | Ga0495658_0051505 | Ga0495658_0051505_27_1064 | 345 |
| 3 | 3300044712 | Ga0453684_0053865 | Ga0453684_0053865_62_1321 | 357 |
| 4 | 3300045051 | Ga0451576_0016818 | Ga0451576_0016818_5548_6807 | 361 |
| 5 | 3300009176 | Ga0105242_10527964 | Ga0105242_105279641 | 363 |
| 6 | 3300015262 | Ga0182007_10016464 | Ga0182007_100164643 | 368 |
| 7 | 3300049569 | Ga0501032_0011320 | Ga0501032_0011320_14_1132 | 372 |
| 8 | 3300053137 | Ga0500561_0034954 | Ga0500561_0034954_111_1232 | 373 |
| 9 | 3300033180 | Ga0307510_10031480 | Ga0307510_100314802 | 393 |
| 10 | 3300005366 | Ga0070659_100044526 | Ga0070659_1000445263 | 394 |
| 11 | 3300005577 | Ga0068857_100019572 | Ga0068857_1000195724 | 394 |
| 12 | 3300013100 | Ga0157373_10010155 | Ga0157373_100101557 | 394 |
| 13 | 3300013102 | Ga0157371_10002257 | Ga0157371_100022578 | 394 |
| 14 | 3300013104 | Ga0157370_10010216 | Ga0157370_100102166 | 394 |
| 15 | 3300013307 | Ga0157372_10013982 | Ga0157372_100139823 | 394 |
| 16 | 3300025904 | Ga0207647_10000665 | Ga0207647_1000066522 | 394 |
| 17 | 3300025932 | Ga0207690_10027359 | Ga0207690_100273593 | 394 |
| 18 | 3300026116 | Ga0207674_10047187 | Ga0207674_100471872 | 394 |
| 19 | 3300037471 | Ga0395905_0219807 | Ga0395905_0219807_84_1343 | 394 |
| 20 | 3300053080 | Ga0500635_0000656 | Ga0500635_0000656_5672_6931 | 394 |
| 21 | 3300046660 | Ga0495625_0078877 | Ga0495625_0078877_84_1307 | 395 |
| 22 | 3300039447 | Ga0436361_0045275 | Ga0436361_0045275_418_1650 | 396 |
| 23 | 3300053157 | Ga0500624_000356 | Ga0500624_000356_8841_10064 | 396 |
| 24 | 3300046519 | Ga0495632_0060715 | Ga0495632_0060715_394_1626 | 397 |
| 25 | 3300050493 | nmdc:mga0k408_1566_c1 | nmdc:mga0k408_1566_c1_9226_10458 | 397 |
| 26 | 3300002737 | JGI25162J39368_1000024 | JGI25162J39368_10000249 | 398 |
| 27 | 3300005563 | Ga0068855_100030112 | Ga0068855_1000301123 | 398 |
| 28 | 3300009093 | Ga0105240_10005708 | Ga0105240_100057087 | 398 |
| 29 | 3300009545 | Ga0105237_10273038 | Ga0105237_102730381 | 398 |
| 30 | 3300010375 | Ga0105239_10001734 | Ga0105239_1000173417 | 398 |
| 31 | 3300010375 | Ga0105239_10163508 | Ga0105239_101635081 | 398 |
| 32 | 3300025233 | Ga0209437_100017 | Ga0209437_1000179 | 398 |
| 33 | 3300025913 | Ga0207695_10005018 | Ga0207695_100050185 | 398 |
| 34 | 3300025914 | Ga0207671_10026376 | Ga0207671_100263762 | 398 |
| 35 | 3300025949 | Ga0207667_10021553 | Ga0207667_100215533 | 398 |
| 36 | 3300025949 | Ga0207667_10260029 | Ga0207667_102600291 | 398 |
| 37 | 3300044712 | Ga0453684_0016572 | Ga0453684_0016572_1621_2880 | 399 |
| 38 | 3300049765 | Ga0501268_002940 | Ga0501268_002940_778_2028 | 399 |
| 39 | 3300046507 | Ga0495606_0016588 | Ga0495606_0016588_3842_5101 | 400 |
| 40 | 3300046810 | Ga0495660_0017062 | Ga0495660_0017062_1648_2907 | 400 |
| 41 | 3300046524 | Ga0495648_0048354 | Ga0495648_0048354_310_1569 | 401 |
| 42 | 3300046660 | Ga0495625_0111321 | Ga0495625_0111321_11_1222 | 403 |
| 43 | 3300046501 | Ga0495607_0014830 | Ga0495607_0014830_2431_3675 | 404 |
| 44 | 3300005329 | Ga0070683_100008250 | Ga0070683_1000082504 | 405 |
