F406455

General Info

Members Datasets Scaffolds Average Seq Length
322 173 322 348

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10109873|Ga0157380_101098733
Length 379
Sequence LPTSINQQSAIENQQWHRDKFSHRPMTVQTVLVCEAQVPFVHGGAEVHVRQLVRELRARGYTTELVSVPFKWYPKEEILPHAAAWRLLDLSESNGRAVDLVIGTKFPSYFARHPKKVAWLIHQYRAAYELCGTEYSDFAHTELDVGLRDTLMRLDTTMLGECRAVFTNARNTAARLARFNGLAAEPLYHPPKLASRLVPGPYTNYVLSVGRIESVKRVDLIIAAMADVPPEVRLMIAGDGTQRLNAERAAEEAGVADRVTFLGTVEDDDLIALYAGALAVVYPPYDEDFGYVTLEAFLARKPVITCTDSGGPNEFVIDGVNGFVSAPESGELAAAINRLAADRARTAAMGDAGHDTASAITWDGVIEKLTTLPEPRKLP

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
98 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
99 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
100 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.83
Nodule 0
Rhizoplane 4.97
Rhizosphere 87.89
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10082668 3300005290 Bacteria 2896
2 Ga0065712_10087850 3300005290 Bacteria 2551
3 Ga0065712_10108457 3300005290 Bacteria 1874
4 Ga0065712_10136877 3300005290 Bacteria 1485
5 Ga0065715_10010082 3300005293 Bacteria 3685
6 Ga0065715_10097041 3300005293 Bacteria 3773
7 Ga0065715_10114847 3300005293 Bacteria 2436
8 Ga0065707_10000751 3300005295 Bacteria 16640
9 Ga0065707_10117721 3300005295 Bacteria 2205
10 Ga0065707_10180556 3300005295 Bacteria 1421
11 Ga0070676_10093872 3300005328 Bacteria 1843
12 Ga0070683_100011290 3300005329 Bacteria 7712
13 Ga0070683_100036513 3300005329 Bacteria 4497
14 Ga0070670_100001909 3300005331 Bacteria 17062
15 Ga0070670_100022132 3300005331 Bacteria 5471
16 Ga0070680_100238452 3300005336 Unclassified 1537
17 Ga0070680_100273531 3300005336 Unclassified 1430
18 Ga0070661_100163906 3300005344 Unclassified 1685
19 Ga0070668_100546315 3300005347 Bacteria 1008
20 Ga0070669_100006661 3300005353 Bacteria 8316
21 Ga0070675_100131233 3300005354 Bacteria 2135
22 Ga0070671_100358244 3300005355 Bacteria 1245
23 Ga0070674_100003342 3300005356 Bacteria 8981
24 Ga0070667_100128125 3300005367 Bacteria 2213
25 Ga0070667_100203738 3300005367 Bacteria 1756
26 Ga0070713_100032582 3300005436 Bacteria 4164
27 Ga0070701_10129101 3300005438 Unclassified 1434
28 Ga0070700_100218445 3300005441 Bacteria 1349
29 Ga0070708_100084710 3300005445 Unclassified 2875
30 Ga0070678_100441076 3300005456 Bacteria 1139
31 Ga0070681_10164742 3300005458 Bacteria 2140
32 Ga0070698_100533167 3300005471 Unclassified 1113
33 Ga0070699_100004383 3300005518 Bacteria 12471
34 Ga0070699_100008307 3300005518 Bacteria 9003
35 Ga0070699_100071834 3300005518 Bacteria 3010
36 Ga0070679_100176146 3300005530 Bacteria 2111
37 Ga0070684_100000477 3300005535 Bacteria 27392
38 Ga0070684_100043012 3300005535 Bacteria 3901
39 Ga0070672_100237671 3300005543 Bacteria 1532
40 Ga0070696_100211695 3300005546 Bacteria 1451
41 Ga0070665_100090039 3300005548 Bacteria 3074
42 Ga0070704_100083614 3300005549 Bacteria 2357
43 Ga0070664_100009326 3300005564 Bacteria 7961
44 Ga0070664_100029357 3300005564 Bacteria 4585
45 Ga0070664_100030942 3300005564 Bacteria 4468
46 Ga0070664_100195685 3300005564 Bacteria 1802
47 Ga0068857_100010376 3300005577 Bacteria 8095
48 Ga0068859_100000002 3300005617 Bacteria 541370
49 Ga0068859_100007477 3300005617 Bacteria 11091
50 Ga0068864_100017239 3300005618 Bacteria 6022
51 Ga0068861_100128007 3300005719 Bacteria 2058
52 Ga0068858_100021737 3300005842 Bacteria 5994
53 Ga0068862_100192520 3300005844 Bacteria 1836
54 Ga0075365_10009839 3300006038 Bacteria 5531
55 Ga0075368_10007277 3300006042 Bacteria 3903
56 Ga0075364_10012556 3300006051 Bacteria 5187
57 Ga0075364_10085558 3300006051 Bacteria 2088
58 Ga0075362_10005950 3300006177 Bacteria 4509
59 Ga0075367_10023911 3300006178 Bacteria 3443
60 Ga0075367_10057822 3300006178 Bacteria 2306
61 Ga0075366_10008258 3300006195 Bacteria 5780
62 Ga0075366_10036357 3300006195 Bacteria 2903
63 Ga0075366_10048795 3300006195 Bacteria 2511
64 Ga0068871_100104158 3300006358 Bacteria 2380
65 Ga0075428_100010597 3300006844 Bacteria 10245
66 Ga0075428_100153328 3300006844 Unclassified 2503
67 Ga0075428_100262611 3300006844 Bacteria 1859
68 Ga0075430_100004199 3300006846 Bacteria 12151
69 Ga0075430_100005653 3300006846 Bacteria 10560
70 Ga0075430_100040543 3300006846 Bacteria 3942
71 Ga0075431_100003567 3300006847 Bacteria 15070
72 Ga0075431_100007134 3300006847 Bacteria 11102
73 Ga0075431_100032226 3300006847 Bacteria 5400
74 Ga0075431_100048362 3300006847 Bacteria 4387
75 Ga0075431_100051746 3300006847 Bacteria 4235
76 Ga0075431_100101116 3300006847 Bacteria 2975
77 Ga0075431_100233287 3300006847 Bacteria 1874
78 Ga0075433_10006822 3300006852 Bacteria 9050
79 Ga0075433_10020657 3300006852 Bacteria 5511
80 Ga0075433_10117994 3300006852 Bacteria 2355
81 Ga0075433_10139591 3300006852 Bacteria 2154
