F406482

General Info

Members Datasets Scaffolds Average Seq Length
322 186 644 241

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10242127|Ga0207664_102421272
Length 274
Sequence VRGRSGCAATPRTRSARSGRRFRAPLCHHAPMRARSYDRGPGEMRPVEIEPGFVRSATGSALISVGETRVICTASVEESVPRWMVGQGRGWVTAEYGMLPASTGQRKPRDVSKGRADGRTVEIQRLIGRSLRGVVDFDALGERTVYVDCDVLQADGGTRCAAITGGWVALRLAFERLVGDGKLERVPLSGAVAAVSSGIVDGVPVLDLDYPEDSTAEVDANVVMTGDGGLVEVQATAERTPLSRAHLDQLLALAADGIAQLHELQDAVVAGART

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
89 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
94 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 4.35
Rhizosphere 90.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10242127 3300025929 Bacteria 1571
2 JGI25406J46586_10033350 3300003203 Bacteria 1902
3 Ga0070683_100039534 3300005329 Bacteria 4331
4 Ga0070683_100078886 3300005329 Bacteria 3081
5 Ga0070683_100448628 3300005329 Bacteria 1231
6 Ga0068868_100404465 3300005338 Bacteria 1179
7 Ga0070660_100047907 3300005339 Bacteria 3281
8 Ga0070660_100288074 3300005339 Bacteria 1345
9 Ga0070668_100053194 3300005347 Bacteria 3123
10 Ga0070669_100009953 3300005353 Bacteria 6764
11 Ga0070674_100256576 3300005356 Bacteria 1375
12 Ga0070659_100000026 3300005366 Bacteria 143542
13 Ga0070659_100028328 3300005366 Bacteria 4324
14 Ga0070659_100084904 3300005366 Bacteria 2532
15 Ga0070659_100583036 3300005366 Bacteria 960
16 Ga0070714_100000083 3300005435 Bacteria 81010
17 Ga0070714_100002756 3300005435 Bacteria 12952
18 Ga0070714_100167479 3300005435 Bacteria 1992
19 Ga0070710_10000008 3300005437 Bacteria 198148
20 Ga0070705_100000405 3300005440 Bacteria 24782
21 Ga0070663_100141090 3300005455 Bacteria 1840
22 Ga0070681_10222547 3300005458 Bacteria 1802
23 Ga0068867_100120192 3300005459 Bacteria 2029
24 Ga0070685_10259550 3300005466 Bacteria 1155
25 Ga0070679_100054008 3300005530 Bacteria 3999
26 Ga0070684_100118977 3300005535 Bacteria 2375
27 Ga0070684_100203079 3300005535 Bacteria 1805
28 Ga0070684_100219989 3300005535 Bacteria 1732
29 Ga0068855_100454659 3300005563 Bacteria 1397
30 Ga0070664_100088045 3300005564 Bacteria 2685
31 Ga0070664_100584392 3300005564 Bacteria 1035
32 Ga0068857_100332784 3300005577 Bacteria 1404
33 Ga0068857_100497492 3300005577 Bacteria 1144
34 Ga0068854_100153241 3300005578 Bacteria 1779
35 Ga0068854_100277552 3300005578 Bacteria 1348
36 Ga0068856_100017255 3300005614 Bacteria 6996
37 Ga0068856_100413059 3300005614 Bacteria 1369
38 Ga0068856_100640170 3300005614 Bacteria 1084
39 Ga0070702_100404992 3300005615 Bacteria 977
40 Ga0068852_100388365 3300005616 Bacteria 1371
41 Ga0068859_100375563 3300005617 Bacteria 1517
42 Ga0068866_10143427 3300005718 Bacteria 1374
43 Ga0081455_10093634 3300005937 Bacteria 2428
44 Ga0081538_10004075 3300005981 Bacteria 13591
45 Ga0081538_10042141 3300005981 Bacteria 2885
46 Ga0081538_10068925 3300005981 Bacteria 1963
47 Ga0081538_10096128 3300005981 Bacteria 1510
48 Ga0081538_10202321 3300005981 Bacteria 814
49 Ga0081539_10000855 3300005985 Bacteria 58253
50 Ga0070717_10000004 3300006028 Bacteria 365525
51 Ga0075428_100039098 3300006844 Bacteria 5222
52 Ga0075428_100117048 3300006844 Bacteria 2903
53 Ga0075428_100135848 3300006844 Bacteria 2674
54 Ga0075430_100007400 3300006846 Bacteria 9269
55 Ga0075431_100005521 3300006847 Bacteria 12483
56 Ga0075431_100057011 3300006847 Bacteria 4029
57 Ga0075433_10045015 3300006852 Bacteria 3835
58 Ga0075433_10111513 3300006852 Bacteria 2427
59 Ga0075434_100003191 3300006871 Bacteria 14624
60 Ga0075434_100022076 3300006871 Bacteria 6197
61 Ga0075434_100072642 3300006871 Bacteria 3432
62 Ga0075429_100002469 3300006880 Bacteria 15554
63 Ga0097620_100375564 3300006931 Bacteria 1517
64 Ga0075435_100116535 3300007076 Bacteria 2226
65 Ga0075435_100140500 3300007076 Bacteria 2026
66 Ga0105240_10488818 3300009093 Bacteria 1371
67 Ga0111539_10013984 3300009094 Bacteria 10029
68 Ga0111539_10466397 3300009094 Bacteria 1470
69 Ga0105245_10112054 3300009098 Bacteria 2538
70 Ga0105245_10310643 3300009098 Bacteria 1550
71 Ga0114129_10003187 3300009147 Bacteria 23006
72 Ga0114129_10093213 3300009147 Bacteria 4172
73 Ga0114129_10286795 3300009147 Bacteria 2198
74 Ga0105241_10338879 3300009174 Bacteria 1302
75 Ga0105242_10705405 3300009176 Bacteria 988
76 Ga0105237_10018771 3300009545 Bacteria 7151
77 Ga0105239_10070213 3300010375 Bacteria 3847
78 Ga0105239_10185361 3300010375 Bacteria 2329
79 Ga0105246_10431220 3300011119 Bacteria 1103
80 Ga0105246_10469018 3300011119 Bacteria 1062
81 Ga0105246_10483750 3300011119 Bacteria 1048
82 Ga0157315_1005251 3300012508 Bacteria 964
83 Ga0157370_10011232 3300013104 Bacteria 9389
84 Ga0157372_10257333 3300013307 Bacteria 2027
85 Ga0157375_10864878 3300013308 Bacteria 1050
86 Ga0157375_11004408 3300013308 Bacteria 974
87 Ga0163163_10621161 3300014325 Bacteria 1144
88 Ga0163163_11245056 3300014325 Bacteria 806
89 Ga0157380_10110510 3300014326 Bacteria 2309
90 Ga0157377_10229449 3300014745 Bacteria 1193
91 Ga0157379_10005812 3300014968 Bacteria 10611
92 Ga0206356_10048207 3300020070 Bacteria 1633
93 Ga0206353_10665729 3300020082 Bacteria 3159
94 Ga0213876_10003770 3300021384 Bacteria 8595
95 Ga0213876_10008648 3300021384 Bacteria 5509
96 Ga0213875_10025016 3300021388 Bacteria 2846
97 Ga0207426_1047637 3300025302 Bacteria 1292
98 Ga0207692_10000006 3300025898 Bacteria 294686
99 Ga0207688_10226745 3300025901 Bacteria 1127
100 Ga0207705_10568057 3300025909 Bacteria 882
101 Ga0207707_10072393 3300025912 Bacteria 3004
102 Ga0207660_10145454 3300025917 Bacteria 1816
103 Ga0207662_10198981 3300025918 Bacteria 1296
104 Ga0207657_10003497 3300025919 Bacteria 16771
105 Ga0207657_10098984 3300025919 Bacteria 2422
106 Ga0207657_10267448 3300025919 Bacteria 1360
107 Ga0207657_10358686 3300025919 Bacteria 1149
108 Ga0207652_10381617 3300025921 Bacteria 1272
109 Ga0207681_10004366 3300025923 Bacteria 8718
110 Ga0207664_10000006 3300025929 Bacteria 408702
111 Ga0207664_10055244 3300025929 Bacteria 3150
112 Ga0207664_10230171 3300025929 Bacteria 1611
113 Ga0207690_10000017 3300025932 Bacteria 243513
114 Ga0207690_10048680 3300025932 Bacteria 2820
115 Ga0207690_10226120 3300025932 Bacteria 1434
116 Ga0207669_10132038 3300025937 Bacteria 1718
117 Ga0207669_10264891 3300025937 Bacteria 1288
118 Ga0207669_10635016 3300025937 Bacteria 872
119 Ga0207665_10369301 3300025939 Bacteria 1086
120 Ga0207661_10059050 3300025944 Bacteria 3089
121 Ga0207661_10246680 3300025944 Bacteria 1586
122 Ga0207679_10250799 3300025945 Bacteria 1505
123 Ga0207679_10548710 3300025945 Bacteria 1037
124 Ga0207712_10121271 3300025961 Bacteria 1978
125 Ga0207640_10188516 3300025981 Bacteria 1552
126 Ga0207640_10287576 3300025981 Bacteria 1294
127 Ga0207640_10406192 3300025981 Bacteria 1110