| 45 | 3300013100 | Ga0157373_10000037 | Ga0157373_1000003761 | 405 |
| 46 | 3300013307 | Ga0157372_10036090 | Ga0157372_100360904 | 405 |
| 47 | 3300025944 | Ga0207661_10005102 | Ga0207661_100051028 | 405 |
| 48 | 3300005539 | Ga0068853_100043793 | Ga0068853_1000437933 | 407 |
| 49 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_1066338_1067564 | 407 |
| 50 | 3300046507 | Ga0495606_0054375 | Ga0495606_0054375_1028_2251 | 407 |
| 51 | 3300046558 | Ga0495633_0000014 | Ga0495633_0000014_114833_116056 | 407 |
| 52 | 3300046665 | Ga0495661_0006905 | Ga0495661_0006905_2359_3582 | 407 |
| 53 | 3300046665 | Ga0495661_0113848 | Ga0495661_0113848_143_1366 | 407 |
| 54 | iso_pu_bacteria | 2896344016 | 2896346679 | 407 |
| 55 | 3300037471 | Ga0395905_0000001 | Ga0395905_0000001_438572_439825 | 408 |
| 56 | 3300044712 | Ga0453684_0272306 | Ga0453684_0272306_614_1840 | 408 |
| 57 | iso_pu_bacteria | 8002869464 | 8002869776 | 408 |
| 58 | 3300005530 | Ga0070679_100128831 | Ga0070679_1001288313 | 409 |
| 59 | 3300032133 | Ga0316583_10046020 | Ga0316583_100460201 | 409 |
| 60 | 3300044712 | Ga0453684_0015909 | Ga0453684_0015909_7702_8958 | 409 |
| 61 | 3300047472 | Ga0495686_0005021 | Ga0495686_0005021_980_2236 | 409 |
| 62 | 3300049571 | Ga0501034_0020662 | Ga0501034_0020662_4138_5394 | 409 |
| 63 | 3300049573 | Ga0501037_0034441 | Ga0501037_0034441_1123_2379 | 409 |
| 64 | 3300049574 | Ga0501038_0006952 | Ga0501038_0006952_7272_8528 | 409 |
| 65 | 3300049581 | Ga0501047_0029463 | Ga0501047_0029463_2338_3594 | 409 |
| 66 | 3300049584 | Ga0501068_0010390 | Ga0501068_0010390_1362_2618 | 409 |
| 67 | 3300049585 | Ga0501069_0009086 | Ga0501069_0009086_2215_3471 | 409 |
| 68 | 3300049586 | Ga0501070_0026873 | Ga0501070_0026873_3494_4750 | 409 |
| 69 | 3300049588 | Ga0501072_0011395 | Ga0501072_0011395_2820_4076 | 409 |
| 70 | 3300049589 | Ga0501073_0001139 | Ga0501073_0001139_8128_9384 | 409 |
| 71 | 3300049590 | Ga0501074_0131618 | Ga0501074_0131618_370_1626 | 409 |
| 72 | 3300049741 | Ga0501079_0128309 | Ga0501079_0128309_185_1441 | 409 |
| 73 | 3300049742 | Ga0501080_0001231 | Ga0501080_0001231_15830_17086 | 409 |
| 74 | 3300049744 | Ga0501083_0000496 | Ga0501083_0000496_14473_15729 | 409 |
| 75 | 3300049822 | Ga0501035_0046264 | Ga0501035_0046264_2100_3356 | 409 |
| 76 | 3300049823 | Ga0501044_0005539 | Ga0501044_0005539_10403_11659 | 409 |
| 77 | 3300054114 | Ga0501084_0104311 | Ga0501084_0104311_989_2245 | 409 |
| 78 | 3300060353 | Ga0501082_0291262 | Ga0501082_0291262_179_1408 | 409 |
| 79 | 3300001904 | JGI24736J21556_1006391 | JGI24736J21556_10063912 | 410 |
| 80 | 3300001979 | JGI24740J21852_10008872 | JGI24740J21852_100088722 | 410 |
| 81 | 3300001989 | JGI24739J22299_10005500 | JGI24739J22299_100055003 | 410 |
| 82 | 3300001989 | JGI24739J22299_10007925 | JGI24739J22299_100079253 | 410 |
| 83 | 3300001990 | JGI24737J22298_10002545 | JGI24737J22298_100025458 | 410 |
| 84 | 3300002067 | JGI24735J21928_10000001 | JGI24735J21928_100000019 | 410 |
| 85 | 3300002737 | JGI25162J39368_1000772 | JGI25162J39368_10007728 | 410 |