82 Ga0075433_10350024 3300006852 Unclassified 1306
83 Ga0075434_100000731 3300006871 Bacteria 25794
84 Ga0075434_100115766 3300006871 Bacteria 2694
85 Ga0075434_100286596 3300006871 Bacteria 1667
86 Ga0075429_100028618 3300006880 Bacteria 4838
87 Ga0068865_100082055 3300006881 Bacteria 2317
88 Ga0068865_100286273 3300006881 Unclassified 1314
89 Ga0075436_100058963 3300006914 Bacteria 2651
90 Ga0097620_100000002 3300006931 Bacteria 541370
91 Ga0097620_100007478 3300006931 Bacteria 11091
92 Ga0075435_100045703 3300007076 Bacteria 3511
93 Ga0075435_100101132 3300007076 Bacteria 2388
94 Ga0105240_10093777 3300009093 Bacteria 3663
95 Ga0111539_10000010 3300009094 Bacteria 366246
96 Ga0111539_10007299 3300009094 Bacteria 14152
97 Ga0111539_10015911 3300009094 Bacteria 9342
98 Ga0111539_10035499 3300009094 Bacteria 6036
99 Ga0111539_10134530 3300009094 Bacteria 2895
100 Ga0111539_10139906 3300009094 Bacteria 2834
101 Ga0105247_10009155 3300009101 Bacteria 6027
102 Ga0105247_10033099 3300009101 Bacteria 3143
103 Ga0114129_10000047 3300009147 Bacteria 104957
104 Ga0114129_10000408 3300009147 Bacteria 50625
105 Ga0114129_10004725 3300009147 Bacteria 19236
106 Ga0114129_10006465 3300009147 Bacteria 16620
107 Ga0114129_10011453 3300009147 Bacteria 12629
108 Ga0114129_10093688 3300009147 Bacteria 4161
109 Ga0105241_10109072 3300009174 Unclassified 2213
110 Ga0105248_10000664 3300009177 Bacteria 39095
111 Ga0105248_10076990 3300009177 Bacteria 3749
112 Ga0105248_10085756 3300009177 Bacteria 3543
113 Ga0105248_10317944 3300009177 Bacteria 1753
114 Ga0105249_10000566 3300009553 Bacteria 33999
115 Ga0105249_10032293 3300009553 Bacteria 4736
116 Ga0105249_10081212 3300009553 Bacteria 3013
117 Ga0163163_10000071 3300014325 Bacteria 112778
118 Ga0163163_10068131 3300014325 Bacteria 3540
119 Ga0163163_10180045 3300014325 Unclassified 2161
120 Ga0157380_10024821 3300014326 Bacteria 4541
121 Ga0157380_10109873 3300014326 Bacteria 2314
122 Ga0157380_10187778 3300014326 Bacteria 1822
123 Ga0157379_10125289 3300014968 Bacteria 2312
124 Ga0207697_10039060 3300025315 Unclassified 1947
125 Ga0207710_10015384 3300025900 Bacteria 3232
126 Ga0207688_10018575 3300025901 Unclassified 3782
127 Ga0207680_10209059 3300025903 Bacteria 1333
128 Ga0207695_10163412 3300025913 Bacteria 2156
129 Ga0207663_10072303 3300025916 Bacteria 2229
130 Ga0207660_10127651 3300025917 Bacteria 1933
131 Ga0207650_10003088 3300025925 Bacteria 11467
132 Ga0207700_10038708 3300025928 Bacteria 3463
133 Ga0207706_10073135 3300025933 Bacteria 3014
134 Ga0207706_10161742 3300025933 Unclassified 1968
135 Ga0207670_10026906 3300025936 Bacteria 3631
136 Ga0207670_10141404 3300025936 Bacteria 1775
137 Ga0207704_10102783 3300025938 Bacteria 1910
138 Ga0207665_10032679 3300025939 Bacteria 3446
139 Ga0207691_10088307 3300025940 Bacteria 2780
140 Ga0207711_10033049 3300025941 Bacteria 4376
141 Ga0207661_10028352 3300025944 Bacteria 4287
142 Ga0207679_10011795 3300025945 Bacteria 5677
143 Ga0207679_10074596 3300025945 Bacteria 2571
144 Ga0207712_10175704 3300025961 Unclassified 1678
145 Ga0207703_10024671 3300026035 Bacteria 4731
146 Ga0207678_10257328 3300026067 Bacteria 1496
147 Ga0207648_10064383 3300026089 Bacteria 3196
148 Ga0207676_10014449 3300026095 Bacteria 5681
149 Ga0207674_10016297 3300026116 Bacteria 8140
150 Ga0207675_100016870 3300026118 Bacteria 6822
151 Ga0207675_100359356 3300026118 Bacteria 1428
152 Ga0209813_10007789 3300027866 Bacteria 2680
153 Ga0207428_10000034 3300027907 Bacteria 231306
154 Ga0207428_10046740 3300027907 Unclassified 3479
155 Ga0307408_100220150 3300031548 Bacteria 1548
156 Ga0307413_10031731 3300031824 Bacteria 2985
157 Ga0307407_10013590 3300031903 Bacteria 3957
158 Ga0307407_10023113 3300031903 Bacteria 3239
159 Ga0307416_100027270 3300032002 Bacteria 4226
160 Ga0307416_100064457 3300032002 Bacteria 3006
161 Ga0307411_10023534 3300032005 Unclassified 3651
162 Ga0307415_100027674 3300032126 Bacteria 3595
163 Ga0307415_100052672 3300032126 Bacteria 2769
164 Ga0373925_0001772 3300037068 Bacteria 18014
165 Ga0373925_0168561 3300037068 Bacteria 1728
166 Ga0436364_0043205 3300037853 Bacteria 2028
167 Ga0439461_0013514 3300041410 Bacteria 1542
168 Ga0450896_003485 3300042133 Bacteria 2093
169 Ga0439435_0019307 3300042436 Unclassified 1745
170 Ga0439435_0033050 3300042436 Bacteria 1414
171 Ga0439435_0039300 3300042436 Bacteria 1318
172 Ga0439464_0015971 3300042439 Bacteria 2029
173 Ga0451577_0003629 3300042876 Bacteria 16952
174 Ga0451577_0299464 3300042876 Unclassified 1457
175 Ga0453684_0000414 3300044712 Bacteria 174278
176 Ga0453684_0042005 3300044712 Bacteria 6171
177 Ga0453684_0094127 3300044712 Bacteria 3687
178 Ga0451576_0054611 3300045051 Bacteria 4182
179 Ga0495603_0131206 3300046455 Bacteria 1459