128 Ga0207640_10457032 3300025981 Bacteria 1054
129 Ga0207677_10163640 3300026023 Bacteria 1731
130 Ga0207678_10063071 3300026067 Bacteria 3185
131 Ga0207678_10091390 3300026067 Bacteria 2601
132 Ga0207702_10046235 3300026078 Bacteria 3663
133 Ga0207702_10078098 3300026078 Bacteria 2865
134 Ga0207702_10296733 3300026078 Bacteria 1533
135 Ga0207702_10539661 3300026078 Bacteria 1140
136 Ga0207648_10308604 3300026089 Bacteria 1420
137 Ga0207674_10023644 3300026116 Bacteria 6579
138 Ga0207674_10540703 3300026116 Bacteria 1125
139 Ga0207675_100182720 3300026118 Bacteria 2009
140 Ga0207675_100221115 3300026118 Bacteria 1825
141 Ga0207698_10145223 3300026142 Bacteria 2051
142 Ga0207428_10175992 3300027907 Bacteria 1618
143 Ga0268266_10223057 3300028379 Bacteria 1734
144 Ga0268265_10441877 3300028380 Bacteria 1213
145 Ga0265337_1003583 3300028556 Bacteria 6677
146 Ga0265326_10000016 3300028558 Bacteria 154674
147 Ga0265326_10009561 3300028558 Bacteria 2900
148 Ga0265326_10064526 3300028558 Bacteria 1036
149 Ga0265319_1001364 3300028563 Bacteria 14681
150 Ga0265319_1001403 3300028563 Bacteria 14443
151 Ga0265334_10000076 3300028573 Bacteria 71688
152 Ga0265318_10000621 3300028577 Bacteria 24545
153 Ga0265322_10014043 3300028654 Bacteria 2317
154 Ga0265336_10000060 3300028666 Bacteria 103055
155 Ga0265336_10014111 3300028666 Bacteria 2651
156 Ga0265338_10000234 3300028800 Bacteria 103028
157 Ga0265338_10006212 3300028800 Bacteria 15302
158 Ga0265338_10049785 3300028800 Bacteria 3794
159 Ga0265338_10051913 3300028800 Bacteria 3686
160 Ga0265324_10001083 3300029957 Bacteria 16395
161 Ga0265324_10016422 3300029957 Bacteria 2702
162 Ga0265340_10000014 3300031247 Bacteria 103055
163 Ga0265339_10000868 3300031249 Bacteria 23247
164 Ga0265316_10011255 3300031344 Bacteria 8086
165 Ga0307408_100109329 3300031548 Bacteria 2121
166 Ga0265314_10066225 3300031711 Bacteria 2437
167 Ga0307405_10363883 3300031731 Bacteria 1120
168 Ga0307413_10113562 3300031824 Bacteria 1819
169 Ga0307413_10337013 3300031824 Bacteria 1158
170 Ga0307410_10041837 3300031852 Bacteria 3024
171 Ga0307406_10031039 3300031901 Bacteria 3251
172 Ga0307406_10249087 3300031901 Bacteria 1337
173 Ga0307407_10071840 3300031903 Bacteria 2062
174 Ga0307409_100012400 3300031995 Bacteria 5431
175 Ga0307416_100123857 3300032002 Bacteria 2311
176 Ga0307415_100063816 3300032126 Bacteria 2561
177 Ga0307415_100096448 3300032126 Bacteria 2155
178 Ga0395900_0008276 3300037418 Bacteria 10704
179 Ga0395898_0002400 3300037466 Bacteria 22246
180 Ga0395898_0214516 3300037466 Bacteria 1836
181 Ga0395898_0530028 3300037466 Bacteria 1119
182 Ga0395905_0517631 3300037471 Bacteria 1094
183 Ga0436364_0685557 3300037853 Bacteria 6633
184 Ga0395901_0263659 3300038443 Bacteria 1793
185 Ga0436365_0088511 3300039437 Bacteria 23289
186 Ga0436365_1030162 3300039437 Bacteria 1145
187 Ga0436365_1603954 3300039437 Bacteria 2349
188 Ga0436363_0359159 3300039450 Bacteria 825
189 Ga0436363_0385136 3300039450 Bacteria 1080
190 Ga0436363_1379261 3300039450 Bacteria 2858
191 Ga0436362_0695594 3300039453 Bacteria 3935
192 Ga0451791_1468551 3300041451 Bacteria 1730
193 Ga0451793_1368730 3300041452 Bacteria 898
194 Ga0451853_3538980 3300041512 Bacteria 1798
195 Ga0439440_0014340 3300042993 Bacteria 1710
196 Ga0466969_0002437 3300044656 Bacteria 9917
197 Ga0466969_0144589 3300044656 Bacteria 1098