| 86 | 3300002737 | JGI25162J39368_1000983 | JGI25162J39368_10009839 | 410 |
| 87 | 3300002772 | JGI25164J39214_1002143 | JGI25164J39214_10021433 | 410 |
| 88 | 3300003214 | JGI25165J46597_1000634 | JGI25165J46597_10006348 | 410 |
| 89 | 3300003316 | rootH1_10038419 | rootH1_1003841914 | 410 |
| 90 | 3300003320 | rootH2_10005719 | rootH2_100057198 | 410 |
| 91 | 3300003320 | rootH2_10028169 | rootH2_1002816910 | 410 |
| 92 | 3300003322 | rootL2_10070215 | rootL2_100702151 | 410 |
| 93 | 3300003322 | rootL2_10070216 | rootL2_100702163 | 410 |
| 94 | 3300003323 | rootH1_10011880 | rootH1_100118802 | 410 |
| 95 | 3300003323 | rootH1_10012862 | rootH1_1001286211 | 410 |
| 96 | 3300003323 | rootH1_10025278 | rootH1_100252782 | 410 |
| 97 | 3300003323 | rootH1_10225706 | rootH1_102257061 | 410 |
| 98 | 3300005288 | Ga0065714_10076463 | Ga0065714_100764632 | 410 |
| 99 | 3300005328 | Ga0070676_10000768 | Ga0070676_100007684 | 410 |
| 100 | 3300005339 | Ga0070660_100106865 | Ga0070660_1001068652 | 410 |
| 101 | 3300005355 | Ga0070671_100019085 | Ga0070671_1000190852 | 410 |
| 102 | 3300005356 | Ga0070674_100099331 | Ga0070674_1000993311 | 410 |
| 103 | 3300005364 | Ga0070673_100279377 | Ga0070673_1002793771 | 410 |
| 104 | 3300005455 | Ga0070663_100016728 | Ga0070663_1000167283 | 410 |
| 105 | 3300005457 | Ga0070662_100000019 | Ga0070662_10000001937 | 410 |
| 106 | 3300005459 | Ga0068867_100000365 | Ga0068867_1000003656 | 410 |
| 107 | 3300005539 | Ga0068853_100003079 | Ga0068853_1000030797 | 410 |
| 108 | 3300005548 | Ga0070665_100000003 | Ga0070665_100000003766 | 410 |
| 109 | 3300005563 | Ga0068855_100032782 | Ga0068855_1000327823 | 410 |
| 110 | 3300005563 | Ga0068855_100043872 | Ga0068855_1000438723 | 410 |
| 111 | 3300005614 | Ga0068856_100016362 | Ga0068856_1000163625 | 410 |
| 112 | 3300005614 | Ga0068856_100028324 | Ga0068856_1000283244 | 410 |
| 113 | 3300005616 | Ga0068852_100006520 | Ga0068852_1000065204 | 410 |
| 114 | 3300005718 | Ga0068866_10026818 | Ga0068866_100268183 | 410 |
| 115 | 3300006195 | Ga0075366_10000141 | Ga0075366_1000014126 | 410 |
| 116 | 3300006195 | Ga0075366_10038269 | Ga0075366_100382692 | 410 |
| 117 | 3300006237 | Ga0097621_100000507 | Ga0097621_1000005076 | 410 |
| 118 | 3300006358 | Ga0068871_100000436 | Ga0068871_10000043611 | 410 |
| 119 | 3300006881 | Ga0068865_100000580 | Ga0068865_1000005803 | 410 |
| 120 | 3300009093 | Ga0105240_10000039 | Ga0105240_10000039170 | 410 |
| 121 | 3300009174 | Ga0105241_10001252 | Ga0105241_100012526 | 410 |
| 122 | 3300009174 | Ga0105241_10053342 | Ga0105241_100533423 | 410 |
| 123 | 3300009174 | Ga0105241_10160573 | Ga0105241_101605731 | 410 |
| 124 | 3300009545 | Ga0105237_10000193 | Ga0105237_1000019320 | 410 |
| 125 | 3300009545 | Ga0105237_10000531 | Ga0105237_100005312 | 410 |
| 126 | 3300009545 | Ga0105237_10010464 | Ga0105237_100104646 | 410 |
| 127 | 3300009545 | Ga0105237_10014902 | Ga0105237_100149024 | 410 |
| 128 | 3300009545 | Ga0105237_10034406 | Ga0105237_100344064 | 410 |
| 129 | 3300009545 | Ga0105237_10046577 | Ga0105237_100465773 | 410 |