180 Ga0495608_0074066 3300046511 Bacteria 2220
181 Ga0495635_0024299 3300046663 Bacteria 4225
182 Ga0495658_0004399 3300046683 Bacteria 6939
183 Ga0495669_0100897 3300046684 Unclassified 1340
184 Ga0495674_0055434 3300047319 Bacteria 3477
185 Ga0496102_0006525 3300048905 Bacteria 9954
186 Ga0496104_0013818 3300048907 Bacteria 7283
187 Ga0496104_0174692 3300048907 Bacteria 2059
188 Ga0496105_0053421 3300048908 Bacteria 3336
189 Ga0496106_0290330 3300048909 Bacteria 1311
190 Ga0496106_0390532 3300048909 Bacteria 1118
191 Ga0496108_0006264 3300048911 Bacteria 9640
192 Ga0496109_0001850 3300048912 Bacteria 17524
193 Ga0496110_0000816 3300048913 Bacteria 21833
194 Ga0496111_0001209 3300048914 Bacteria 14420
195 Ga0496112_0003409 3300048915 Bacteria 13132
196 Ga0496112_0023882 3300048915 Bacteria 5849
197 Ga0496112_0237955 3300048915 Unclassified 1774
198 Ga0496112_0454420 3300048915 Unclassified 1218
199 Ga0496113_0007690 3300048916 Bacteria 6955
200 Ga0496113_0264923 3300048916 Bacteria 1373
201 Ga0501032_0046976 3300049569 Bacteria 2916
202 Ga0501034_0000989 3300049571 Bacteria 40796
203 Ga0501034_0075741 3300049571 Bacteria 3371
204 Ga0501036_0017503 3300049572 Bacteria 5993
205 Ga0501036_0106595 3300049572 Bacteria 2370
206 Ga0501036_0126945 3300049572 Unclassified 2154
207 Ga0501036_0216091 3300049572 Bacteria 1610
208 Ga0501037_0033451 3300049573 Bacteria 3796
209 Ga0501038_0004904 3300049574 Bacteria 12430
210 Ga0501038_0022381 3300049574 Bacteria 5665
211 Ga0501039_0036589 3300049575 Bacteria 3788
212 Ga0501039_0040531 3300049575 Bacteria 3595
213 Ga0501039_0074676 3300049575 Bacteria 2635
214 Ga0501039_0099939 3300049575 Bacteria 2264
215 Ga0501040_0026550 3300049576 Bacteria 3896
216 Ga0501041_0054887 3300049577 Bacteria 2431
217 Ga0501042_0005337 3300049578 Bacteria 8260
218 Ga0501042_0011995 3300049578 Bacteria 5859
219 Ga0501043_0287363 3300049579 Bacteria 1259
220 Ga0501046_0004223 3300049580 Bacteria 13073
221 Ga0501046_0016794 3300049580 Bacteria 6119
222 Ga0501046_0058336 3300049580 Bacteria 3026
223 Ga0501046_0061032 3300049580 Unclassified 2950
224 Ga0501047_0001605 3300049581 Bacteria 22037
225 Ga0501047_0062222 3300049581 Bacteria 3600
226 Ga0501048_0044968 3300049582 Bacteria 3155
227 Ga0501048_0111318 3300049582 Bacteria 1933
228 Ga0501048_0323851 3300049582 Bacteria 1098
229 Ga0501067_0038400 3300049583 Bacteria 2658
230 Ga0501068_0008802 3300049584 Bacteria 5630
231 Ga0501068_0065911 3300049584 Bacteria 2205
232 Ga0501069_0040049 3300049585 Bacteria 2589
233 Ga0501069_0072429 3300049585 Bacteria 1932
234 Ga0501071_0097893 3300049587 Bacteria 2160
235 Ga0501071_0161884 3300049587 Bacteria 1673
236 Ga0501072_0010302 3300049588 Bacteria 7124
237 Ga0501072_0070963 3300049588 Unclassified 2752
238 Ga0501072_0121111 3300049588 Bacteria 2084
239 Ga0501073_0028578 3300049589 Bacteria 3984
240 Ga0501073_0076282 3300049589 Bacteria 2332
241 Ga0501074_0114464 3300049590 Bacteria 1930
242 Ga0501075_0053199 3300049591 Bacteria 3045
243 Ga0501075_0175632 3300049591 Bacteria 1635
244 Ga0501076_0005286 3300049592 Bacteria 9258
245 Ga0501076_0028319 3300049592 Bacteria 4349
246 Ga0501076_0056194 3300049592 Bacteria 3123
247 Ga0501076_0102866 3300049592 Unclassified 2303
248 Ga0501077_0049271 3300049593 Bacteria 2677
249 Ga0501079_0026155 3300049741 Bacteria 4475
250 Ga0501079_0068651 3300049741 Bacteria 2736
251 Ga0501079_0088549 3300049741 Bacteria 2397
252 Ga0501080_0005942 3300049742 Bacteria 10938
253 Ga0501080_0087935 3300049742 Bacteria 2886
254 Ga0501080_0108186 3300049742 Bacteria 2577
255 Ga0501080_0221229 3300049742 Bacteria 1732
256 Ga0501081_0052250 3300049743 Unclassified 2819
257 Ga0501081_0271597 3300049743 Bacteria 1240
258 Ga0501083_0114920 3300049744 Bacteria 1767
259 Ga0501035_0043356 3300049822 Bacteria 4054
260 Ga0501035_0058625 3300049822 Bacteria 3430
261 Ga0501044_0109353 3300049823 Bacteria 2773
262 Ga0501045_0031718 3300049824 Bacteria 3827
263 Ga0501045_0095603 3300049824 Bacteria 2198
264 nmdc:mga00v17_14970_c1 3300050491 Bacteria 4344
265 nmdc:mga00v17_46901_c1 3300050491 Bacteria 2616
266 nmdc:mga0yw44_1474_c1 3300050492 Bacteria 9375
267 nmdc:mga0k408_13535_c1 3300050493 Bacteria 4477
268 nmdc:mga0k408_222874_c1 3300050493 Bacteria 1126
269 nmdc:mga06z11_3024_c1 3300050494 Bacteria 6472
270 nmdc:mga06z11_36597_c1 3300050494 Bacteria 2424
271 nmdc:mga05p37_130943_c1 3300050507 Unclassified 3078
272 nmdc:mga05p37_16784_c1 3300050507 Bacteria 8827
273 nmdc:mga05p37_180_c1 3300050507 Bacteria 61836
274 nmdc:mga05p37_19709_c1 3300050507 Bacteria 8160
275 nmdc:mga05p37_24022_c1 3300050507 Bacteria 7404
276 nmdc:mga05p37_46062_c1 3300050507 Bacteria 5363
277 nmdc:mga05p37_625_c1 3300050507 Bacteria 19207
278 nmdc:mga05p37_75083_c1 3300050507 Bacteria 4161
279 nmdc:mga09592_120073_c1 3300050508 Unclassified 2257
280 nmdc:mga09592_173421_c1 3300050508 Unclassified 1865
281 nmdc:mga09592_48357_c1 3300050508 Bacteria 3585
282 nmdc:mga0qj67_15375_c1 3300050509 Bacteria 5795
283 nmdc:mga0qj67_69728_c1 3300050509 Bacteria 2804
284 nmdc:mga06r32_10344_c1 3300050510 Bacteria 8414
285 nmdc:mga06r32_120140_c1 3300050510 Bacteria 2591
286 nmdc:mga06r32_47060_c1 3300050510 Bacteria 4119
287 nmdc:mga06r32_88533_c1 3300050510 Bacteria 3022
288 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
289 nmdc:mga08y16_139201_c1 3300050511 Bacteria 2523
290 nmdc:mga08y16_2484_c1 3300050511 Bacteria 18944
291 nmdc:mga08y16_25449_c1 3300050511 Bacteria 6241
292 nmdc:mga08y16_52384_c1 3300050511 Bacteria 4270
293 nmdc:mga0n895_152077_c1 3300050512 Bacteria 2345
294 nmdc:mga0n895_409031_c1 3300050512 Bacteria 1372
295 nmdc:mga0n895_73896_c1 3300050512 Bacteria 3385
296 nmdc:mga0rr50_41349_c1 3300050513 Bacteria 3358
297 nmdc:mga0rr50_93444_c1 3300050513 Bacteria 2347
298 nmdc:mga08x19_70808_c1 3300050514 Bacteria 2273
299 nmdc:mga08x19_9112_c1 3300050514 Bacteria 5925
300 nmdc:mga0a205_10903_c1 3300050515 Bacteria 8361
301 nmdc:mga0a205_249726_c1 3300050515 Bacteria 1654
302 nmdc:mga0a205_31209_c1 3300050515 Bacteria 5104
303 nmdc:mga0a205_59516_c2 3300050515 Unclassified 2048
304 nmdc:mga0a205_84111_c1 3300050515 Bacteria 3073
305 Ga0500651_0064351 3300053093 Bacteria 2287
306 Ga0500555_000244 3300053103 Bacteria 24230
307 Ga0500568_0008892 3300053139 Bacteria 4804
308 Ga0500616_0003547 3300053153 Bacteria 11823
309 Ga0501084_0007619 3300054114 Bacteria 8926
310 Ga0501084_0048263 3300054114 Bacteria 3564
311 Ga0501084_0131921 3300054114 Unclassified 2103
312 Ga0590071_000759 3300059421 Bacteria 9033
313 Ga0590074_000969 3300059423 Bacteria 4505
314 Ga0590074_001011 3300059423 Bacteria 4420
315 Ga0590075_002158 3300059424 Bacteria 4732
316 Ga0590077_000392 3300059426 Bacteria 12330
317 Ga0590077_000652 3300059426 Bacteria 9244
318 Ga0501082_0006545 3300060353 Bacteria 10095
319 Ga0501082_0053099 3300060353 Bacteria 3493
320 Ga0501082_0067638 3300060353 Bacteria 3077
321 Ga0530510_0003827 3300061734 Bacteria 10379
322 Ga0530510_0096975 3300061734 Bacteria 2155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100546315 Ga0070668_1005463151 304
2 3300031824 Ga0307413_10031731 Ga0307413_100317311 310
3 3300031903 Ga0307407_10023113 Ga0307407_100231133 310
4 3300032126 Ga0307415_100027674 Ga0307415_1000276741 310
5 3300042436 Ga0439435_0039300 Ga0439435_0039300_137_1099 317
6 3300048907 Ga0496104_0013818 Ga0496104_0013818_6262_7263 325
7 3300006852 Ga0075433_10020657 Ga0075433_100206576 328
8 3300005356 Ga0070674_100003342 Ga0070674_1000033426 331
9 3300050510 nmdc:mga06r32_88533_c1 nmdc:mga06r32_88533_c1_1424_2473 331
10 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_403423_404472 331
11 3300006844 Ga0075428_100010597 Ga0075428_1000105976 332
12 3300009147 Ga0114129_10000047 Ga0114129_1000004763 332
13 3300050507 nmdc:mga05p37_180_c1 nmdc:mga05p37_180_c1_45623_46678 332
14 3300046455 Ga0495603_0131206 Ga0495603_0131206_129_1142 333
15 3300006195 Ga0075366_10008258 Ga0075366_100082585 334
16 3300006847 Ga0075431_100233287 Ga0075431_1002332872 334
17 3300042436 Ga0439435_0033050 Ga0439435_0033050_87_1091 334
18 3300042439 Ga0439464_0015971 Ga0439464_0015971_685_1689 334
19 3300049579 Ga0501043_0287363 Ga0501043_0287363_210_1220 334
20 3300050510 nmdc:mga06r32_120140_c1 nmdc:mga06r32_120140_c1_67_1071 334
21 3300050511 nmdc:mga08y16_52384_c1 nmdc:mga08y16_52384_c1_2666_3679 334
22 3300005445 Ga0070708_100084710 Ga0070708_1000847102 337
23 3300005549 Ga0070704_100083614 Ga0070704_1000836142 340
24 3300005617 Ga0068859_100000002 Ga0068859_10000000279 340
25 3300006931 Ga0097620_100000002 Ga0097620_100000002382 340
26 3300044712 Ga0453684_0094127 Ga0453684_0094127_1323_2360 340
27 3300048907 Ga0496104_0174692 Ga0496104_0174692_728_1765 340
28 3300048915 Ga0496112_0023882 Ga0496112_0023882_195_1250 341
29 3300059423 Ga0590074_001011 Ga0590074_001011_2131_3156 341
30 3300059424 Ga0590075_002158 Ga0590075_002158_384_1409 341
31 3300059426 Ga0590077_000652 Ga0590077_000652_3057_4082 341
32 3300005518 Ga0070699_100071834 Ga0070699_1000718342 343
33 3300006358 Ga0068871_100104158 Ga0068871_1001041582 343
34 3300006847 Ga0075431_100048362 Ga0075431_1000483622 343
35 3300006914 Ga0075436_100058963 Ga0075436_1000589632 343
36 3300007076 Ga0075435_100101132 Ga0075435_1001011322 343
37 3300009094 Ga0111539_10139906 Ga0111539_101399062 343
38 3300009147 Ga0114129_10093688 Ga0114129_100936882 343
39 3300009177 Ga0105248_10076990 Ga0105248_100769901 343
40 3300009177 Ga0105248_10085756 Ga0105248_100857564 343
41 3300009177 Ga0105248_10317944 Ga0105248_103179442 343
42 3300014325 Ga0163163_10000071 Ga0163163_1000007117 343
43 3300014326 Ga0157380_10187778 Ga0157380_101877782 343
44 3300025936 Ga0207670_10141404 Ga0207670_101414042 343
45 3300025941 Ga0207711_10033049 Ga0207711_100330492 343
46 3300037853 Ga0436364_0043205 Ga0436364_0043205_96_1136 343
47 3300042876 Ga0451577_0003629 Ga0451577_0003629_978_2033 343
48 3300044712 Ga0453684_0000414 Ga0453684_0000414_114277_115332 343
49 3300045051 Ga0451576_0054611 Ga0451576_0054611_2032_3069 343
50 3300049575 Ga0501039_0099939 Ga0501039_0099939_758_1795 343
51 3300049577 Ga0501041_0054887 Ga0501041_0054887_381_1424 343
52 3300049578 Ga0501042_0005337 Ga0501042_0005337_422_1465 343
53 3300049582 Ga0501048_0044968 Ga0501048_0044968_1520_2602 343
54 3300049587 Ga0501071_0097893 Ga0501071_0097893_529_1566 343
55 3300049588 Ga0501072_0070963 Ga0501072_0070963_1526_2569 343
56 3300049590 Ga0501074_0114464 Ga0501074_0114464_195_1232 343
57 3300049592 Ga0501076_0056194 Ga0501076_0056194_1162_2199 343
58 3300049742 Ga0501080_0108186 Ga0501080_0108186_1381_2484 343
59 3300049824 Ga0501045_0031718 Ga0501045_0031718_2074_3117 343
60 3300050507 nmdc:mga05p37_75083_c1 nmdc:mga05p37_75083_c1_279_1310 343
61 3300050511 nmdc:mga08y16_139201_c1 nmdc:mga08y16_139201_c1_1412_2452 343
62 3300054114 Ga0501084_0007619 Ga0501084_0007619_2921_3964 343
63 3300059421 Ga0590071_000759 Ga0590071_000759_4940_5977 343
64 3300059423 Ga0590074_000969 Ga0590074_000969_1704_2741 343
65 3300059426 Ga0590077_000392 Ga0590077_000392_10342_11379 343
66 3300005290 Ga0065712_10082668 Ga0065712_100826682 344
67 3300005290 Ga0065712_10087850 Ga0065712_100878502 344
68 3300005290 Ga0065712_10108457 Ga0065712_101084572 344
69 3300005290 Ga0065712_10136877 Ga0065712_101368771 344
70 3300005293 Ga0065715_10010082 Ga0065715_100100822 344
71 3300005293 Ga0065715_10097041 Ga0065715_100970412 344
72 3300005293 Ga0065715_10114847 Ga0065715_101148471 344
73 3300005295 Ga0065707_10000751 Ga0065707_100007516 344
74 3300005295 Ga0065707_10117721 Ga0065707_101177212 344
75 3300005295 Ga0065707_10180556 Ga0065707_101805561 344
76 3300005328 Ga0070676_10093872 Ga0070676_100938721 344
77 3300005329 Ga0070683_100011290 Ga0070683_1000112906 344
78 3300005329 Ga0070683_100036513 Ga0070683_1000365131 344
79 3300005331 Ga0070670_100001909 Ga0070670_10000190912 344
80 3300005331 Ga0070670_100022132 Ga0070670_1000221321 344
81 3300005336 Ga0070680_100238452 Ga0070680_1002384521 344
82 3300005336 Ga0070680_100273531 Ga0070680_1002735311 344
83 3300005344 Ga0070661_100163906 Ga0070661_1001639062 344
84 3300005353 Ga0070669_100006661 Ga0070669_1000066616 344
85 3300005354 Ga0070675_100131233 Ga0070675_1001312332 344
86 3300005355 Ga0070671_100358244 Ga0070671_1003582441 344
87 3300005367 Ga0070667_100128125 Ga0070667_1001281252 344
88 3300005367 Ga0070667_100203738 Ga0070667_1002037381 344
89 3300005436 Ga0070713_100032582 Ga0070713_1000325824 344
90 3300005438 Ga0070701_10129101 Ga0070701_101291012 344
91 3300005441 Ga0070700_100218445 Ga0070700_1002184451 344
92 3300005456 Ga0070678_100441076 Ga0070678_1004410761 344
93 3300005458 Ga0070681_10164742 Ga0070681_101647422 344
94 3300005471 Ga0070698_100533167 Ga0070698_1005331671 344
95 3300005518 Ga0070699_100004383 Ga0070699_1000043839 344
96 3300005518 Ga0070699_100008307 Ga0070699_1000083076 344
97 3300005530 Ga0070679_100176146 Ga0070679_1001761461 344
98 3300005535 Ga0070684_100000477 Ga0070684_10000047714 344
99 3300005535 Ga0070684_100043012 Ga0070684_1000430122 344
100 3300005543 Ga0070672_100237671 Ga0070672_1002376712 344
101 3300005546 Ga0070696_100211695 Ga0070696_1002116952 344
102 3300005548 Ga0070665_100090039 Ga0070665_1000900392 344
103 3300005564 Ga0070664_100009326 Ga0070664_1000093261 344
104 3300005564 Ga0070664_100029357 Ga0070664_1000293575 344
105 3300005564 Ga0070664_100030942 Ga0070664_1000309422 344
106 3300005564 Ga0070664_100195685 Ga0070664_1001956851 344
107 3300005577 Ga0068857_100010376 Ga0068857_1000103764 344
108 3300005617 Ga0068859_100007477 Ga0068859_1000074772 344
109 3300005618 Ga0068864_100017239 Ga0068864_1000172395 344
110 3300005719 Ga0068861_100128007 Ga0068861_1001280072 344
111 3300005842 Ga0068858_100021737 Ga0068858_1000217371 344
112 3300005844 Ga0068862_100192520 Ga0068862_1001925202 344
113 3300006038 Ga0075365_10009839 Ga0075365_100098396 344
114 3300006042 Ga0075368_10007277 Ga0075368_100072774 344
115 3300006051 Ga0075364_10012556 Ga0075364_100125562 344
116 3300006051 Ga0075364_10085558 Ga0075364_100855581 344
117 3300006177 Ga0075362_10005950 Ga0075362_100059504 344
118 3300006178 Ga0075367_10023911 Ga0075367_100239112 344
119 3300006178 Ga0075367_10057822 Ga0075367_100578222 344
120 3300006195 Ga0075366_10036357 Ga0075366_100363572 344
121 3300006195 Ga0075366_10048795 Ga0075366_100487952 344
122 3300006844 Ga0075428_100153328 Ga0075428_1001533282 344
123 3300006844 Ga0075428_100262611 Ga0075428_1002626112 344
124 3300006846 Ga0075430_100004199 Ga0075430_10000419910 344
125 3300006846 Ga0075430_100005653 Ga0075430_1000056536 344
126 3300006846 Ga0075430_100040543 Ga0075430_1000405434 344
127 3300006847 Ga0075431_100003567 Ga0075431_1000035677 344
128 3300006847 Ga0075431_100007134 Ga0075431_1000071342 344
129 3300006847 Ga0075431_100032226 Ga0075431_1000322261 344
130 3300006847 Ga0075431_100051746 Ga0075431_1000517463 344
131 3300006847 Ga0075431_100101116 Ga0075431_1001011162 344
132 3300006852 Ga0075433_10006822 Ga0075433_100068228 344
133 3300006852 Ga0075433_10117994 Ga0075433_101179942 344
134 3300006852 Ga0075433_10139591 Ga0075433_101395912 344
135 3300006852 Ga0075433_10350024 Ga0075433_103500242 344
136 3300006871 Ga0075434_100000731 Ga0075434_1000007318 344
137 3300006871 Ga0075434_100115766 Ga0075434_1001157661 344
138 3300006871 Ga0075434_100286596 Ga0075434_1002865962 344
139 3300006880 Ga0075429_100028618 Ga0075429_1000286183 344
140 3300006881 Ga0068865_100082055 Ga0068865_1000820552 344
141 3300006881 Ga0068865_100286273 Ga0068865_1002862731 344
142 3300006931 Ga0097620_100007478 Ga0097620_1000074782 344
143 3300007076 Ga0075435_100045703 Ga0075435_1000457032 344
144 3300009093 Ga0105240_10093777 Ga0105240_100937772 344
145 3300009094 Ga0111539_10000010 Ga0111539_1000001075 344
146 3300009094 Ga0111539_10007299 Ga0111539_100072994 344
147 3300009094 Ga0111539_10015911 Ga0111539_100159114 344
148 3300009094 Ga0111539_10035499 Ga0111539_100354995 344
149 3300009094 Ga0111539_10134530 Ga0111539_101345302 344
150 3300009101 Ga0105247_10009155 Ga0105247_100091556 344
151 3300009101 Ga0105247_10033099 Ga0105247_100330993 344
152 3300009147 Ga0114129_10000408 Ga0114129_1000040822 344
153 3300009147 Ga0114129_10004725 Ga0114129_100047258 344
154 3300009147 Ga0114129_10006465 Ga0114129_100064656 344
155 3300009147 Ga0114129_10011453 Ga0114129_100114537 344
156 3300009174 Ga0105241_10109072 Ga0105241_101090722 344
157 3300009177 Ga0105248_10000664 Ga0105248_1000066411 344
158 3300009553 Ga0105249_10000566 Ga0105249_100005668 344
159 3300009553 Ga0105249_10032293 Ga0105249_100322932 344
160 3300009553 Ga0105249_10081212 Ga0105249_100812123 344
161 3300014325 Ga0163163_10068131 Ga0163163_100681312 344
162 3300014325 Ga0163163_10180045 Ga0163163_101800452 344
163 3300014326 Ga0157380_10024821 Ga0157380_100248214 344
164 3300014326 Ga0157380_10109873 Ga0157380_101098733 344
165 3300014968 Ga0157379_10125289 Ga0157379_101252891 344
166 3300025315 Ga0207697_10039060 Ga0207697_100390602 344
167 3300025900 Ga0207710_10015384 Ga0207710_100153842 344
168 3300025901 Ga0207688_10018575 Ga0207688_100185754 344
169 3300025903 Ga0207680_10209059 Ga0207680_102090592 344
170 3300025913 Ga0207695_10163412 Ga0207695_101634121 344
171 3300025916 Ga0207663_10072303 Ga0207663_100723032 344
172 3300025917 Ga0207660_10127651 Ga0207660_101276512 344
173 3300025925 Ga0207650_10003088 Ga0207650_100030885 344
174 3300025928 Ga0207700_10038708 Ga0207700_100387084 344
175 3300025933 Ga0207706_10073135 Ga0207706_100731353 344
176 3300025933 Ga0207706_10161742 Ga0207706_101617422 344
177 3300025936 Ga0207670_10026906 Ga0207670_100269063 344
178 3300025938 Ga0207704_10102783 Ga0207704_101027832 344
179 3300025939 Ga0207665_10032679 Ga0207665_100326793 344
180 3300025940 Ga0207691_10088307 Ga0207691_100883072 344
181 3300025944 Ga0207661_10028352 Ga0207661_100283523 344
182 3300025945 Ga0207679_10011795 Ga0207679_100117955 344
183 3300025945 Ga0207679_10074596 Ga0207679_100745962 344
184 3300025961 Ga0207712_10175704 Ga0207712_101757042 344
185 3300026035 Ga0207703_10024671 Ga0207703_100246711 344
186 3300026067 Ga0207678_10257328 Ga0207678_102573281 344
187 3300026089 Ga0207648_10064383 Ga0207648_100643831 344
188 3300026095 Ga0207676_10014449 Ga0207676_100144495 344
189 3300026116 Ga0207674_10016297 Ga0207674_100162976 344
190 3300026118 Ga0207675_100016870 Ga0207675_1000168707 344
191 3300026118 Ga0207675_100359356 Ga0207675_1003593562 344
192 3300027866 Ga0209813_10007789 Ga0209813_100077893 344
193 3300027907 Ga0207428_10000034 Ga0207428_10000034145 344
194 3300027907 Ga0207428_10046740 Ga0207428_100467404 344
195 3300031548 Ga0307408_100220150 Ga0307408_1002201501 344
196 3300031903 Ga0307407_10013590 Ga0307407_100135902 344
197 3300032002 Ga0307416_100027270 Ga0307416_1000272702 344
198 3300032002 Ga0307416_100064457 Ga0307416_1000644572 344
199 3300032005 Ga0307411_10023534 Ga0307411_100235342 344
200 3300032126 Ga0307415_100052672 Ga0307415_1000526722 344
201 3300037068 Ga0373925_0001772 Ga0373925_0001772_6455_7495 344
202 3300037068 Ga0373925_0168561 Ga0373925_0168561_98_1144 344
