F406479

General Info

Members Datasets Scaffolds Average Seq Length
322 161 322 125

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_11019311|Ga0207687_110193112
Length 137
Sequence LRLDGLPSSSIQCIVMEFTDEHFQELIDEAFESLPKEHRDNVKNVAILYEDEPTPEQRQRLLLRDDQSLFGLYEGVPLSQRQGQTHLLPDRITLFKWPLLRASFDLKSLKENIRHTLWHEIAHYYGLNHADIHRLEQ

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
88 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
89 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
93 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
94 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
118 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
150 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
151 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
152 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
153 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
154 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
155 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
156 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
157 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
158 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
159 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.9
Nodule 0
Rhizoplane 1.24
Rhizosphere 91.93
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10029080 3300001979 Bacteria 1819
2 rootH2_10000244 3300003320 Bacteria 697651
3 rootL2_10041123 3300003322 Bacteria 6094
4 Ga0070658_10000064 3300005327 Bacteria 106537
5 Ga0070658_10000668 3300005327 Bacteria 29714
6 Ga0070658_10001718 3300005327 Bacteria 18491
7 Ga0070658_10102247 3300005327 Bacteria 2370
8 Ga0070658_11535089 3300005327 Unclassified 577
9 Ga0070676_10002481 3300005328 Bacteria 9461
10 Ga0070683_100086127 3300005329 Unclassified 2946
11 Ga0070683_101224760 3300005329 Unclassified 721
12 Ga0070680_101017990 3300005336 Unclassified 715
13 Ga0070680_101881868 3300005336 Unclassified 518
14 Ga0070682_100131384 3300005337 Unclassified 1695
15 Ga0070682_100585926 3300005337 Unclassified 878
16 Ga0070660_100000047 3300005339 Bacteria 69868
17 Ga0070660_100000185 3300005339 Bacteria 41480
18 Ga0070660_100000215 3300005339 Bacteria 38482
19 Ga0070660_100071089 3300005339 Bacteria 2716
20 Ga0070691_10014083 3300005341 Bacteria 3667
21 Ga0070671_100122034 3300005355 Bacteria 2193
22 Ga0070674_100087308 3300005356 Unclassified 2242
23 Ga0070659_100007742 3300005366 Bacteria 7812
24 Ga0070667_100001621 3300005367 Bacteria 20155
25 Ga0070678_100473942 3300005456 Unclassified 1100
26 Ga0070681_10903625 3300005458 Unclassified 801
27 Ga0068867_101581616 3300005459 Unclassified 612
28 Ga0070685_10001280 3300005466 Bacteria 13289
29 Ga0070679_100005349 3300005530 Bacteria 11881
30 Ga0070679_100081615 3300005530 Unclassified 3223
31 Ga0070679_100441432 3300005530 Unclassified 1246
32 Ga0070679_101385466 3300005530 Bacteria 649
33 Ga0070679_101424192 3300005530 Bacteria 639
34 Ga0070679_101935059 3300005530 Unclassified 538
35 Ga0070679_102020669 3300005530 Unclassified 525
36 Ga0070684_100021351 3300005535 Bacteria 5386
37 Ga0068853_100103331 3300005539 Unclassified 2522
38 Ga0070665_100037602 3300005548 Bacteria 4866
39 Ga0068855_100000003 3300005563 Bacteria 589862
40 Ga0068855_100002780 3300005563 Bacteria 21542
41 Ga0068855_100019096 3300005563 Bacteria 8238
42 Ga0068855_100021468 3300005563 Bacteria 7743
43 Ga0068855_100105619 3300005563 Unclassified 3238
44 Ga0068855_100340104 3300005563 Unclassified 1655
45 Ga0068855_100455782 3300005563 Bacteria 1395
46 Ga0068855_100593236 3300005563 Unclassified 1195
47 Ga0070664_100345656 3300005564 Bacteria 1352
48 Ga0068857_100000040 3300005577 Bacteria 70513
49 Ga0068857_100012530 3300005577 Bacteria 7383
50 Ga0068856_100000001 3300005614 Bacteria 565602
51 Ga0068856_100001649 3300005614 Bacteria 23391
52 Ga0068856_100109159 3300005614 Bacteria 2763
53 Ga0068856_100153934 3300005614 Unclassified 2309
54 Ga0068856_101209084 3300005614 Unclassified 772
55 Ga0068852_100143767 3300005616 Bacteria 2210
56 Ga0068852_100661820 3300005616 Bacteria 1052
57 Ga0068852_101129061 3300005616 Unclassified 804
58 Ga0068859_100718507 3300005617 Bacteria 1089
59 Ga0068863_100025044 3300005841 Bacteria 5690
60 Ga0068858_100015545 3300005842 Bacteria 7158
61 Ga0068862_101868086 3300005844 Bacteria 610
62 Ga0081455_10000003 3300005937 Bacteria 367763
63 Ga0070717_10178032 3300006028 Bacteria 1852
64 Ga0075365_10390932 3300006038 Unclassified 981
65 Ga0075366_10000518 3300006195 Bacteria 17818
66 Ga0097621_100000009 3300006237 Bacteria 114089
67 Ga0097621_100359654 3300006237 Bacteria 1296
68 Ga0068871_100000055 3300006358 Bacteria 62753
69 Ga0068871_101958268 3300006358 Unclassified 557
70 Ga0097620_100718479 3300006931 Bacteria 1089
71 Ga0105240_10000004 3300009093 Bacteria 708156
72 Ga0105240_10091771 3300009093 Unclassified 3710
73 Ga0111539_10003367 3300009094 Bacteria 21089
74 Ga0105245_10000001 3300009098 Bacteria 939270
75 Ga0105245_10000002 3300009098 Bacteria 634374
76 Ga0105245_10001246 3300009098 Bacteria 22974
77 Ga0105245_10381517 3300009098 Unclassified 1404
78 Ga0105245_11019632 3300009098 Unclassified 872
79 Ga0105243_10001860 3300009148 Bacteria 18026
80 Ga0105243_11198326 3300009148 Unclassified 772
81 Ga0105241_10000003 3300009174 Bacteria 839043
82 Ga0105241_10000367 3300009174 Bacteria 34366
83 Ga0105241_10053791 3300009174 Bacteria 3080
84 Ga0105241_10374700 3300009174 Bacteria 1242
85 Ga0105241_10650002 3300009174 Unclassified 958
86 Ga0105241_12017703 3300009174 Unclassified 568
87 Ga0105242_10002304 3300009176 Bacteria 15058
88 Ga0105248_11536906 3300009177 Unclassified 754
89 Ga0105248_11809207 3300009177 Unclassified 693
90 Ga0105237_10000488 3300009545 Bacteria 56363
91 Ga0105237_10358220 3300009545 Bacteria 1463
92 Ga0105238_10101277 3300009551 Unclassified 2863
93 Ga0105238_10110178 3300009551 Bacteria 2734
94 Ga0105238_10208979 3300009551 Bacteria 1928
95 Ga0105238_10294606 3300009551 Bacteria 1605
96 Ga0105238_10771438 3300009551 Bacteria 976
97 Ga0105238_11095562 3300009551 Unclassified 819
98 Ga0105238_13054736 3300009551 Unclassified 502
99 Ga0105249_10024995 3300009553 Bacteria 5374
100 Ga0105249_10497703 3300009553 Bacteria 1264
101 Ga0105239_10666730 3300010375 Bacteria 1188
102 Ga0157371_10008839 3300013102 Bacteria 7978
103 Ga0157370_10000706 3300013104 Bacteria 41789
104 Ga0157370_10058837 3300013104 Bacteria 3652
105 Ga0157370_10064081 3300013104 Unclassified 3480
106 Ga0157369_10000261 3300013105 Bacteria 71207
107 Ga0157369_10021580 3300013105 Bacteria 7202
108 Ga0157369_10051038 3300013105 Bacteria 4477
109 Ga0157369_10102214 3300013105 Bacteria 3055
110 Ga0157369_11817732 3300013105 Unclassified 619
111 Ga0157374_10000031 3300013296 Bacteria 204840
112 Ga0157374_10000509 3300013296 Bacteria 35015
113 Ga0157374_10349614 3300013296 Bacteria 1469
114 Ga0157374_11473548 3300013296 Unclassified 704
115 Ga0157374_11911261 3300013296 Unclassified 619
116 Ga0157372_10000002 3300013307 Bacteria 687862
117 Ga0157372_10613652 3300013307 Bacteria 1268
118 Ga0163163_10001421 3300014325 Bacteria 20253
119 Ga0163163_11821635 3300014325 Unclassified 669
120 Ga0163163_12431375 3300014325 Unclassified 582
121 Ga0157376_10000007 3300014969 Bacteria 368004
122 Ga0207647_10390019 3300025904 Unclassified 785
123 Ga0207645_10104743 3300025907 Bacteria 1827
124 Ga0207705_10000104 3300025909 Bacteria 96668
125 Ga0207705_10006243 3300025909 Bacteria 8853
126 Ga0207705_10023000 3300025909 Unclassified 4445
127 Ga0207705_11218063 3300025909 Unclassified 577
128 Ga0207654_10000002 3300025911 Bacteria 1460142
129 Ga0207654_10023179 3300025911 Bacteria 3321
130 Ga0207654_10048700 3300025911 Unclassified 2426
131 Ga0207654_10475194 3300025911 Unclassified 880
132 Ga0207707_10023844 3300025912 Bacteria 5351
133 Ga0207707_10557921 3300025912 Bacteria 973
134 Ga0207695_10000009 3300025913 Bacteria 1034276
135 Ga0207695_10083645 3300025913 Bacteria 3224
136 Ga0207671_10000003 3300025914 Bacteria 1065461
137 Ga0207671_10298931 3300025914 Bacteria 1271
138 Ga0207660_10006209 3300025917 Bacteria 7758
139 Ga0207660_10006474 3300025917 Bacteria 7596
140 Ga0207657_10000883 3300025919 Bacteria 31684
141 Ga0207657_10002237 3300025919 Bacteria 20989
142 Ga0207657_10004977 3300025919 Bacteria 13981
143 Ga0207657_10096251 3300025919 Bacteria 2462
144 Ga0207652_10033474 3300025921 Unclassified 4328
145 Ga0207652_10384365 3300025921 Unclassified 1267
146 Ga0207652_11252529 3300025921 Unclassified 644
147 Ga0207652_11484622 3300025921 Bacteria 582
148 Ga0207694_10040504 3300025924 Bacteria 3587
149 Ga0207694_10927591 3300025924 Bacteria 736
150 Ga0207687_10000001 3300025927 Bacteria 1130810
151 Ga0207687_10000004 3300025927 Bacteria 841177
152 Ga0207687_10002066 3300025927 Bacteria 13750
153 Ga0207687_10675079 3300025927 Unclassified 875
154 Ga0207687_11019311 3300025927 Bacteria 710
155 Ga0207644_10096971 3300025931 Bacteria 2208
156 Ga0207690_10004971 3300025932 Bacteria 7850
157 Ga0207686_10098261 3300025934 Unclassified 1949
158 Ga0207709_10013096 3300025935 Bacteria 4572
159 Ga0207669_10265832 3300025937 Unclassified 1285
160 Ga0207711_10972456 3300025941 Unclassified 788
161 Ga0207661_10377752 3300025944 Unclassified 1282
162 Ga0207661_11268100 3300025944 Bacteria 677
163 Ga0207661_11271507 3300025944 Unclassified 676
164 Ga0207667_10000008 3300025949 Bacteria 625138
165 Ga0207667_10000784 3300025949 Bacteria 41252
166 Ga0207667_10005366 3300025949 Bacteria 15624
167 Ga0207667_10005931 3300025949 Bacteria 14875
168 Ga0207667_10056861 3300025949 Bacteria 4107
169 Ga0207667_10296442 3300025949 Bacteria 1652
170 Ga0207667_10327062 3300025949 Unclassified 1565
171 Ga0207712_10004190 3300025961 Bacteria 9107
172 Ga0207712_10288218 3300025961 Unclassified 1342
173 Ga0207712_10436781 3300025961 Bacteria 1107
174 Ga0207668_10249282 3300025972 Bacteria 1441
175 Ga0207658_10041580 3300025986 Bacteria 3329
176 Ga0207703_11156671 3300026035 Bacteria 744
177 Ga0207639_10241991 3300026041 Bacteria 1569
178 Ga0207702_10000062 3300026078 Bacteria 124850
179 Ga0207702_10003296 3300026078 Bacteria 14883
180 Ga0207702_10085366 3300026078 Unclassified 2751
181 Ga0207702_10241175 3300026078 Unclassified 1694
182 Ga0207702_10328658 3300026078 Bacteria 1458
183 Ga0207702_11528537 3300026078 Unclassified 661
184 Ga0207674_10000001 3300026116 Bacteria 616581
185 Ga0207683_10039284 3300026121 Bacteria 4129
186 Ga0207698_10077452 3300026142 Unclassified 2666
187 Ga0207698_10738034 3300026142 Bacteria 983
188 Ga0268266_10006586 3300028379 Bacteria 10608
189 Ga0265337_1026610 3300028556 Bacteria 1750
190 Ga0265326_10000572 3300028558 Bacteria 13768
191 Ga0265326_10002122 3300028558 Bacteria 6754
192 Ga0265326_10248803 3300028558 Unclassified 513
193 Ga0265319_1044541 3300028563 Bacteria 1486
194 Ga0265319_1141925 3300028563 Unclassified 745
195 Ga0265334_10000028 3300028573 Bacteria 115200
196 Ga0265334_10000676 3300028573 Bacteria 17067
197 Ga0265334_10060503 3300028573 Bacteria 1429
198 Ga0265334_10206956 3300028573 Unclassified 680
199 Ga0265318_10015705 3300028577 Bacteria 3142
200 Ga0265318_10218308 3300028577 Unclassified 696
201 Ga0265323_10003157 3300028653 Bacteria 7337
202 Ga0265322_10002329 3300028654 Bacteria 5875
203 Ga0265322_10098897 3300028654 Unclassified 830
204 Ga0265336_10000069 3300028666 Bacteria 89776
205 Ga0265336_10000617 3300028666 Bacteria 19610
206 Ga0265336_10014304 3300028666 Unclassified 2631
207 Ga0265336_10129840 3300028666 Unclassified 750
208 Ga0265338_10000130 3300028800 Bacteria 137739
209 Ga0265338_10000195 3300028800 Bacteria 114621
210 Ga0265338_10000323 3300028800 Bacteria 87009
211 Ga0265338_10000412 3300028800 Bacteria 76488
212 Ga0265338_10000905 3300028800 Bacteria 49902
213 Ga0265338_10029392 3300028800 Bacteria 5449
214 Ga0265338_10039752 3300028800 Unclassified 4430
215 Ga0265338_10126224 3300028800 Bacteria 2029
216 Ga0265324_10001589 3300029957 Bacteria 12648
217 Ga0265324_10005721 3300029957 Bacteria 5298
218 Ga0265324_10005979 3300029957 Bacteria 5152
219 Ga0265324_10070639 3300029957 Bacteria 1189
220 Ga0265330_10007024 3300031235 Bacteria 5522
221 Ga0265332_10004991 3300031238 Bacteria 6167
222 Ga0265332_10121264 3300031238 Unclassified 1098
223 Ga0265328_10005462 3300031239 Bacteria 5443
224 Ga0265320_10095599 3300031240 Bacteria 1372
225 Ga0265325_10014680 3300031241 Bacteria 4419
226 Ga0265329_10015085 3300031242 Bacteria 2708
227 Ga0265340_10000065 3300031247 Bacteria 49264
228 Ga0265340_10025163 3300031247 Bacteria 3018
229 Ga0265339_10012088 3300031249 Bacteria 5288
230 Ga0265331_10003777 3300031250 Bacteria 9605
231 Ga0265327_10002783 3300031251 Bacteria 17675
232 Ga0265327_10006609 3300031251 Bacteria 9218
233 Ga0265316_10031122 3300031344 Unclassified 4366
234 Ga0265316_10135255 3300031344 Bacteria 1854
235 Ga0265313_10011375 3300031595 Bacteria 5539
236 Ga0265313_10032017 3300031595 Bacteria 2690
237 Ga0265314_10009493 3300031711 Bacteria 8205
238 Ga0265314_10170066 3300031711 Unclassified 1316
239 Ga0265342_10005104 3300031712 Bacteria 10117
240 Ga0265342_10120922 3300031712 Bacteria 1475
241 Ga0265342_10369415 3300031712 Unclassified 744
242 Ga0265342_10593543 3300031712 Unclassified 559
243 Ga0307516_10492809 3300031730 Bacteria 880
244 Ga0395899_0006151 3300037312 Bacteria 9304
245 Ga0395899_0147445 3300037312 Bacteria 1670
246 Ga0395900_0035541 3300037418 Bacteria 5132
247 Ga0395900_0142898 3300037418 Bacteria 2449
248 Ga0395900_0190604 3300037418 Bacteria 2080
249 Ga0395900_0367923 3300037418 Unclassified 1408
250 Ga0395900_0606132 3300037418 Bacteria 1035
251 Ga0395898_0009539 3300037466 Bacteria 10192
252 Ga0395898_0012765 3300037466 Bacteria 8676
253 Ga0395898_0592126 3300037466 Bacteria 1051
254 Ga0395905_0043428 3300037471 Bacteria 4217
255 Ga0395905_0073865 3300037471 Bacteria 3196
256 Ga0395905_0173804 3300037471 Unclassified 2023
257 Ga0395905_0469636 3300037471 Bacteria 1157
258 Ga0395901_0000738 3300038443 Bacteria 36950
259 Ga0395901_0111678 3300038443 Bacteria 2870
260 Ga0395901_0186310 3300038443 Bacteria 2177
261 Ga0439445_0015262 3300042004 Bacteria 1879
262 Ga0439432_025049 3300042006 Unclassified 1958
263 Ga0466967_0420423 3300045976 Bacteria 1303
264 Ga0495609_0079106 3300046538 Bacteria 1438
265 Ga0495672_0171090 3300047320 Bacteria 1108
266 Ga0496100_0072296 3300048903 Unclassified 2305
267 Ga0496101_0928775 3300048904 Bacteria 685
268 Ga0496105_0249087 3300048908 Bacteria 1440
269 Ga0496112_0020062 3300048915 Bacteria 6328
270 Ga0501031_0001772 3300049568 Bacteria 13539
271 Ga0501032_0002880 3300049569 Bacteria 13378
272 Ga0501033_0354329 3300049570 Bacteria 1028
273 Ga0501033_0382686 3300049570 Unclassified 983
274 Ga0501034_0086112 3300049571 Unclassified 3144
275 Ga0501034_0198817 3300049571 Unclassified 1963
276 Ga0501036_0021815 3300049572 Bacteria 5384
277 Ga0501036_0076195 3300049572 Unclassified 2837
278 Ga0501037_0000141 3300049573 Bacteria 67142
279 Ga0501037_0122480 3300049573 Bacteria 1869
280 Ga0501038_0045744 3300049574 Unclassified 3798
281 Ga0501039_0043666 3300049575 Unclassified 3462
282 Ga0501042_1016295 3300049578 Unclassified 604
283 Ga0501043_0000145 3300049579 Bacteria 65943
284 Ga0501043_0115683 3300049579 Unclassified 2105
285 Ga0501046_0000065 3300049580 Bacteria 116095
286 Ga0501047_0000119 3300049581 Bacteria 96051
287 Ga0501047_0000375 3300049581 Bacteria 50494
288 Ga0501048_0000059 3300049582 Bacteria 54989
289 Ga0501048_0029053 3300049582 Unclassified 4013
290 Ga0501069_0085034 3300049585 Bacteria 1785
291 Ga0501070_0012994 3300049586 Bacteria 7018
292 Ga0501070_0032149 3300049586 Bacteria 4393
293 Ga0501070_0709120 3300049586 Unclassified 795
294 Ga0501073_0003902 3300049589 Bacteria 11200
295 Ga0501234_007715 3300049707 Unclassified 1681
296 Ga0501080_0306904 3300049742 Bacteria 1438
297 Ga0501080_0355648 3300049742 Bacteria 1322
298 Ga0501080_1367039 3300049742 Unclassified 605
299 Ga0501083_0179626 3300049744 Unclassified 1382
300 Ga0501083_0238358 3300049744 Bacteria 1184
301 Ga0501035_0000211 3300049822 Bacteria 69883
302 Ga0501035_0000821 3300049822 Bacteria 33132
303 Ga0501044_0309586 3300049823 Bacteria 1506
304 nmdc:mga0k408_17_c1 3300050493 Bacteria 17829
305 nmdc:mga08y16_1620_c2 3300050511 Bacteria 22070
306 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
307 Ga0500610_0000001 3300053079 Bacteria 185468
308 Ga0500643_000022 3300053087 Bacteria 277519
309 Ga0500643_010576 3300053087 Bacteria 3422
310 Ga0500644_0000006 3300053088 Bacteria 143304
311 Ga0500644_0006492 3300053088 Bacteria 3001
312 Ga0500555_000002 3300053103 Bacteria 1314346
313 Ga0500556_0000196 3300053104 Bacteria 49648
314 Ga0500562_018824 3300053108 Bacteria 1784
315 Ga0500594_0000185 3300053118 Bacteria 15772
316 Ga0500628_000015 3300053129 Bacteria 101037
317 Ga0500628_077448 3300053129 Bacteria 845
318 Ga0500652_000020 3300053131 Bacteria 119198
319 Ga0500577_0080869 3300053142 Bacteria 1295
320 Ga0500616_0000005 3300053153 Bacteria 961725
321 Ga0500616_0213865 3300053153 Bacteria 845
322 Ga0501082_0117653 3300060353 Unclassified 2302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_10249282 Ga0207668_102492822 107
2 3300005530 Ga0070679_101385466 Ga0070679_1013854662 109
3 3300005530 Ga0070679_100441432 Ga0070679_1004414322 111
4 3300025921 Ga0207652_10384365 Ga0207652_103843652 111
5 3300028666 Ga0265336_10129840 Ga0265336_101298402 111
6 3300028800 Ga0265338_10000412 Ga0265338_1000041243 111
7 3300031711 Ga0265314_10170066 Ga0265314_101700662 111
8 3300005327 Ga0070658_10000668 Ga0070658_1000066819 112
9 3300005339 Ga0070660_100000185 Ga0070660_10000018511 112
10 3300005341 Ga0070691_10014083 Ga0070691_100140834 112
11 3300005366 Ga0070659_100007742 Ga0070659_1000077426 112
12 3300005530 Ga0070679_100005349 Ga0070679_1000053496 112
13 3300005563 Ga0068855_100002780 Ga0068855_1000027806 112
14 3300005577 Ga0068857_100000040 Ga0068857_10000004046 112
15 3300025904 Ga0207647_10390019 Ga0207647_103900192 112
16 3300025909 Ga0207705_10006243 Ga0207705_1000624310 112
17 3300025919 Ga0207657_10004977 Ga0207657_1000497710 112
18 3300025921 Ga0207652_10033474 Ga0207652_100334743 112
19 3300025932 Ga0207690_10004971 Ga0207690_100049716 112
20 3300025949 Ga0207667_10000784 Ga0207667_1000078421 112
21 3300026116 Ga0207674_10000001 Ga0207674_1000000146 112
22 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_152727_153110 112
23 3300013296 Ga0157374_10349614 Ga0157374_103496142 120
24 3300025921 Ga0207652_11252529 Ga0207652_112525291 120
25 3300037418 Ga0395900_0035541 Ga0395900_0035541_1556_1930 120
26 3300037466 Ga0395898_0012765 Ga0395898_0012765_1922_2296 120
27 3300038443 Ga0395901_0186310 Ga0395901_0186310_1263_1637 120
28 3300003320 rootH2_10000244 rootH2_10000244461 121
29 3300006237 Ga0097621_100000009 Ga0097621_1000000091 121
30 3300006358 Ga0068871_100000055 Ga0068871_10000005545 121
31 3300009098 Ga0105245_10000002 Ga0105245_10000002154 121
32 3300009148 Ga0105243_11198326 Ga0105243_111983262 121
33 3300009174 Ga0105241_10000367 Ga0105241_1000036712 121
34 3300009551 Ga0105238_13054736 Ga0105238_130547361 121
35 3300013296 Ga0157374_10000031 Ga0157374_10000031219 121
36 3300025911 Ga0207654_10023179 Ga0207654_100231792 121
37 3300025927 Ga0207687_10000001 Ga0207687_100000011057 121
38 3300003322 rootL2_10041123 rootL2_100411233 122
39 3300005327 Ga0070658_10000064 Ga0070658_1000006497 122
40 3300005327 Ga0070658_10102247 Ga0070658_101022473 122
41 3300005329 Ga0070683_100086127 Ga0070683_1000861271 122
42 3300005329 Ga0070683_101224760 Ga0070683_1012247601 122
43 3300005336 Ga0070680_101017990 Ga0070680_1010179901 122
44 3300005336 Ga0070680_101881868 Ga0070680_1018818681 122
45 3300005337 Ga0070682_100131384 Ga0070682_1001313842 122
46 3300005337 Ga0070682_100585926 Ga0070682_1005859262 122
47 3300005339 Ga0070660_100000047 Ga0070660_10000004728 122
48 3300005339 Ga0070660_100000215 Ga0070660_10000021542 122
49 3300005339 Ga0070660_100071089 Ga0070660_1000710893 122
50 3300005458 Ga0070681_10903625 Ga0070681_109036251 122
51 3300005459 Ga0068867_101581616 Ga0068867_1015816162 122
52 3300005530 Ga0070679_100081615 Ga0070679_1000816153 122
53 3300005530 Ga0070679_101935059 Ga0070679_1019350591 122
54 3300005530 Ga0070679_102020669 Ga0070679_1020206691 122
55 3300005535 Ga0070684_100021351 Ga0070684_1000213515 122
56 3300005539 Ga0068853_100103331 Ga0068853_1001033314 122
57 3300005563 Ga0068855_100019096 Ga0068855_10001909611 122
58 3300005563 Ga0068855_100455782 Ga0068855_1004557822 122
59 3300005563 Ga0068855_100593236 Ga0068855_1005932362 122
60 3300005577 Ga0068857_100012530 Ga0068857_1000125308 122
61 3300005614 Ga0068856_100000001 Ga0068856_100000001625 122
62 3300005614 Ga0068856_100109159 Ga0068856_1001091592 122
63 3300005616 Ga0068852_100143767 Ga0068852_1001437673 122
64 3300005616 Ga0068852_101129061 Ga0068852_1011290611 122
65 3300005937 Ga0081455_10000003 Ga0081455_1000000322 122
66 3300006038 Ga0075365_10390932 Ga0075365_103909322 122
67 3300009093 Ga0105240_10000004 Ga0105240_10000004755 122
68 3300009093 Ga0105240_10091771 Ga0105240_100917714 122
69 3300009098 Ga0105245_10000001 Ga0105245_1000000156 122
70 3300009098 Ga0105245_10001246 Ga0105245_1000124612 122
71 3300009098 Ga0105245_10381517 Ga0105245_103815172 122
72 3300009098 Ga0105245_11019632 Ga0105245_110196322 122
73 3300009148 Ga0105243_10001860 Ga0105243_1000186014 122
74 3300009174 Ga0105241_10053791 Ga0105241_100537913 122
75 3300009174 Ga0105241_10374700 Ga0105241_103747002 122
76 3300009174 Ga0105241_10650002 Ga0105241_106500022 122
77 3300009174 Ga0105241_12017703 Ga0105241_120177031 122
78 3300009177 Ga0105248_11536906 Ga0105248_115369061 122
79 3300009545 Ga0105237_10000488 Ga0105237_1000048820 122
80 3300009545 Ga0105237_10358220 Ga0105237_103582202 122
81 3300009551 Ga0105238_10110178 Ga0105238_101101784 122
82 3300009551 Ga0105238_10208979 Ga0105238_102089792 122
83 3300009551 Ga0105238_10294606 Ga0105238_102946062 122
84 3300009551 Ga0105238_10771438 Ga0105238_107714382 122
85 3300013102 Ga0157371_10008839 Ga0157371_100088393 122
86 3300013104 Ga0157370_10000706 Ga0157370_1000070639 122
87 3300013104 Ga0157370_10058837 Ga0157370_100588373 122
88 3300013104 Ga0157370_10064081 Ga0157370_100640812 122
89 3300013105 Ga0157369_10021580 Ga0157369_100215808 122
90 3300013105 Ga0157369_10102214 Ga0157369_101022144 122
91 3300013296 Ga0157374_11473548 Ga0157374_114735481 122
92 3300013296 Ga0157374_11911261 Ga0157374_119112611 122
93 3300013307 Ga0157372_10000002 Ga0157372_10000002732 122
94 3300013307 Ga0157372_10613652 Ga0157372_106136521 122
95 3300014325 Ga0163163_11821635 Ga0163163_118216352 122
96 3300014969 Ga0157376_10000007 Ga0157376_1000000763 122
97 3300025909 Ga0207705_10000104 Ga0207705_1000010422 122
98 3300025911 Ga0207654_10048700 Ga0207654_100487002 122
99 3300025911 Ga0207654_10475194 Ga0207654_104751941 122
100 3300025912 Ga0207707_10023844 Ga0207707_100238442 122
101 3300025913 Ga0207695_10000009 Ga0207695_100000091139 122
102 3300025913 Ga0207695_10083645 Ga0207695_100836453 122
103 3300025914 Ga0207671_10000003 Ga0207671_100000031195 122
104 3300025914 Ga0207671_10298931 Ga0207671_102989312 122
105 3300025917 Ga0207660_10006209 Ga0207660_100062095 122
106 3300025917 Ga0207660_10006474 Ga0207660_100064744 122
107 3300025919 Ga0207657_10000883 Ga0207657_1000088317 122
108 3300025919 Ga0207657_10002237 Ga0207657_1000223721 122
109 3300025919 Ga0207657_10096251 Ga0207657_100962513 122
110 3300025924 Ga0207694_10927591 Ga0207694_109275911 122
111 3300025927 Ga0207687_10000004 Ga0207687_10000004211 122
112 3300025927 Ga0207687_10002066 Ga0207687_1000206611 122
113 3300025927 Ga0207687_10675079 Ga0207687_106750792 122
114 3300025935 Ga0207709_10013096 Ga0207709_100130963 122
115 3300025941 Ga0207711_10972456 Ga0207711_109724562 122
116 3300025944 Ga0207661_10377752 Ga0207661_103777522 122
117 3300025944 Ga0207661_11271507 Ga0207661_112715071 122
118 3300025949 Ga0207667_10005366 Ga0207667_100053669 122
119 3300025949 Ga0207667_10056861 Ga0207667_100568614 122
120 3300025949 Ga0207667_10296442 Ga0207667_102964422 122
121 3300025961 Ga0207712_10004190 Ga0207712_100041907 122
122 3300026035 Ga0207703_11156671 Ga0207703_111566711 122
123 3300026041 Ga0207639_10241991 Ga0207639_102419913 122
124 3300026078 Ga0207702_10000062 Ga0207702_1000006235 122
125 3300026078 Ga0207702_10085366 Ga0207702_100853662 122
126 3300026078 Ga0207702_10241175 Ga0207702_102411752 122
127 3300026078 Ga0207702_10328658 Ga0207702_103286582 122
128 3300026142 Ga0207698_10077452 Ga0207698_100774522 122
129 3300026142 Ga0207698_10738034 Ga0207698_107380341 122
130 3300028558 Ga0265326_10000572 Ga0265326_100005728 122
131 3300028654 Ga0265322_10098897 Ga0265322_100988972 122
132 3300028666 Ga0265336_10000069 Ga0265336_1000006947 122
133 3300028800 Ga0265338_10000130 Ga0265338_1000013041 122
134 3300028800 Ga0265338_10000195 Ga0265338_1000019545 122
135 3300029957 Ga0265324_10001589 Ga0265324_1000158917 122
136 3300031238 Ga0265332_10121264 Ga0265332_101212642 122
137 3300031712 Ga0265342_10593543 Ga0265342_105935431 122
138 3300037312 Ga0395899_0006151 Ga0395899_0006151_7204_7572 122
139 3300037312 Ga0395899_0147445 Ga0395899_0147445_898_1278 122
140 3300037418 Ga0395900_0142898 Ga0395900_0142898_1370_1738 122
141 3300037418 Ga0395900_0190604 Ga0395900_0190604_1185_1553 122
142 3300037418 Ga0395900_0606132 Ga0395900_0606132_495_875 122
143 3300037466 Ga0395898_0009539 Ga0395898_0009539_653_1021 122
144 3300037466 Ga0395898_0592126 Ga0395898_0592126_451_819 122
145 3300037471 Ga0395905_0073865 Ga0395905_0073865_340_708 122
146 3300037471 Ga0395905_0173804 Ga0395905_0173804_1548_1916 122
147 3300037471 Ga0395905_0469636 Ga0395905_0469636_155_523 122
148 3300038443 Ga0395901_0000738 Ga0395901_0000738_29175_29543 122
149 3300038443 Ga0395901_0111678 Ga0395901_0111678_1890_2258 122
150 3300042004 Ga0439445_0015262 Ga0439445_0015262_410_799 122
151 3300042006 Ga0439432_025049 Ga0439432_025049_999_1388 122
152 3300045976 Ga0466967_0420423 Ga0466967_0420423_788_1156 122
153 3300048903 Ga0496100_0072296 Ga0496100_0072296_913_1281 122
154 3300048904 Ga0496101_0928775 Ga0496101_0928775_274_642 122
155 3300049568 Ga0501031_0001772 Ga0501031_0001772_122_490 122
156 3300049569 Ga0501032_0002880 Ga0501032_0002880_462_830 122
157 3300049570 Ga0501033_0354329 Ga0501033_0354329_327_695 122
158 3300049570 Ga0501033_0382686 Ga0501033_0382686_408_776 122
159 3300049571 Ga0501034_0086112 Ga0501034_0086112_1087_1455 122
160 3300049571 Ga0501034_0198817 Ga0501034_0198817_1096_1464 122
161 3300049572 Ga0501036_0021815 Ga0501036_0021815_4041_4409 122
162 3300049572 Ga0501036_0076195 Ga0501036_0076195_2207_2575 122
163 3300049573 Ga0501037_0000141 Ga0501037_0000141_40925_41293 122
164 3300049573 Ga0501037_0122480 Ga0501037_0122480_419_787 122
165 3300049574 Ga0501038_0045744 Ga0501038_0045744_2645_3013 122
166 3300049575 Ga0501039_0043666 Ga0501039_0043666_1514_1882 122
167 3300049578 Ga0501042_1016295 Ga0501042_1016295_25_393 122
168 3300049579 Ga0501043_0000145 Ga0501043_0000145_58372_58740 122
169 3300049579 Ga0501043_0115683 Ga0501043_0115683_1524_1892 122
170 3300049580 Ga0501046_0000065 Ga0501046_0000065_113400_113768 122
171 3300049581 Ga0501047_0000119 Ga0501047_0000119_46508_46876 122
172 3300049581 Ga0501047_0000375 Ga0501047_0000375_19469_19837 122
173 3300049582 Ga0501048_0000059 Ga0501048_0000059_53609_53977 122
174 3300049582 Ga0501048_0029053 Ga0501048_0029053_1068_1436 122
175 3300049585 Ga0501069_0085034 Ga0501069_0085034_409_777 122
176 3300049586 Ga0501070_0012994 Ga0501070_0012994_4422_4790 122
177 3300049586 Ga0501070_0709120 Ga0501070_0709120_126_494 122
178 3300049589 Ga0501073_0003902 Ga0501073_0003902_1186_1554 122
179 3300049707 Ga0501234_007715 Ga0501234_007715_448_816 122
180 3300049742 Ga0501080_0306904 Ga0501080_0306904_198_566 122
181 3300049742 Ga0501080_0355648 Ga0501080_0355648_123_503 122
182 3300049742 Ga0501080_1367039 Ga0501080_1367039_33_422 122
183 3300049744 Ga0501083_0179626 Ga0501083_0179626_113_481 122
184 3300049744 Ga0501083_0238358 Ga0501083_0238358_291_659 122
185 3300049822 Ga0501035_0000211 Ga0501035_0000211_49189_49557 122
186 3300049822 Ga0501035_0000821 Ga0501035_0000821_18869_19237 122
187 3300049823 Ga0501044_0309586 Ga0501044_0309586_829_1197 122
188 3300053104 Ga0500556_0000196 Ga0500556_0000196_27856_28224 122
189 3300053142 Ga0500577_0080869 Ga0500577_0080869_585_953 122
190 3300060353 Ga0501082_0117653 Ga0501082_0117653_1777_2145 122
191 3300001979 JGI24740J21852_10029080 JGI24740J21852_100290802 123
192 3300005327 Ga0070658_10001718 Ga0070658_1000171816 123
193 3300005327 Ga0070658_11535089 Ga0070658_115350891 123
194 3300005328 Ga0070676_10002481 Ga0070676_100024814 123
195 3300005355 Ga0070671_100122034 Ga0070671_1001220342 123
196 3300005356 Ga0070674_100087308 Ga0070674_1000873082 123
197 3300005367 Ga0070667_100001621 Ga0070667_10000162128 123
198 3300005456 Ga0070678_100473942 Ga0070678_1004739422 123
199 3300005466 Ga0070685_10001280 Ga0070685_100012802 123
200 3300005530 Ga0070679_101424192 Ga0070679_1014241922 123
201 3300005548 Ga0070665_100037602 Ga0070665_1000376022 123
202 3300005563 Ga0068855_100000003 Ga0068855_10000000334 123
203 3300005563 Ga0068855_100021468 Ga0068855_1000214682 123
204 3300005563 Ga0068855_100105619 Ga0068855_1001056193 123
205 3300005563 Ga0068855_100340104 Ga0068855_1003401042 123
206 3300005564 Ga0070664_100345656 Ga0070664_1003456562 123
207 3300005614 Ga0068856_100001649 Ga0068856_10000164917 123
208 3300005614 Ga0068856_100153934 Ga0068856_1001539344 123
209 3300005614 Ga0068856_101209084 Ga0068856_1012090842 123
210 3300005616 Ga0068852_100661820 Ga0068852_1006618202 123
211 3300005617 Ga0068859_100718507 Ga0068859_1007185071 123
212 3300005841 Ga0068863_100025044 Ga0068863_1000250441 123
213 3300005842 Ga0068858_100015545 Ga0068858_1000155456 123
214 3300005844 Ga0068862_101868086 Ga0068862_1018680862 123
215 3300006028 Ga0070717_10178032 Ga0070717_101780322 123
216 3300006195 Ga0075366_10000518 Ga0075366_1000051813 123
217 3300006237 Ga0097621_100359654 Ga0097621_1003596542 123
218 3300006358 Ga0068871_101958268 Ga0068871_1019582681 123
219 3300006931 Ga0097620_100718479 Ga0097620_1007184791 123
220 3300009094 Ga0111539_10003367 Ga0111539_1000336716 123
221 3300009174 Ga0105241_10000003 Ga0105241_10000003268 123
222 3300009176 Ga0105242_10002304 Ga0105242_1000230419 123
223 3300009177 Ga0105248_11809207 Ga0105248_118092071 123
224 3300009551 Ga0105238_10101277 Ga0105238_101012773 123
225 3300009551 Ga0105238_11095562 Ga0105238_110955622 123
226 3300009553 Ga0105249_10024995 Ga0105249_100249955 123
227 3300009553 Ga0105249_10497703 Ga0105249_104977032 123
228 3300010375 Ga0105239_10666730 Ga0105239_106667302 123
229 3300013105 Ga0157369_10000261 Ga0157369_1000026133 123
230 3300013105 Ga0157369_10051038 Ga0157369_100510383 123
231 3300013105 Ga0157369_11817732 Ga0157369_118177321 123
232 3300013296 Ga0157374_10000509 Ga0157374_1000050921 123
233 3300014325 Ga0163163_10001421 Ga0163163_1000142115 123
234 3300014325 Ga0163163_12431375 Ga0163163_124313751 123
235 3300025907 Ga0207645_10104743 Ga0207645_101047432 123
236 3300025909 Ga0207705_10023000 Ga0207705_100230005 123
237 3300025909 Ga0207705_11218063 Ga0207705_112180632 123
238 3300025911 Ga0207654_10000002 Ga0207654_10000002941 123
239 3300025912 Ga0207707_10557921 Ga0207707_105579212 123
240 3300025921 Ga0207652_11484622 Ga0207652_114846221 123
241 3300025924 Ga0207694_10040504 Ga0207694_100405043 123
242 3300025927 Ga0207687_11019311 Ga0207687_110193112 123
243 3300025931 Ga0207644_10096971 Ga0207644_100969713 123
244 3300025934 Ga0207686_10098261 Ga0207686_100982613 123
245 3300025937 Ga0207669_10265832 Ga0207669_102658322 123
246 3300025944 Ga0207661_11268100 Ga0207661_112681002 123
247 3300025949 Ga0207667_10000008 Ga0207667_1000000833 123
248 3300025949 Ga0207667_10005931 Ga0207667_100059318 123
249 3300025949 Ga0207667_10327062 Ga0207667_103270622 123
250 3300025961 Ga0207712_10288218 Ga0207712_102882182 123
251 3300025961 Ga0207712_10436781 Ga0207712_104367812 123
252 3300025986 Ga0207658_10041580 Ga0207658_100415803 123
253 3300026078 Ga0207702_10003296 Ga0207702_1000329614 123
254 3300026078 Ga0207702_11528537 Ga0207702_115285372 123
255 3300026121 Ga0207683_10039284 Ga0207683_100392842 123
256 3300028379 Ga0268266_10006586 Ga0268266_100065863 123
257 3300028556 Ga0265337_1026610 Ga0265337_10266104 123
258 3300028558 Ga0265326_10002122 Ga0265326_100021224 123
259 3300028558 Ga0265326_10248803 Ga0265326_102488032 123
260 3300028563 Ga0265319_1044541 Ga0265319_10445411 123
261 3300028563 Ga0265319_1141925 Ga0265319_11419252 123
262 3300028573 Ga0265334_10000028 Ga0265334_1000002811 123
263 3300028573 Ga0265334_10000676 Ga0265334_100006769 123
264 3300028573 Ga0265334_10060503 Ga0265334_100605034 123
265 3300028573 Ga0265334_10206956 Ga0265334_102069561 123
266 3300028577 Ga0265318_10015705 Ga0265318_100157054 123
267 3300028577 Ga0265318_10218308 Ga0265318_102183081 123
268 3300028653 Ga0265323_10003157 Ga0265323_100031578 123
269 3300028654 Ga0265322_10002329 Ga0265322_100023292 123
270 3300028666 Ga0265336_10000617 Ga0265336_1000061721 123
271 3300028666 Ga0265336_10014304 Ga0265336_100143044 123
272 3300028800 Ga0265338_10000323 Ga0265338_1000032334 123
273 3300028800 Ga0265338_10000905 Ga0265338_1000090549 123
274 3300028800 Ga0265338_10029392 Ga0265338_100293924 123
275 3300028800 Ga0265338_10039752 Ga0265338_100397524 123
276 3300028800 Ga0265338_10126224 Ga0265338_101262242 123
277 3300029957 Ga0265324_10005721 Ga0265324_100057212 123
278 3300029957 Ga0265324_10005979 Ga0265324_100059792 123
279 3300029957 Ga0265324_10070639 Ga0265324_100706391 123
280 3300031235 Ga0265330_10007024 Ga0265330_100070243 123
281 3300031238 Ga0265332_10004991 Ga0265332_100049916 123
282 3300031239 Ga0265328_10005462 Ga0265328_100054625 123
283 3300031240 Ga0265320_10095599 Ga0265320_100955992 123
284 3300031241 Ga0265325_10014680 Ga0265325_100146805 123
285 3300031242 Ga0265329_10015085 Ga0265329_100150852 123
286 3300031247 Ga0265340_10000065 Ga0265340_1000006529 123
287 3300031247 Ga0265340_10025163 Ga0265340_100251632 123
288 3300031249 Ga0265339_10012088 Ga0265339_100120885 123
289 3300031250 Ga0265331_10003777 Ga0265331_100037775 123
290 3300031251 Ga0265327_10002783 Ga0265327_1000278312 123
291 3300031251 Ga0265327_10006609 Ga0265327_100066095 123
292 3300031344 Ga0265316_10031122 Ga0265316_100311224 123
293 3300031344 Ga0265316_10135255 Ga0265316_101352552 123
294 3300031595 Ga0265313_10011375 Ga0265313_100113752 123
295 3300031595 Ga0265313_10032017 Ga0265313_100320173 123
296 3300031711 Ga0265314_10009493 Ga0265314_100094936 123
297 3300031712 Ga0265342_10005104 Ga0265342_100051045 123
298 3300031712 Ga0265342_10120922 Ga0265342_101209222 123
299 3300031712 Ga0265342_10369415 Ga0265342_103694152 123
300 3300031730 Ga0307516_10492809 Ga0307516_104928092 123
301 3300037418 Ga0395900_0367923 Ga0395900_0367923_543_926 123
302 3300037471 Ga0395905_0043428 Ga0395905_0043428_671_1054 123
303 3300046538 Ga0495609_0079106 Ga0495609_0079106_1031_1405 123
304 3300047320 Ga0495672_0171090 Ga0495672_0171090_17_391 123
305 3300048908 Ga0496105_0249087 Ga0496105_0249087_472_843 123
306 3300048915 Ga0496112_0020062 Ga0496112_0020062_1074_1445 123
307 3300049586 Ga0501070_0032149 Ga0501070_0032149_3110_3484 123
308 3300050493 nmdc:mga0k408_17_c1 nmdc:mga0k408_17_c1_8250_8624 123
309 3300050511 nmdc:mga08y16_1620_c2 nmdc:mga08y16_1620_c2_10454_10831 123
310 3300053079 Ga0500610_0000001 Ga0500610_0000001_184158_184532 123
311 3300053087 Ga0500643_000022 Ga0500643_000022_61467_61850 123
312 3300053087 Ga0500643_010576 Ga0500643_010576_452_826 123
313 3300053088 Ga0500644_0000006 Ga0500644_0000006_56102_56476 123
314 3300053088 Ga0500644_0006492 Ga0500644_0006492_366_740 123
315 3300053103 Ga0500555_000002 Ga0500555_000002_602039_602413 123
316 3300053108 Ga0500562_018824 Ga0500562_018824_25_399 123
317 3300053118 Ga0500594_0000185 Ga0500594_0000185_7095_7469 123
318 3300053129 Ga0500628_000015 Ga0500628_000015_81774_82148 123
319 3300053129 Ga0500628_077448 Ga0500628_077448_120_491 123
320 3300053131 Ga0500652_000020 Ga0500652_000020_90088_90462 123
321 3300053153 Ga0500616_0000005 Ga0500616_0000005_295578_295961 123
322 3300053153 Ga0500616_0213865 Ga0500616_0213865_16_399 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06262

Zincin_1

Zincin-like metallopeptidase

42

137

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.779 1 123
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7667 1 123
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.689 5 110
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6404 5 110
2ejq-assembly2.cif.gz_B conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6187 5 121
ID Description Score Start End Superfamily
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7706 1 123 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7644 1 123 3.30.2010.20
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6923 3 114 3.30.2010.20
2ejqA00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.689 5 110 3.30.2010.20
2ejqA00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6404 5 110 3.30.2010.20
ID Description Score Start End GO Terms
AF-A0A2E7N382-F1-model_v4 Metallopeptidase family protein 0.9702 3 122
AF-A0A2E7N382-F1-model_v4 Metallopeptidase family protein 0.9396 3 122
AF-A0A0G1VNN3-F1-model_v4 Metallopeptidase family protein 0.9301 4 120
AF-A0A0G0YFT2-F1-model_v4 Metallopeptidase family protein 0.9262 9 122
AF-A0A0M8K9W0-F1-model_v4 Metallopeptidase family protein 0.9196 4 122

Feature Viewer

pLDDT pTM Quality
91.06 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map