| 130 | 3300009551 | Ga0105238_10007379 | Ga0105238_100073796 | 410 |
| 131 | 3300010375 | Ga0105239_10000013 | Ga0105239_1000001390 | 410 |
| 132 | 3300010375 | Ga0105239_10017129 | Ga0105239_100171296 | 410 |
| 133 | 3300010375 | Ga0105239_10020184 | Ga0105239_100201843 | 410 |
| 134 | 3300011119 | Ga0105246_10013392 | Ga0105246_100133923 | 410 |
| 135 | 3300013100 | Ga0157373_10013396 | Ga0157373_100133967 | 410 |
| 136 | 3300013102 | Ga0157371_10008168 | Ga0157371_100081688 | 410 |
| 137 | 3300013105 | Ga0157369_10068749 | Ga0157369_100687492 | 410 |
| 138 | 3300013296 | Ga0157374_10003331 | Ga0157374_100033318 | 410 |
| 139 | 3300013297 | Ga0157378_10010353 | Ga0157378_100103534 | 410 |
| 140 | 3300013297 | Ga0157378_10021016 | Ga0157378_100210162 | 410 |
| 141 | 3300013306 | Ga0163162_10000083 | Ga0163162_1000008348 | 410 |
| 142 | 3300013306 | Ga0163162_10008070 | Ga0163162_100080702 | 410 |
| 143 | 3300013307 | Ga0157372_10000001 | Ga0157372_10000001128 | 410 |
| 144 | 3300013307 | Ga0157372_10002422 | Ga0157372_100024223 | 410 |
| 145 | 3300013307 | Ga0157372_10015014 | Ga0157372_100150144 | 410 |
| 146 | 3300013307 | Ga0157372_10101419 | Ga0157372_101014192 | 410 |
| 147 | 3300013307 | Ga0157372_10147276 | Ga0157372_101472763 | 410 |
| 148 | 3300013308 | Ga0157375_10065324 | Ga0157375_100653242 | 410 |
| 149 | 3300013308 | Ga0157375_10125486 | Ga0157375_101254862 | 410 |
| 150 | 3300014745 | Ga0157377_10029508 | Ga0157377_100295082 | 410 |
| 151 | 3300025231 | Ga0207427_100103 | Ga0207427_100103131 | 410 |
| 152 | 3300025233 | Ga0209437_100101 | Ga0209437_100101152 | 410 |
| 153 | 3300025250 | Ga0209026_1002747 | Ga0209026_10027476 | 410 |
| 154 | 3300025261 | Ga0209233_1000124 | Ga0209233_100012485 | 410 |
| 155 | 3300025272 | Ga0209455_1009600 | Ga0209455_10096003 | 410 |
| 156 | 3300025899 | Ga0207642_10030619 | Ga0207642_100306191 | 410 |
| 157 | 3300025904 | Ga0207647_10000042 | Ga0207647_1000004213 | 410 |
| 158 | 3300025907 | Ga0207645_10000717 | Ga0207645_1000071710 | 410 |
| 159 | 3300025909 | Ga0207705_10000040 | Ga0207705_1000004097 | 410 |
| 160 | 3300025911 | Ga0207654_10000694 | Ga0207654_1000069411 | 410 |
| 161 | 3300025913 | Ga0207695_10000058 | Ga0207695_1000005834 | 410 |
| 162 | 3300025913 | Ga0207695_10010636 | Ga0207695_100106368 | 410 |
| 163 | 3300025913 | Ga0207695_10071010 | Ga0207695_100710103 | 410 |
| 164 | 3300025913 | Ga0207695_10133659 | Ga0207695_101336591 | 410 |
| 165 | 3300025914 | Ga0207671_10001850 | Ga0207671_100018505 | 410 |
| 166 | 3300025914 | Ga0207671_10004121 | Ga0207671_100041217 | 410 |
| 167 | 3300025914 | Ga0207671_10009497 | Ga0207671_100094972 | 410 |
| 168 | 3300025914 | Ga0207671_10012180 | Ga0207671_100121802 | 410 |
| 169 | 3300025914 | Ga0207671_10049016 | Ga0207671_100490161 | 410 |
| 170 | 3300025919 | Ga0207657_10113775 | Ga0207657_101137752 | 410 |
| 171 | 3300025924 | Ga0207694_10028618 | Ga0207694_100286184 | 410 |
| 172 | 3300025931 | Ga0207644_10012681 | Ga0207644_100126816 | 410 |
| 173 | 3300025931 | Ga0207644_10012896 | Ga0207644_100128963 | 410 |
| 174 | 3300025933 | Ga0207706_10000058 | Ga0207706_1000005837 | 410 |