203 3300041410 Ga0439461_0013514 Ga0439461_0013514_82_1134 344
204 3300042133 Ga0450896_003485 Ga0450896_003485_162_1205 344
205 3300042436 Ga0439435_0019307 Ga0439435_0019307_456_1562 344
206 3300042876 Ga0451577_0299464 Ga0451577_0299464_287_1351 344
207 3300044712 Ga0453684_0042005 Ga0453684_0042005_2513_3574 344
208 3300046511 Ga0495608_0074066 Ga0495608_0074066_999_2039 344
209 3300046663 Ga0495635_0024299 Ga0495635_0024299_3122_4162 344
210 3300046683 Ga0495658_0004399 Ga0495658_0004399_4025_5065 344
211 3300046684 Ga0495669_0100897 Ga0495669_0100897_60_1127 344
212 3300047319 Ga0495674_0055434 Ga0495674_0055434_593_1726 344
213 3300048905 Ga0496102_0006525 Ga0496102_0006525_8733_9779 344
214 3300048908 Ga0496105_0053421 Ga0496105_0053421_1770_2834 344
215 3300048909 Ga0496106_0290330 Ga0496106_0290330_177_1238 344
216 3300048909 Ga0496106_0390532 Ga0496106_0390532_31_1074 344
217 3300048911 Ga0496108_0006264 Ga0496108_0006264_7937_8980 344
218 3300048912 Ga0496109_0001850 Ga0496109_0001850_8743_9807 344
219 3300048913 Ga0496110_0000816 Ga0496110_0000816_20589_21653 344
220 3300048914 Ga0496111_0001209 Ga0496111_0001209_9519_10583 344
221 3300048915 Ga0496112_0003409 Ga0496112_0003409_4153_5217 344
222 3300048915 Ga0496112_0237955 Ga0496112_0237955_188_1228 344
223 3300048915 Ga0496112_0454420 Ga0496112_0454420_54_1097 344
224 3300048916 Ga0496113_0007690 Ga0496113_0007690_2702_3745 344
225 3300048916 Ga0496113_0264923 Ga0496113_0264923_75_1139 344
226 3300049569 Ga0501032_0046976 Ga0501032_0046976_343_1389 344
227 3300049571 Ga0501034_0000989 Ga0501034_0000989_30173_31219 344
228 3300049571 Ga0501034_0075741 Ga0501034_0075741_1931_2977 344
229 3300049572 Ga0501036_0017503 Ga0501036_0017503_1972_3018 344
230 3300049572 Ga0501036_0106595 Ga0501036_0106595_1158_2198 344
231 3300049572 Ga0501036_0126945 Ga0501036_0126945_994_2040 344
232 3300049572 Ga0501036_0216091 Ga0501036_0216091_28_1074 344
233 3300049573 Ga0501037_0033451 Ga0501037_0033451_1508_2554 344
234 3300049574 Ga0501038_0004904 Ga0501038_0004904_4679_5725 344
235 3300049574 Ga0501038_0022381 Ga0501038_0022381_289_1335 344
236 3300049575 Ga0501039_0036589 Ga0501039_0036589_315_1361 344
237 3300049575 Ga0501039_0040531 Ga0501039_0040531_977_2023 344
238 3300049575 Ga0501039_0074676 Ga0501039_0074676_1481_2527 344
239 3300049576 Ga0501040_0026550 Ga0501040_0026550_2244_3290 344
240 3300049578 Ga0501042_0011995 Ga0501042_0011995_4138_5184 344
241 3300049580 Ga0501046_0004223 Ga0501046_0004223_9549_10595 344
242 3300049580 Ga0501046_0016794 Ga0501046_0016794_349_1395 344
243 3300049580 Ga0501046_0058336 Ga0501046_0058336_1794_2840 344
244 3300049580 Ga0501046_0061032 Ga0501046_0061032_686_1732 344
245 3300049581 Ga0501047_0001605 Ga0501047_0001605_5107_6153 344
246 3300049581 Ga0501047_0062222 Ga0501047_0062222_778_1824 344
247 3300049582 Ga0501048_0111318 Ga0501048_0111318_585_1631 344
248 3300049582 Ga0501048_0323851 Ga0501048_0323851_36_1082 344
249 3300049583 Ga0501067_0038400 Ga0501067_0038400_1407_2453 344
250 3300049584 Ga0501068_0008802 Ga0501068_0008802_981_2027 344
251 3300049584 Ga0501068_0065911 Ga0501068_0065911_270_1316 344
252 3300049585 Ga0501069_0040049 Ga0501069_0040049_719_1765 344
253 3300049585 Ga0501069_0072429 Ga0501069_0072429_100_1140 344
254 3300049587 Ga0501071_0161884 Ga0501071_0161884_281_1327 344
255 3300049588 Ga0501072_0010302 Ga0501072_0010302_4000_5046 344
256 3300049588 Ga0501072_0121111 Ga0501072_0121111_461_1501 344
257 3300049589 Ga0501073_0028578 Ga0501073_0028578_1093_2139 344
258 3300049589 Ga0501073_0076282 Ga0501073_0076282_972_2018 344
259 3300049591 Ga0501075_0053199 Ga0501075_0053199_1843_2883 344
260 3300049591 Ga0501075_0175632 Ga0501075_0175632_198_1232 344
261 3300049592 Ga0501076_0005286 Ga0501076_0005286_5450_6490 344
262 3300049592 Ga0501076_0028319 Ga0501076_0028319_872_1918 344
263 3300049592 Ga0501076_0102866 Ga0501076_0102866_380_1426 344
264 3300049593 Ga0501077_0049271 Ga0501077_0049271_168_1214 344
265 3300049741 Ga0501079_0026155 Ga0501079_0026155_3223_4257 344
266 3300049741 Ga0501079_0068651 Ga0501079_0068651_1268_2308 344
267 3300049741 Ga0501079_0088549 Ga0501079_0088549_891_1937 344
268 3300049742 Ga0501080_0005942 Ga0501080_0005942_9549_10595 344
269 3300049742 Ga0501080_0087935 Ga0501080_0087935_290_1336 344
270 3300049742 Ga0501080_0221229 Ga0501080_0221229_534_1580 344
271 3300049743 Ga0501081_0052250 Ga0501081_0052250_1010_2056 344
272 3300049743 Ga0501081_0271597 Ga0501081_0271597_64_1104 344
273 3300049744 Ga0501083_0114920 Ga0501083_0114920_95_1141 344
274 3300049822 Ga0501035_0043356 Ga0501035_0043356_1697_2743 344
275 3300049822 Ga0501035_0058625 Ga0501035_0058625_64_1110 344
276 3300049823 Ga0501044_0109353 Ga0501044_0109353_1393_2439 344
277 3300049824 Ga0501045_0095603 Ga0501045_0095603_27_1073 344
278 3300050491 nmdc:mga00v17_14970_c1 nmdc:mga00v17_14970_c1_861_1901 344
279 3300050491 nmdc:mga00v17_46901_c1 nmdc:mga00v17_46901_c1_1399_2439 344
280 3300050492 nmdc:mga0yw44_1474_c1 nmdc:mga0yw44_1474_c1_296_1357 344
281 3300050493 nmdc:mga0k408_13535_c1 nmdc:mga0k408_13535_c1_1368_2408 344
282 3300050493 nmdc:mga0k408_222874_c1 nmdc:mga0k408_222874_c1_44_1084 344
283 3300050494 nmdc:mga06z11_3024_c1 nmdc:mga06z11_3024_c1_241_1281 344
284 3300050494 nmdc:mga06z11_36597_c1 nmdc:mga06z11_36597_c1_249_1289 344
285 3300050507 nmdc:mga05p37_130943_c1 nmdc:mga05p37_130943_c1_207_1241 344
286 3300050507 nmdc:mga05p37_16784_c1 nmdc:mga05p37_16784_c1_4447_5490 344
287 3300050507 nmdc:mga05p37_19709_c1 nmdc:mga05p37_19709_c1_1770_2831 344
288 3300050507 nmdc:mga05p37_24022_c1 nmdc:mga05p37_24022_c1_5567_6613 344
289 3300050507 nmdc:mga05p37_46062_c1 nmdc:mga05p37_46062_c1_136_1179 344
290 3300050507 nmdc:mga05p37_625_c1 nmdc:mga05p37_625_c1_11337_12380 344
291 3300050508 nmdc:mga09592_120073_c1 nmdc:mga09592_120073_c1_13_1113 344
292 3300050508 nmdc:mga09592_173421_c1 nmdc:mga09592_173421_c1_116_1162 344
293 3300050508 nmdc:mga09592_48357_c1 nmdc:mga09592_48357_c1_1950_2984 344
294 3300050509 nmdc:mga0qj67_15375_c1 nmdc:mga0qj67_15375_c1_2339_3373 344
295 3300050509 nmdc:mga0qj67_69728_c1 nmdc:mga0qj67_69728_c1_1387_2430 344
296 3300050510 nmdc:mga06r32_10344_c1 nmdc:mga06r32_10344_c1_6355_7407 344
297 3300050510 nmdc:mga06r32_47060_c1 nmdc:mga06r32_47060_c1_144_1187 344
298 3300050511 nmdc:mga08y16_2484_c1 nmdc:mga08y16_2484_c1_6611_7657 344
299 3300050511 nmdc:mga08y16_25449_c1 nmdc:mga08y16_25449_c1_4198_5244 344
300 3300050512 nmdc:mga0n895_152077_c1 nmdc:mga0n895_152077_c1_170_1261 344
301 3300050512 nmdc:mga0n895_409031_c1 nmdc:mga0n895_409031_c1_209_1252 344
302 3300050512 nmdc:mga0n895_73896_c1 nmdc:mga0n895_73896_c1_846_1892 344
303 3300050513 nmdc:mga0rr50_41349_c1 nmdc:mga0rr50_41349_c1_17_1066 344
304 3300050513 nmdc:mga0rr50_93444_c1 nmdc:mga0rr50_93444_c1_1125_2168 344
305 3300050514 nmdc:mga08x19_70808_c1 nmdc:mga08x19_70808_c1_1179_2228 344
306 3300050514 nmdc:mga08x19_9112_c1 nmdc:mga08x19_9112_c1_3680_4723 344
307 3300050515 nmdc:mga0a205_10903_c1 nmdc:mga0a205_10903_c1_6202_7245 344
308 3300050515 nmdc:mga0a205_249726_c1 nmdc:mga0a205_249726_c1_126_1217 344
309 3300050515 nmdc:mga0a205_31209_c1 nmdc:mga0a205_31209_c1_2550_3596 344
310 3300050515 nmdc:mga0a205_59516_c2 nmdc:mga0a205_59516_c2_817_1863 344
311 3300050515 nmdc:mga0a205_84111_c1 nmdc:mga0a205_84111_c1_925_1971 344
312 3300053093 Ga0500651_0064351 Ga0500651_0064351_802_1845 344
313 3300053103 Ga0500555_000244 Ga0500555_000244_21447_22490 344
314 3300053139 Ga0500568_0008892 Ga0500568_0008892_1319_2359 344
315 3300053153 Ga0500616_0003547 Ga0500616_0003547_9000_10043 344
316 3300054114 Ga0501084_0048263 Ga0501084_0048263_902_1942 344
317 3300054114 Ga0501084_0131921 Ga0501084_0131921_664_1710 344
318 3300060353 Ga0501082_0006545 Ga0501082_0006545_8938_9984 344
319 3300060353 Ga0501082_0053099 Ga0501082_0053099_1339_2385 344
320 3300060353 Ga0501082_0067638 Ga0501082_0067638_1859_2899 344
321 3300061734 Ga0530510_0003827 Ga0530510_0003827_1458_2504 344
322 3300061734 Ga0530510_0096975 Ga0530510_0096975_646_1692 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

196

356

0.96

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

203

342

0.91

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

163

369

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8606 178 332
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.8594 167 332
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8481 177 334
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.8406 167 332
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8395 178 332
ID Description Score Start End Superfamily
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9494 176 331 3.40.50.2000
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.948 176 328 3.40.50.2000
af_F4IBV4_205_380_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9356 174 332 3.40.50.2000
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9278 180 332 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9257 177 332 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2V8C5X4-F1-model_v4 Glycosyl transferase family 1 0.9851 169 319 GO:0016757
AF-A0A538G9T2-F1-model_v4 Glycosyltransferase 0.9739 119 344 GO:0016758
AF-A0A538G9T2-F1-model_v4 Glycosyltransferase 0.9654 119 344 GO:0016758
AF-A0A538LKC2-F1-model_v4 Glycosyltransferase 0.9577 188 343 GO:0016757
AF-A0A2V8C5X4-F1-model_v4 Glycosyl transferase family 1 0.9478 169 319 GO:0016757

Feature Viewer

pLDDT pTM Quality
94.41 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map