198 Ga0466972_0159978 3300044658 Bacteria 1058
199 Ga0466965_0226421 3300044683 Bacteria 998
200 Ga0466963_0025881 3300044694 Bacteria 3746
201 Ga0466963_0060980 3300044694 Bacteria 2520
202 Ga0466963_0102256 3300044694 Bacteria 1962
203 Ga0466964_0182667 3300044706 Bacteria 996
204 Ga0466971_0011070 3300044719 Bacteria 3950
205 Ga0466971_0017972 3300044719 Bacteria 3131
206 Ga0466971_0088591 3300044719 Bacteria 1416
207 Ga0466957_0127119 3300044842 Bacteria 1629
208 Ga0466957_0156734 3300044842 Bacteria 1476
209 Ga0466957_0267903 3300044842 Bacteria 1140
210 Ga0466960_0000004 3300044901 Bacteria 84724
211 Ga0466960_0039313 3300044901 Bacteria 2231
212 Ga0466960_0126079 3300044901 Bacteria 1346
213 Ga0466960_0159261 3300044901 Bacteria 1211
214 Ga0466960_0367060 3300044901 Bacteria 824
215 Ga0466959_0003500 3300045049 Bacteria 10290
216 Ga0466959_0121995 3300045049 Bacteria 1852
217 Ga0466958_0084174 3300045836 Bacteria 1961
218 Ga0466958_0170390 3300045836 Bacteria 1378
219 Ga0466967_0026280 3300045976 Bacteria 4819
220 Ga0466967_0032163 3300045976 Bacteria 4426
221 Ga0466967_0052786 3300045976 Bacteria 3570
222 Ga0466967_0053759 3300045976 Bacteria 3541
223 Ga0466967_0133317 3300045976 Bacteria 2308
224 Ga0466967_0134268 3300045976 Bacteria 2300
225 Ga0466967_0142492 3300045976 Bacteria 2234
226 Ga0466967_0188615 3300045976 Bacteria 1948
227 Ga0466967_0233801 3300045976 Bacteria 1751
228 Ga0466967_0237968 3300045976 Bacteria 1735
229 Ga0466967_0246685 3300045976 Bacteria 1704
230 Ga0466967_0399792 3300045976 Bacteria 1336
231 Ga0466967_0455497 3300045976 Bacteria 1251
232 Ga0466967_0459695 3300045976 Bacteria 1245
233 Ga0466967_0667511 3300045976 Bacteria 1029
234 Ga0495650_0000035 3300046471 Bacteria 403799
235 Ga0495608_0130381 3300046511 Bacteria 1609
236 Ga0495631_0211879 3300046518 Bacteria 828
237 Ga0495600_0069586 3300046809 Bacteria 2300
238 Ga0495604_0001124 3300047317 Bacteria 22220
239 Ga0495674_0526067 3300047319 Bacteria 944
240 Ga0496102_0000096 3300048905 Bacteria 124941
241 Ga0496103_0000035 3300048906 Bacteria 182242
242 Ga0496104_0000028 3300048907 Bacteria 203377
243 Ga0496108_0094843 3300048911 Bacteria 2540
244 Ga0496108_0289259 3300048911 Bacteria 1427
245 Ga0496109_0143967 3300048912 Bacteria 2229
246 Ga0496109_0201157 3300048912 Bacteria 1873
247 Ga0496110_0000604 3300048913 Bacteria 24724
248 Ga0496111_0000531 3300048914 Bacteria 19737
249 Ga0496113_0150317 3300048916 Bacteria 1837
250 Ga0496113_0395512 3300048916 Bacteria 1109
251 Ga0496115_0283892 3300048918 Bacteria 1359
252 Ga0496119_0028457 3300048922 Bacteria 3813
253 Ga0496121_0002900 3300048924 Bacteria 25168
254 Ga0496126_0591125 3300048929 Bacteria 876
255 Ga0501291_007865 3300049514 Bacteria 1458
256 Ga0501034_0010237 3300049571 Bacteria 9781
257 Ga0501034_0065771 3300049571 Bacteria 3639
258 Ga0501039_0011190 3300049575 Bacteria 6836
259 Ga0501039_0062693 3300049575 Bacteria 2881
260 Ga0501039_0191063 3300049575 Bacteria 1610
261 Ga0501040_0029309 3300049576 Bacteria 3715
262 Ga0501040_0348352 3300049576 Bacteria 1061
263 Ga0501041_0045688 3300049577 Bacteria 2663
264 Ga0501041_0190706 3300049577 Bacteria 1284
265 Ga0501042_0058933 3300049578 Bacteria 2741
266 Ga0501046_0074591 3300049580 Bacteria 2632
267 Ga0501046_0105047 3300049580 Bacteria 2164
268 Ga0501046_0175595 3300049580 Bacteria 1605
269 Ga0501048_0396274 3300049582 Bacteria 986
270 Ga0501067_0207151 3300049583 Bacteria 1092
271 Ga0501070_0168751 3300049586 Bacteria 1803
272 Ga0501071_0138108 3300049587 Bacteria 1814
273 Ga0501071_0174157 3300049587 Bacteria 1611
274 Ga0501072_0182027 3300049588 Bacteria 1676
275 Ga0501072_0257393 3300049588 Bacteria 1390
276 Ga0501072_0336827 3300049588 Bacteria 1198
277 Ga0501072_0444548 3300049588 Bacteria 1027
278 Ga0501072_0447260 3300049588 Bacteria 1023
279 Ga0501072_0556294 3300049588 Bacteria 906
280 Ga0501075_0241736 3300049591 Bacteria 1376
281 Ga0501076_0063743 3300049592 Bacteria 2937
282 Ga0501076_0471363 3300049592 Bacteria 1034
283 Ga0501077_0132095 3300049593 Bacteria 1583
284 Ga0501079_0127700 3300049741 Bacteria 1978
285 Ga0501080_0387386 3300049742 Bacteria 1259
286 Ga0501080_0481680 3300049742 Bacteria 1110
287 Ga0501081_0051910 3300049743 Bacteria 2828
288 Ga0501081_0127345 3300049743 Bacteria 1817
289 Ga0501045_0072955 3300049824 Bacteria 2527
290 Ga0501045_0118752 3300049824 Bacteria 1963
291 Ga0501045_0242394 3300049824 Bacteria 1342
292 nmdc:mga06z11_216646_c1 3300050494 Bacteria 1117
293 nmdc:mga05p37_201375_c1 3300050507 Bacteria 2411
294 nmdc:mga05p37_5635_c1 3300050507 Bacteria 14720
295 nmdc:mga05p37_785034_c1 3300050507 Bacteria 1044
296 nmdc:mga05p37_8487_c1 3300050507 Bacteria 12147
297 nmdc:mga09592_791_c1 3300050508 Bacteria 24480
298 nmdc:mga0qj67_20499_c1 3300050509 Bacteria 5063
299 nmdc:mga06r32_140764_c1 3300050510 Bacteria 2389
300 nmdc:mga08y16_184720_c1 3300050511 Bacteria 2164
301 nmdc:mga08y16_252685_c1 3300050511 Bacteria 1821
302 nmdc:mga08y16_64492_c1 3300050511 Bacteria 3825
303 nmdc:mga08y16_85312_c1 3300050511 Bacteria 3291
304 nmdc:mga0n895_33921_c1 3300050512 Bacteria 4909
305 nmdc:mga0n895_36566_c1 3300050512 Bacteria 4742
306 nmdc:mga0n895_8331_c1 3300050512 Bacteria 8974
307 nmdc:mga0rr50_297570_c1 3300050513 Bacteria 1349
308 nmdc:mga0rr50_51311_c1 3300050513 Bacteria 3060
309 nmdc:mga08x19_18542_c1 3300050514 Bacteria 4264
310 nmdc:mga0a205_166940_c1 3300050515 Bacteria 2097
311 nmdc:mga0a205_177616_c1 3300050515 Bacteria 2024
312 nmdc:mga0a205_184051_c1 3300050515 Bacteria 1983
313 Ga0495655_0038321 3300053083 Bacteria 1209
314 Ga0495619_0030918 3300053085 Bacteria 3468
315 Ga0500614_037000 3300053123 Bacteria 1223
316 Ga0500616_0033721 3300053153 Bacteria 2792
317 Ga0501084_0110433 3300054114 Bacteria 2310
318 Ga0501084_0140764 3300054114 Bacteria 2031
319 Ga0466962_0014563 3300061719 Bacteria 3790
320 Ga0466962_0172148 3300061719 Bacteria 1054
321 Ga0530510_0064463 3300061734 Bacteria 2653
322 Ga0530510_0071607 3300061734 Bacteria 2516
323 Ga0207664_10242127
324 JGI25406J46586_10033350
325 Ga0070683_100039534
326 Ga0070683_100078886
327 Ga0070683_100448628
328 Ga0068868_100404465
329 Ga0070660_100047907
330 Ga0070660_100288074
331 Ga0070668_100053194
332 Ga0070669_100009953
333 Ga0070674_100256576
334 Ga0070659_100000026
335 Ga0070659_100028328
336 Ga0070659_100084904
337 Ga0070659_100583036
338 Ga0070714_100000083
339 Ga0070714_100002756
340 Ga0070714_100167479
341 Ga0070710_10000008
342 Ga0070705_100000405
343 Ga0070663_100141090
344 Ga0070681_10222547
345 Ga0068867_100120192
346 Ga0070685_10259550
347 Ga0070679_100054008
348 Ga0070684_100118977
349 Ga0070684_100203079
350 Ga0070684_100219989
351 Ga0068855_100454659
352 Ga0070664_100088045
353 Ga0070664_100584392
354 Ga0068857_100332784
355 Ga0068857_100497492
356 Ga0068854_100153241
357 Ga0068854_100277552
358 Ga0068856_100017255
359 Ga0068856_100413059
360 Ga0068856_100640170
361 Ga0070702_100404992
362 Ga0068852_100388365
363 Ga0068859_100375563
364 Ga0068866_10143427
365 Ga0081455_10093634
366 Ga0081538_10004075
367 Ga0081538_10042141
368 Ga0081538_10068925
369 Ga0081538_10096128
370 Ga0081538_10202321
371 Ga0081539_10000855
372 Ga0070717_10000004
373 Ga0075428_100039098
374 Ga0075428_100117048
375 Ga0075428_100135848
376 Ga0075430_100007400
377 Ga0075431_100005521
378 Ga0075431_100057011
379 Ga0075433_10045015
380 Ga0075433_10111513
381 Ga0075434_100003191
382 Ga0075434_100022076
383 Ga0075434_100072642
384 Ga0075429_100002469
385 Ga0097620_100375564
386 Ga0075435_100116535
387 Ga0075435_100140500
388 Ga0105240_10488818
389 Ga0111539_10013984
390 Ga0111539_10466397
391 Ga0105245_10112054
392 Ga0105245_10310643
393 Ga0114129_10003187
394 Ga0114129_10093213
395 Ga0114129_10286795
396 Ga0105241_10338879
397 Ga0105242_10705405
398 Ga0105237_10018771
399 Ga0105239_10070213
400 Ga0105239_10185361
401 Ga0105246_10431220
402 Ga0105246_10469018
403 Ga0105246_10483750
404 Ga0157315_1005251
405 Ga0157370_10011232
406 Ga0157372_10257333
407 Ga0157375_10864878
408 Ga0157375_11004408
409 Ga0163163_10621161
410 Ga0163163_11245056
411 Ga0157380_10110510
412 Ga0157377_10229449
413 Ga0157379_10005812
414 Ga0206356_10048207
415 Ga0206353_10665729
416 Ga0213876_10003770
417 Ga0213876_10008648
418 Ga0213875_10025016
419 Ga0207426_1047637
420 Ga0207692_10000006
421 Ga0207688_10226745
422 Ga0207705_10568057
423 Ga0207707_10072393
424 Ga0207660_10145454
425 Ga0207662_10198981
426 Ga0207657_10003497
427 Ga0207657_10098984
428 Ga0207657_10267448
429 Ga0207657_10358686
430 Ga0207652_10381617
431 Ga0207681_10004366
432 Ga0207664_10000006
433 Ga0207664_10055244
434 Ga0207664_10230171
435 Ga0207690_10000017
436 Ga0207690_10048680
437 Ga0207690_10226120
438 Ga0207669_10132038
439 Ga0207669_10264891
440 Ga0207669_10635016
441 Ga0207665_10369301
442 Ga0207661_10059050
443 Ga0207661_10246680
444 Ga0207679_10250799
445 Ga0207679_10548710
446 Ga0207712_10121271
447 Ga0207640_10188516
448 Ga0207640_10287576
449 Ga0207640_10406192
450 Ga0207640_10457032
451 Ga0207677_10163640
452 Ga0207678_10063071
453 Ga0207678_10091390
454 Ga0207702_10046235
455 Ga0207702_10078098
456 Ga0207702_10296733
457 Ga0207702_10539661
458 Ga0207648_10308604
459 Ga0207674_10023644
460 Ga0207674_10540703
461 Ga0207675_100182720
462 Ga0207675_100221115
463 Ga0207698_10145223
464 Ga0207428_10175992
465 Ga0268266_10223057
466 Ga0268265_10441877
467 Ga0265337_1003583
468 Ga0265326_10000016
469 Ga0265326_10009561
470 Ga0265326_10064526
471 Ga0265319_1001364
472 Ga0265319_1001403
473 Ga0265334_10000076
474 Ga0265318_10000621
475 Ga0265322_10014043
476 Ga0265336_10000060
477 Ga0265336_10014111
478 Ga0265338_10000234
479 Ga0265338_10006212
480 Ga0265338_10049785
481 Ga0265338_10051913
482 Ga0265324_10001083
483 Ga0265324_10016422
484 Ga0265340_10000014
485 Ga0265339_10000868
486 Ga0265316_10011255
487 Ga0307408_100109329
488 Ga0265314_10066225
489 Ga0307405_10363883
490 Ga0307413_10113562
491 Ga0307413_10337013
492 Ga0307410_10041837
493 Ga0307406_10031039
494 Ga0307406_10249087
495 Ga0307407_10071840
496 Ga0307409_100012400
497 Ga0307416_100123857
498 Ga0307415_100063816
499 Ga0307415_100096448
500 Ga0395900_0008276
501 Ga0395898_0002400
502 Ga0395898_0214516
503 Ga0395898_0530028
504 Ga0395905_0517631
505 Ga0436364_0685557
506 Ga0395901_0263659
507 Ga0436365_0088511
508 Ga0436365_1030162
509 Ga0436365_1603954
510 Ga0436363_0359159
511 Ga0436363_0385136
512 Ga0436363_1379261
513 Ga0436362_0695594
514 Ga0451791_1468551
515 Ga0451793_1368730
516 Ga0451853_3538980
517 Ga0439440_0014340
518 Ga0466969_0002437
519 Ga0466969_0144589
520 Ga0466972_0159978
521 Ga0466965_0226421
522 Ga0466963_0025881
523 Ga0466963_0060980
524 Ga0466963_0102256
525 Ga0466964_0182667
526 Ga0466971_0011070
527 Ga0466971_0017972
528 Ga0466971_0088591
529 Ga0466957_0127119
530 Ga0466957_0156734
531 Ga0466957_0267903
532 Ga0466960_0000004
533 Ga0466960_0039313
534 Ga0466960_0126079
535 Ga0466960_0159261
536 Ga0466960_0367060
537 Ga0466959_0003500
538 Ga0466959_0121995
539 Ga0466958_0084174
540 Ga0466958_0170390
541 Ga0466967_0026280
542 Ga0466967_0032163
543 Ga0466967_0052786
544 Ga0466967_0053759
545 Ga0466967_0133317
546 Ga0466967_0134268
547 Ga0466967_0142492
548 Ga0466967_0188615
549 Ga0466967_0233801
550 Ga0466967_0237968
551 Ga0466967_0246685
552 Ga0466967_0399792
553 Ga0466967_0455497
554 Ga0466967_0459695
555 Ga0466967_0667511
556 Ga0495650_0000035
557 Ga0495608_0130381
558 Ga0495631_0211879
559 Ga0495600_0069586
560 Ga0495604_0001124
561 Ga0495674_0526067
562 Ga0496102_0000096
563 Ga0496103_0000035
564 Ga0496104_0000028
565 Ga0496108_0094843
566 Ga0496108_0289259
567 Ga0496109_0143967
568 Ga0496109_0201157
569 Ga0496110_0000604
570 Ga0496111_0000531
571 Ga0496113_0150317
572 Ga0496113_0395512
573 Ga0496115_0283892
574 Ga0496119_0028457
575 Ga0496121_0002900
576 Ga0496126_0591125
577 Ga0501291_007865
578 Ga0501034_0010237
579 Ga0501034_0065771
580 Ga0501039_0011190
581 Ga0501039_0062693
582 Ga0501039_0191063
583 Ga0501040_0029309
584 Ga0501040_0348352
585 Ga0501041_0045688
586 Ga0501041_0190706
587 Ga0501042_0058933
588 Ga0501046_0074591
589 Ga0501046_0105047
590 Ga0501046_0175595
591 Ga0501048_0396274
592 Ga0501067_0207151
593 Ga0501070_0168751
594 Ga0501071_0138108
595 Ga0501071_0174157
596 Ga0501072_0182027
597 Ga0501072_0257393
598 Ga0501072_0336827
599 Ga0501072_0444548
600 Ga0501072_0447260
601 Ga0501072_0556294
602 Ga0501075_0241736
603 Ga0501076_0063743
604 Ga0501076_0471363
605 Ga0501077_0132095
606 Ga0501079_0127700
607 Ga0501080_0387386
608 Ga0501080_0481680
609 Ga0501081_0051910
610 Ga0501081_0127345
611 Ga0501045_0072955
612 Ga0501045_0118752
613 Ga0501045_0242394
614 nmdc:mga06z11_216646_c1
615 nmdc:mga05p37_201375_c1
616 nmdc:mga05p37_5635_c1
617 nmdc:mga05p37_785034_c1
618 nmdc:mga05p37_8487_c1
619 nmdc:mga09592_791_c1
620 nmdc:mga0qj67_20499_c1
621 nmdc:mga06r32_140764_c1
622 nmdc:mga08y16_184720_c1
623 nmdc:mga08y16_252685_c1
624 nmdc:mga08y16_64492_c1
625 nmdc:mga08y16_85312_c1
626 nmdc:mga0n895_33921_c1
627 nmdc:mga0n895_36566_c1
628 nmdc:mga0n895_8331_c1
629 nmdc:mga0rr50_297570_c1
630 nmdc:mga0rr50_51311_c1
631 nmdc:mga08x19_18542_c1
632 nmdc:mga0a205_166940_c1
633 nmdc:mga0a205_177616_c1
634 nmdc:mga0a205_184051_c1
635 Ga0495655_0038321
636 Ga0495619_0030918
637 Ga0500614_037000
638 Ga0500616_0033721
639 Ga0501084_0110433
640 Ga0501084_0140764
641 Ga0466962_0014563
642 Ga0466962_0172148
643 Ga0530510_0064463
644 Ga0530510_0071607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03725

RNase_PH_C

3' exoribonuclease family, domain 2

190

257

0.97

PF01138

RNase_PH

3' exoribonuclease family, domain 1

43

174

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oyr-assembly1.cif.gz_C crystal structure of the phosphorolytic exoribonuclease rnase ph from bacillus subtilis 0.9817 3 238
1udn-assembly1.cif.gz_A crystal structure of the trna processing enzyme rnase ph from aquifex aeolicus 0.9749 3 234
1udo-assembly1.cif.gz_A crystal structure of the trna processing enzyme rnase ph r86a mutant from aquifex aeolicus 0.9745 3 235
1uds-assembly1.cif.gz_A crystal structure of the trna processing enzyme rnase ph r126a mutant from aquifex aeolicus 0.9736 3 234
1oyp-assembly1.cif.gz_A crystal structure of the phosphorolytic exoribonuclease rnase ph from bacillus subtilis 0.973 3 238
ID Description Score Start End Superfamily
3dd6A01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.97 14 238 3.30.230.70
1oysA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9689 14 235 3.30.230.70
1oysA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9547 14 235 3.30.230.70
2wnrF01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9383 11 237 3.30.230.70
3dd6A01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9372 14 238 3.30.230.70
ID Description Score Start End GO Terms
AF-A0A4U9HE90-F1-model_v4 Ribonuclease PH (EC 2.7.7.56) 0.992 120 237 GO:0000049
GO:0008033
GO:0009022
GO:0016075
AF-A0A3D4G1B9-F1-model_v4 Ribonuclease PH 0.9909 85 238 GO:0000049
GO:0006364
GO:0008033
GO:0009022
GO:0016075
AF-A0A354U5V2-F1-model_v4 deleted 0.9908 92 238
AF-A0A5C7V991-F1-model_v4 Ribonuclease PH (EC 2.7.7.56) 0.9908 97 237 GO:0000049
GO:0006364
GO:0008033
GO:0009022
GO:0016075
AF-A0A3D0DVA3-F1-model_v4 Ribonuclease PH (EC 2.7.7.56) 0.9895 132 238 GO:0009022

Map