| 175 | 3300025937 | Ga0207669_10014492 | Ga0207669_100144922 | 410 |
| 176 | 3300025938 | Ga0207704_10000066 | Ga0207704_1000006633 | 410 |
| 177 | 3300025949 | Ga0207667_10029122 | Ga0207667_100291225 | 410 |
| 178 | 3300025949 | Ga0207667_10272127 | Ga0207667_102721272 | 410 |
| 179 | 3300025960 | Ga0207651_10248333 | Ga0207651_102483332 | 410 |
| 180 | 3300026041 | Ga0207639_10003519 | Ga0207639_100035199 | 410 |
| 181 | 3300026041 | Ga0207639_10005532 | Ga0207639_100055325 | 410 |
| 182 | 3300026067 | Ga0207678_10042316 | Ga0207678_100423163 | 410 |
| 183 | 3300026089 | Ga0207648_10000184 | Ga0207648_100001847 | 410 |
| 184 | 3300026142 | Ga0207698_10001576 | Ga0207698_100015768 | 410 |
| 185 | 3300028379 | Ga0268266_10000018 | Ga0268266_1000001886 | 410 |
| 186 | 3300028794 | Ga0307515_10004006 | Ga0307515_1000400615 | 410 |
| 187 | 3300031507 | Ga0307509_10071578 | Ga0307509_100715783 | 410 |
| 188 | 3300037312 | Ga0395899_0000232 | Ga0395899_0000232_39805_41064 | 410 |
| 189 | 3300037312 | Ga0395899_0007068 | Ga0395899_0007068_5786_7018 | 410 |
| 190 | 3300037466 | Ga0395898_0029478 | Ga0395898_0029478_1304_2536 | 410 |
| 191 | 3300038443 | Ga0395901_0000794 | Ga0395901_0000794_23982_25214 | 410 |
| 192 | 3300046461 | Ga0495641_0083585 | Ga0495641_0083585_75_1334 | 410 |
| 193 | 3300046471 | Ga0495650_0000013 | Ga0495650_0000013_513074_514333 | 410 |
| 194 | 3300046492 | Ga0495585_0000570 | Ga0495585_0000570_22656_23915 | 410 |
| 195 | 3300046492 | Ga0495585_0002315 | Ga0495585_0002315_7269_8528 | 410 |
| 196 | 3300046507 | Ga0495606_0000002 | Ga0495606_0000002_71717_72976 | 410 |
| 197 | 3300046507 | Ga0495606_0011907 | Ga0495606_0011907_4357_5589 | 410 |
| 198 | 3300046512 | Ga0495610_0009641 | Ga0495610_0009641_932_2164 | 410 |
| 199 | 3300046513 | Ga0495616_0004230 | Ga0495616_0004230_3837_5096 | 410 |
| 200 | 3300046513 | Ga0495616_0023579 | Ga0495616_0023579_962_2221 | 410 |
| 201 | 3300046523 | Ga0495644_0034324 | Ga0495644_0034324_311_1543 | 410 |
| 202 | 3300046524 | Ga0495648_0009093 | Ga0495648_0009093_4896_6155 | 410 |
| 203 | 3300046538 | Ga0495609_0053878 | Ga0495609_0053878_427_1686 | 410 |
| 204 | 3300046616 | Ga0495668_0000003 | Ga0495668_0000003_501943_503202 | 410 |
| 205 | 3300046660 | Ga0495625_0000030 | Ga0495625_0000030_142782_144041 | 410 |
| 206 | 3300046660 | Ga0495625_0001288 | Ga0495625_0001288_23570_24829 | 410 |
| 207 | 3300046660 | Ga0495625_0003593 | Ga0495625_0003593_10129_11388 | 410 |
| 208 | 3300046694 | Ga0495649_0000041 | Ga0495649_0000041_97162_98421 | 410 |
| 209 | 3300047443 | Ga0495687_003402 | Ga0495687_003402_3351_4610 | 410 |
| 210 | 3300047443 | Ga0495687_007675 | Ga0495687_007675_2541_3800 | 410 |
| 211 | 3300047472 | Ga0495686_0000693 | Ga0495686_0000693_36810_38042 | 410 |
| 212 | 3300047472 | Ga0495686_0003550 | Ga0495686_0003550_3661_4893 | 410 |
| 213 | 3300048089 | Ga0495614_0011185 | Ga0495614_0011185_1894_3153 | 410 |
| 214 | 3300048904 | Ga0496101_0059790 | Ga0496101_0059790_835_2127 | 410 |
| 215 | 3300048911 | Ga0496108_0100044 | Ga0496108_0100044_685_1977 | 410 |
| 216 | 3300048912 | Ga0496109_0039543 | Ga0496109_0039543_736_2028 | 410 |
| 217 | 3300048916 | Ga0496113_0071675 | Ga0496113_0071675_591_1883 | 410 |
| 218 | 3300049663 | Ga0501223_012834 | Ga0501223_012834_243_1526 | 410 |
| 219 | 3300050493 | nmdc:mga0k408_450_c1 | nmdc:mga0k408_450_c1_13636_14895 | 410 |
| 220 | 3300050493 | nmdc:mga0k408_52922_c1 | nmdc:mga0k408_52922_c1_1057_2289 | 410 |
| 221 | 3300053125 | Ga0500618_000001 | Ga0500618_000001_201598_202857 | 410 |
| 222 | iso_pu_bacteria | 2599185184 | 2599477589 | 410 |
| 223 | iso_pu_bacteria | 2852623160 | 2852623505 | 410 |
| 224 | iso_pu_bacteria | 2884933994 | 2884937594 | 410 |
| 225 | iso_pu_bacteria | 2919437846 | 2919440953 | 410 |
| 226 | iso_pu_bacteria | 2928078545 | 2928079500 | 410 |
| 227 | iso_pu_bacteria | 2928147474 | 2928148016 | 410 |
| 228 | iso_pu_bacteria | 2932082852 | 2932083909 | 410 |
| 229 | iso_pu_bacteria | 2977232053 | 2977232815 | 410 |
| 230 | 3300005328 | Ga0070676_10080565 | Ga0070676_100805651 | 411 |
| 231 | 3300005353 | Ga0070669_100015081 | Ga0070669_1000150812 | 411 |
| 232 | 3300005354 | Ga0070675_100252556 | Ga0070675_1002525562 | 411 |
| 233 | 3300005457 | Ga0070662_100059886 | Ga0070662_1000598861 | 411 |
| 234 | 3300005563 | Ga0068855_100291929 | Ga0068855_1002919292 | 411 |
| 235 | 3300005614 | Ga0068856_100002428 | Ga0068856_10000242812 | 411 |
| 236 | 3300005618 | Ga0068864_100242708 | Ga0068864_1002427082 | 411 |
| 237 | 3300010375 | Ga0105239_10021049 | Ga0105239_100210495 | 411 |
| 238 | 3300013104 | Ga0157370_10028651 | Ga0157370_100286514 | 411 |
| 239 | 3300013296 | Ga0157374_10012666 | Ga0157374_100126665 | 411 |
| 240 | 3300013308 | Ga0157375_10005554 | Ga0157375_100055542 | 411 |
| 241 | 3300025914 | Ga0207671_10032240 | Ga0207671_100322403 | 411 |
| 242 | 3300025923 | Ga0207681_10014697 | Ga0207681_100146973 | 411 |
| 243 | 3300026089 | Ga0207648_10006394 | Ga0207648_100063949 | 411 |
| 244 | 3300026095 | Ga0207676_10033118 | Ga0207676_100331182 | 411 |
| 245 | 3300027543 | Ga0209999_1000377 | Ga0209999_10003774 | 411 |
| 246 | 3300027614 | Ga0209970_1001638 | Ga0209970_10016382 | 411 |
| 247 | 3300027665 | Ga0209983_1000831 | Ga0209983_10008311 | 411 |
| 248 | 3300027682 | Ga0209971_1002119 | Ga0209971_10021193 | 411 |
| 249 | 3300027876 | Ga0209974_10054197 | Ga0209974_100541971 | 411 |
| 250 | 3300028381 | Ga0268264_10006451 | Ga0268264_100064517 | 411 |
| 251 | 3300031730 | Ga0307516_10006982 | Ga0307516_100069827 | 411 |
| 252 | 3300039437 | Ga0436365_0867315 | Ga0436365_0867315_615_1919 | 411 |
| 253 | 3300048918 | Ga0496115_0000515 | Ga0496115_0000515_22500_23846 | 411 |
| 254 | 3300048921 | Ga0496118_0017713 | Ga0496118_0017713_2476_3750 | 411 |
| 255 | 3300048929 | Ga0496126_0000087 | Ga0496126_0000087_122883_124229 | 411 |
| 256 | 3300049569 | Ga0501032_0068933 | Ga0501032_0068933_765_2042 | 411 |
| 257 | 3300049570 | Ga0501033_0001011 | Ga0501033_0001011_23959_25248 | 411 |
| 258 | 3300049571 | Ga0501034_0140106 | Ga0501034_0140106_722_1972 | 411 |
| 259 | 3300049571 | Ga0501034_0311835 | Ga0501034_0311835_24_1301 | 411 |
| 260 | 3300049575 | Ga0501039_0018069 | Ga0501039_0018069_536_1813 | 411 |
| 261 | 3300049579 | Ga0501043_0019646 | Ga0501043_0019646_2169_3419 | 411 |
| 262 | 3300049581 | Ga0501047_0043718 | Ga0501047_0043718_722_1972 | 411 |
| 263 | 3300049586 | Ga0501070_0007283 | Ga0501070_0007283_282_1532 | 411 |
| 264 | 3300049590 | Ga0501074_0021337 | Ga0501074_0021337_581_1831 | 411 |
| 265 | 3300049742 | Ga0501080_0032883 | Ga0501080_0032883_3035_4285 | 411 |
| 266 | 3300049822 | Ga0501035_0103438 | Ga0501035_0103438_864_2141 | 411 |
| 267 | 3300049823 | Ga0501044_0026511 | Ga0501044_0026511_1385_2635 | 411 |
| 268 | 3300049823 | Ga0501044_0060436 | Ga0501044_0060436_2011_3288 | 411 |
| 269 | 2162886007 | SwRhRL2b_contig_1411852 | SwRhRL2b_0097.00004820 | 412 |
| 270 | 2162886007 | SwRhRL2b_contig_3065032 | SwRhRL2b_0791.00004310 | 412 |
| 271 | 3300005288 | Ga0065714_10002212 | Ga0065714_1000221240 | 412 |
| 272 | 3300005288 | Ga0065714_10068107 | Ga0065714_100681072 | 412 |
| 273 | 3300005289 | Ga0065704_10000193 | Ga0065704_1000019338 | 412 |
| 274 | 3300005347 | Ga0070668_100135745 | Ga0070668_1001357452 | 412 |
| 275 | 3300005355 | Ga0070671_100043402 | Ga0070671_1000434022 | 412 |
| 276 | 3300005366 | Ga0070659_100000277 | Ga0070659_1000002779 | 412 |
| 277 | 3300005543 | Ga0070672_100174379 | Ga0070672_1001743792 | 412 |
| 278 | 3300009093 | Ga0105240_10030918 | Ga0105240_100309186 | 412 |
| 279 | 3300010375 | Ga0105239_10000005 | Ga0105239_10000005111 | 412 |
| 280 | 3300010375 | Ga0105239_10016949 | Ga0105239_100169495 | 412 |
| 281 | 3300013100 | Ga0157373_10000121 | Ga0157373_1000012139 | 412 |
| 282 | 3300013102 | Ga0157371_10000426 | Ga0157371_100004264 | 412 |
| 283 | 3300013102 | Ga0157371_10002317 | Ga0157371_1000231711 | 412 |
| 284 | 3300013104 | Ga0157370_10006844 | Ga0157370_100068443 | 412 |
| 285 | 3300013104 | Ga0157370_10011991 | Ga0157370_100119918 | 412 |
| 286 | 3300013104 | Ga0157370_10036657 | Ga0157370_100366572 | 412 |
| 287 | 3300013306 | Ga0163162_10002693 | Ga0163162_100026936 | 412 |
| 288 | 3300013307 | Ga0157372_10129010 | Ga0157372_101290103 | 412 |
| 289 | 3300013308 | Ga0157375_10004094 | Ga0157375_100040949 | 412 |
| 290 | 3300013308 | Ga0157375_10029814 | Ga0157375_100298143 | 412 |
| 291 | 3300014325 | Ga0163163_10082180 | Ga0163163_100821802 | 412 |
| 292 | 3300014497 | Ga0182008_10000018 | Ga0182008_10000018163 | 412 |
| 293 | 3300014497 | Ga0182008_10006790 | Ga0182008_100067903 | 412 |
| 294 | 3300014497 | Ga0182008_10009150 | Ga0182008_100091503 | 412 |
| 295 | 3300015261 | Ga0182006_1009184 | Ga0182006_10091846 | 412 |
| 296 | 3300015262 | Ga0182007_10003351 | Ga0182007_100033512 | 412 |
| 297 | 3300015262 | Ga0182007_10016478 | Ga0182007_100164783 | 412 |
| 298 | 3300025250 | Ga0209026_1000316 | Ga0209026_100031622 | 412 |
| 299 | 3300025907 | Ga0207645_10009783 | Ga0207645_100097836 | 412 |
| 300 | 3300025913 | Ga0207695_10037467 | Ga0207695_100374674 | 412 |
| 301 | 3300025932 | Ga0207690_10000249 | Ga0207690_1000024933 | 412 |
| 302 | 3300025938 | Ga0207704_10041433 | Ga0207704_100414331 | 412 |
| 303 | 3300025940 | Ga0207691_10210111 | Ga0207691_102101112 | 412 |
| 304 | 3300025941 | Ga0207711_10009487 | Ga0207711_100094871 | 412 |
| 305 | 3300025941 | Ga0207711_10072440 | Ga0207711_100724402 | 412 |
| 306 | 3300025942 | Ga0207689_10101358 | Ga0207689_101013581 | 412 |
| 307 | 3300025972 | Ga0207668_10175679 | Ga0207668_101756792 | 412 |
| 308 | 3300026023 | Ga0207677_10079852 | Ga0207677_100798522 | 412 |
| 309 | 3300026121 | Ga0207683_10031517 | Ga0207683_100315173 | 412 |
| 310 | 3300030744 | Ga0316181_1187423 | Ga0316181_11874232 | 412 |
| 311 | 3300031911 | Ga0307412_10000077 | Ga0307412_1000007751 | 412 |
| 312 | 3300032004 | Ga0307414_10002866 | Ga0307414_100028662 | 412 |
| 313 | 3300032004 | Ga0307414_10008019 | Ga0307414_100080192 | 412 |
| 314 | 3300032004 | Ga0307414_10018460 | Ga0307414_100184602 | 412 |
| 315 | 3300048907 | Ga0496104_0000023 | Ga0496104_0000023_70058_71338 | 412 |
| 316 | 3300048908 | Ga0496105_0000019 | Ga0496105_0000019_70057_71337 | 412 |
| 317 | 3300049571 | Ga0501034_0000938 | Ga0501034_0000938_29962_31239 | 412 |
| 318 | 3300049758 | Ga0501241_001977 | Ga0501241_001977_696_1961 | 412 |
| 319 | 3300053093 | Ga0500651_0000127 | Ga0500651_0000127_21964_23202 | 412 |
| 320 | iso_pu_bacteria | 2738541284 | 2738760972 | 412 |
| 321 | iso_pu_bacteria | 2775506987 | 2776613159 | 412 |
| 322 | iso_pu_bacteria | 2852627209 | 2852631309 | 412 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7dla-assembly1.cif.gz_A | crystal structure of nucleoside transporter nupg (d323a mutant) | 0.9703 | 2 | 396 |
| 7dla-assembly1.cif.gz_A | crystal structure of nucleoside transporter nupg (d323a mutant) | 0.9467 | 2 | 396 |
| 7dl9-assembly2.cif.gz_B | crystal structure of nucleoside transporter nupg | 0.9367 | 2 | 398 |
| 7dl9-assembly2.cif.gz_B | crystal structure of nucleoside transporter nupg | 0.9122 | 2 | 398 |
| 1pv6-assembly2.cif.gz_B | crystal structure of lactose permease | 0.7929 | 2 | 412 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45562_195_403_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9855 | 189 | 396 | 1.20.1250.20 |
| af_P0AFF4_5_189_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9727 | 2 | 182 | 1.20.1250.20 |
| af_P45562_195_403_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9715 | 189 | 396 | 1.20.1250.20 |
| af_P45562_4_189_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9635 | 1 | 184 | 1.20.1250.20 |
| af_P0AFF4_5_189_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9368 | 2 | 182 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N5A2Y4-F1-model_v4 | MFS transporter | 0.9812 | 2 | 163 |
GO:0005886
GO:0015212 GO:0015213 |
| AF-A0A2G6LS05-F1-model_v4 | MFS transporter | 0.9811 | 1 | 400 |
GO:0005886
GO:0015212 GO:0015213 |
| AF-A0A831DPN5-F1-model_v4 | deleted | 0.9803 | 2 | 175 |
|
| AF-A0A645A6M0-F1-model_v4 | Xanthosine permease | 0.98 | 190 | 412 |
GO:0005886
GO:0015212 GO:0015213 |
| AF-A0A6G3HQX5-F1-model_v4 | deleted | 0.9781 | 2 | 352 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar