F406532

General Info

Members Datasets Scaffolds Average Seq Length
322 245 268 132

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0174885|Ga0395900_0174885_817_1257
Length 146
Sequence MIVRTLDEITDTDRDVKTPNWRSKRIVLAGDGVGFSVHETVLDAGTVNDFWYANHIEAVFITEGEGELYDKDNDVTYQLGPGSIYVLNGNERHQLRPRTRMRTVCVFNPPVTGREVHDENGVYPLISPDAAPTTAAGEVESTKEAS

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2582580736 Prauserella sp. Am3 Isolate Unclassified
6 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
7 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
8 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
9 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
10 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
11 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
12 2643221692 Nocardia sp. Root136 Isolate Unclassified
13 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
14 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
15 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
16 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
17 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
18 2808606394 Promicromonospora sp. C35 Isolate Unclassified
19 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
20 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
21 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
22 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
23 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
24 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
25 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
26 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
27 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
28 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
29 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
30 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
31 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
32 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
33 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
34 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
35 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
36 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
37 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
38 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
39 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
40 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
41 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
42 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
43 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
44 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
45 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
46 2922554459 Rhodococcus sp. 66b Isolate Unclassified
47 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
48 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
80 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
81 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
101 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
102 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
103 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
126 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
201 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
202 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
206 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
207 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
208 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
240 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
241 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
242 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
243 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
244 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
245 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.57
Metatranscriptomes 13.66
Isolates 16.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.9
Nodule 0.31
Rhizoplane 2.8
Rhizosphere 68.32
Stem 0
Stem Tuber 0.31
Unclassified 22.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10242294 3300003320 Bacteria 1340
2 Ga0055530_10029848 3300003791 Bacteria 1452
3 JGI25405J52794_10006023 3300003911 Bacteria 2207
4 Ga0070670_101141297 3300005331 Bacteria 711
5 Ga0068868_100172739 3300005338 Bacteria 1790
6 Ga0070668_100001325 3300005347 Bacteria 17726
7 Ga0070668_100037917 3300005347 Bacteria 3682
8 Ga0070668_100124963 3300005347 Bacteria 2060
9 Ga0070668_100561664 3300005347 Bacteria 994
10 Ga0070669_101651894 3300005353 Bacteria 558
11 Ga0070671_100001069 3300005355 Bacteria 20212
12 Ga0070667_100242695 3300005367 Bacteria 1609
13 Ga0070714_100165374 3300005435 Bacteria 2004
14 Ga0070700_100175956 3300005441 Bacteria 1485
15 Ga0070663_100000277 3300005455 Bacteria 25888
16 Ga0070678_102407904 3300005456 Bacteria 500
17 Ga0070681_11734855 3300005458 Bacteria 551
18 Ga0070686_100113068 3300005544 Bacteria 1853
19 Ga0070665_100006798 3300005548 Bacteria 11628
20 Ga0070665_100677759 3300005548 Bacteria 1044
21 Ga0068864_100473457 3300005618 Bacteria 1201
22 Ga0068851_10016612 3300005834 Bacteria 3525
23 Ga0068863_100011962 3300005841 Bacteria 8387
24 Ga0068863_100937834 3300005841 Bacteria 867
25 Ga0068860_100029208 3300005843 Bacteria 5303
26 Ga0068860_100213083 3300005843 Bacteria 1874
27 Ga0068860_100720887 3300005843 Bacteria 1008
28 Ga0081455_10000037 3300005937 Bacteria 136059
29 Ga0081539_10074506 3300005985 Bacteria 1807
30 Ga0075363_100242761 3300006048 Bacteria 1036
31 Ga0075364_10491642 3300006051 Bacteria 839
32 Ga0075432_10110686 3300006058 Bacteria 1023
33 Ga0075362_10537258 3300006177 Bacteria 600
34 Ga0075370_10143683 3300006353 Bacteria 1396
35 Ga0105250_10541839 3300009092 Bacteria 533
36 Ga0105247_10328972 3300009101 Bacteria 1069
37 Ga0105249_13018372 3300009553 Bacteria 540
38 Ga0105029_109539 3300009984 Bacteria 726
39 Ga0105033_113304 3300009986 Bacteria 731
40 Ga0105028_108049 3300009993 Bacteria 1103
41 Ga0157369_10912157 3300013105 Bacteria 901
42 Ga0157379_10016033 3300014968 Bacteria 6588
43 Ga0206350_10870357 3300020080 Bacteria 1700
44 Ga0224712_10487504 3300022467 Bacteria 595
45 Ga0209050_1000813 3300025298 Bacteria 43681
46 Ga0207710_10221128 3300025900 Bacteria 940
47 Ga0207693_10358773 3300025915 Bacteria 1140
48 Ga0207664_10076034 3300025929 Bacteria 2717
49 Ga0207664_10319097 3300025929 Bacteria 1371
50 Ga0207644_10001360 3300025931 Bacteria 15731
51 Ga0207668_10062385 3300025972 Bacteria 2624
52 Ga0207668_10111554 3300025972 Bacteria 2053
53 Ga0207677_10192420 3300026023 Bacteria 1615
54 Ga0207678_10000108 3300026067 Bacteria 67848
55 Ga0207708_10400477 3300026075 Bacteria 1135
56 Ga0207641_10019785 3300026088 Bacteria 5526
57 Ga0207641_10506623 3300026088 Bacteria 1173
58 Ga0268266_10025934 3300028379 Bacteria 4986
59 Ga0268266_10236335 3300028379 Bacteria 1685
60 Ga0268264_10056432 3300028381 Bacteria 3284
61 Ga0268264_10173383 3300028381 Bacteria 1953
62 Ga0268264_10232883 3300028381 Bacteria 1702
63 Ga0307515_10068648 3300028794 Bacteria 4865
64 Ga0307515_10873040 3300028794 Bacteria 528
65 Ga0307511_10299542 3300030521 Bacteria 727
66 Ga0307512_10011888 3300030522 Bacteria 8229
67 Ga0316176_1117183 3300030732 Bacteria 923
68 Ga0314311_1236085 3300030733 Bacteria 1922
69 Ga0316181_1060726 3300030744 Bacteria 686
70 Ga0265327_10000019 3300031251 Bacteria 427653
71 Ga0265327_10000367 3300031251 Bacteria 85619
72 Ga0265327_10012133 3300031251 Bacteria 5846
73 Ga0307513_10002686 3300031456 Bacteria 24488
74 Ga0307513_10049091 3300031456 Bacteria 4574
75 Ga0307513_10106717 3300031456 Bacteria 2806
76 Ga0307513_10147820 3300031456 Bacteria 2265
77 Ga0307513_10231907 3300031456 Bacteria 1658
78 Ga0307408_100046133 3300031548 Bacteria 3116
79 Ga0307408_100069318 3300031548 Bacteria 2600
80 Ga0307408_100895648 3300031548 Bacteria 812
81 Ga0307408_101739015 3300031548 Bacteria 595
82 Ga0316575_10028383 3300031665 Bacteria 2182
83 Ga0307405_10013619 3300031731 Bacteria 4343
84 Ga0307405_10045609 3300031731 Bacteria 2688
85 Ga0307405_10763879 3300031731 Bacteria 806
86 Ga0307405_11272715 3300031731 Bacteria 639
87 Ga0307413_10026127 3300031824 Bacteria 3214
88 Ga0307413_10029738 3300031824 Bacteria 3061
89 Ga0307413_10185307 3300031824 Bacteria 1489
90 Ga0307518_10005350 3300031838 Bacteria 9169
91 Ga0307518_10522412 3300031838 Bacteria 601
92 Ga0307410_10084392 3300031852 Bacteria 2239
93 Ga0307410_10251844 3300031852 Bacteria 1373
94 Ga0307410_10279518 3300031852 Bacteria 1309
95 Ga0307410_11409153 3300031852 Bacteria 612
96 Ga0307406_10033107 3300031901 Bacteria 3161
97 Ga0307407_10030292 3300031903 Bacteria 2918
98 Ga0307412_10216105 3300031911 Bacteria 1466
99 Ga0307409_100141313 3300031995 Bacteria 2075
100 Ga0307409_100221520 3300031995 Bacteria 1708
101 Ga0307409_102637231 3300031995 Bacteria 531
102 Ga0307416_100200577 3300032002 Bacteria 1892
103 Ga0307416_100473655 3300032002 Bacteria 1310
104 Ga0307414_10003353 3300032004 Bacteria 8554
105 Ga0307414_10031554 3300032004 Bacteria 3478
106 Ga0307414_10049660 3300032004 Bacteria 2902
107 Ga0307411_10299459 3300032005 Bacteria 1289
108 Ga0307411_10687002 3300032005 Bacteria 890
109 Ga0307411_11947722 3300032005 Bacteria 548
110 Ga0307415_100056906 3300032126 Bacteria 2684
111 Ga0307415_100116073 3300032126 Bacteria 1996
112 Ga0307507_10010720 3300033179 Bacteria 11752
113 Ga0307510_10160980 3300033180 Bacteria 1841
114 Ga0395899_0216252 3300037312 Bacteria 1329
115 Ga0395900_0174885 3300037418 Bacteria 2184
116 Ga0436361_0419572 3300039447 Bacteria 4538
117 Ga0439438_022406 3300041405 Bacteria 1752
118 Ga0439439_0020360 3300041406 Bacteria 1649
119 Ga0451789_0191377 3300041443 Bacteria 683
120 Ga0451797_0961830 3300041453 Bacteria 542
121 Ga0451807_2034116 3300041486 Bacteria 524
122 Ga0451853_1149488 3300041512 Bacteria 1284
123 Ga0439431_0269240 3300041997 Bacteria 508
124 Ga0439449_0004255 3300042007 Bacteria 5534
125 Ga0439449_0011822 3300042007 Bacteria 3282
126 Ga0439457_001603 3300042014 Bacteria 6744
127 Ga0466969_0116904 3300044656 Bacteria 1244
128 Ga0466972_0009899 3300044658 Bacteria 4784
129 Ga0466972_0015397 3300044658 Bacteria 3822
130 Ga0466965_0000227 3300044683 Bacteria 17945
131 Ga0466966_0342867 3300044684 Bacteria 898
132 Ga0466961_0270167 3300044693 Bacteria 1042
133 Ga0466963_0110405 3300044694 Bacteria 1887
134 Ga0466964_0006225 3300044706 Bacteria 4449
135 Ga0466964_0117297 3300044706 Bacteria 1195
136 Ga0466964_0260777 3300044706 Bacteria 858
137 Ga0466971_0276778 3300044719 Bacteria 803
138 Ga0466968_0109149 3300044735 Bacteria 1243
139 Ga0466968_0365167 3300044735 Bacteria 703
140 Ga0466970_0025556 3300044765 Bacteria 3092
141 Ga0466957_0037723 3300044842 Bacteria 2910
142 Ga0466957_0096694 3300044842 Bacteria 1856
143 Ga0466960_0006272 3300044901 Bacteria 4761
144 Ga0466958_0036959 3300045836 Bacteria 2925
145 Ga0466958_0336135 3300045836 Bacteria 971
146 Ga0466958_1059962 3300045836 Bacteria 529
147 Ga0466967_0041700 3300045976 Bacteria 3960
148 Ga0466967_0041797 3300045976 Bacteria 3957
149 Ga0495627_029126 3300046453 Bacteria 1759
150 Ga0495596_0000696 3300046500 Bacteria 20861
151 Ga0495665_0034942 3300046531 Bacteria 2687
152 Ga0495656_0022023 3300046615 Bacteria 2490
153 Ga0495668_0000043 3300046616 Bacteria 227636
154 Ga0495588_0340619 3300046674 Bacteria 788
155 Ga0495670_0219408 3300046691 Bacteria 1010
156 Ga0495581_0265445 3300047315 Bacteria 1004
157 Ga0495676_0478988 3300047321 Bacteria 819
158 Ga0496100_0003124 3300048903 Bacteria 8573
159 Ga0496100_0432234 3300048903 Bacteria 1007
160 Ga0496102_0000574 3300048905 Bacteria 39023
161 Ga0496103_0000380 3300048906 Bacteria 39723
162 Ga0496111_0035275 3300048914 Bacteria 3574
163 Ga0496114_0731182 3300048917 Bacteria 866
164 Ga0496116_0000183 3300048919 Bacteria 124744
165 Ga0496116_0001035 3300048919 Bacteria 33974
166 Ga0496117_0000059 3300048920 Bacteria 260163
167 Ga0496118_0001225 3300048921 Bacteria 39433
168 Ga0496119_0000955 3300048922 Bacteria 37211
169 Ga0496120_0004216 3300048923 Bacteria 12267
170 Ga0496121_0003157 3300048924 Bacteria 23758
171 Ga0496121_0021696 3300048924 Bacteria 6277
172 Ga0496122_0001374 3300048925 Bacteria 39556
173 Ga0496122_0003519 3300048925 Bacteria 20549
174 Ga0496122_0167543 3300048925 Bacteria 1330
175 Ga0496123_0000858 3300048926 Bacteria 48557
176 Ga0496123_0001146 3300048926 Bacteria 39552
177 Ga0496124_0004559 3300048927 Bacteria 16104
178 Ga0496124_0006202 3300048927 Bacteria 13099
179 Ga0496124_0011877 3300048927 Bacteria 8670
180 Ga0496124_0211000 3300048927 Bacteria 1469
181 Ga0496125_0042757 3300048928 Bacteria 3854
182 Ga0496125_0122556 3300048928 Bacteria 1850
183 Ga0496126_0001443 3300048929 Bacteria 37279
184 Ga0496126_0003265 3300048929 Bacteria 20705
185 Ga0501306_025561 3300049127 Bacteria 850
186 Ga0501311_069903 3300049527 Bacteria 581
187 Ga0501317_075516 3300049533 Bacteria 575
188 Ga0501323_013443 3300049539 Bacteria 1012
189 Ga0501325_011067 3300049541 Bacteria 828
190 Ga0501325_019232 3300049541 Bacteria 706
191 Ga0501031_0759339 3300049568 Bacteria 622
192 Ga0501032_0021418 3300049569 Bacteria 4493
193 Ga0501032_0084302 3300049569 Bacteria 2112
194 Ga0501033_0154725 3300049570 Bacteria 1652
195 Ga0501034_0012231 3300049571 Bacteria 8869
196 Ga0501034_0293676 3300049571 Bacteria 1563
197 Ga0501036_0025799 3300049572 Bacteria 4959
198 Ga0501037_0085162 3300049573 Bacteria 2288
199 Ga0501038_0010538 3300049574 Bacteria 8455
200 Ga0501038_1192684 3300049574 Bacteria 553
201 Ga0501039_0322354 3300049575 Bacteria 1214
202 Ga0501040_0317716 3300049576 Bacteria 1114
203 Ga0501043_0002029 3300049579 Bacteria 17284
204 Ga0501043_0165526 3300049579 Bacteria 1727
205 Ga0501047_0007212 3300049581 Bacteria 10452
206 Ga0501068_0199765 3300049584 Bacteria 1268
207 Ga0501070_0020861 3300049586 Bacteria 5496
208 Ga0501070_0052884 3300049586 Bacteria 3370
209 Ga0501070_0731036 3300049586 Bacteria 781
210 Ga0501070_1068675 3300049586 Bacteria 624
211 Ga0501073_0578071 3300049589 Bacteria 776
212 Ga0501198_098710 3300049649 Bacteria 589
213 Ga0501080_0009086 3300049742 Bacteria 9043
214 Ga0501035_0213199 3300049822 Bacteria 1651
215 Ga0501044_0154069 3300049823 Bacteria 2278
216 Ga0501045_0077379 3300049824 Bacteria 2451
217 nmdc:mga03n38_299230_c1 3300050490 Bacteria 863
218 nmdc:mga03n38_54348_c1 3300050490 Bacteria 1799
219 nmdc:mga03n38_76706_c1 3300050490 Bacteria 1560
220 nmdc:mga07m45_89443_c1 3300050496 Bacteria 1763
221 nmdc:mga07m45_89749_c1 3300050496 Bacteria 1760
222 Ga0495619_0680903 3300053085 Bacteria 700
223 Ga0500644_0061652 3300053088 Bacteria 1323
224 Ga0500658_0070680 3300053134 Bacteria 1472
225 Ga0500559_0006914 3300053136 Bacteria 5076
226 Ga0500568_0036001 3300053139 Bacteria 2017
227 Ga0500577_0043064 3300053142 Bacteria 1656
228 Ga0500589_232492 3300053147 Bacteria 687
229 Ga0500600_0304742 3300053149 Bacteria 680
230 Ga0500634_0168130 3300053161 Bacteria 1003
231 Ga0587084_010419 3300059477 Bacteria 1218
232 Ga0587066_030590 3300059490 Bacteria 957
233 Ga0587073_0033040 3300059492 Bacteria 1082
234 Ga0587077_058352 3300059493 Bacteria 829
235 Ga0587080_004029 3300059503 Bacteria 1877
236 Ga0587082_092930 3300059504 Bacteria 646
237 Ga0587083_0015441 3300059505 Bacteria 1333
238 Ga0587085_036838 3300059506 Bacteria 833
239 Ga0587088_000569 3300059508 Bacteria 3161
240 Ga0587088_030479 3300059508 Bacteria 961
241 Ga0587088_071217 3300059508 Bacteria 725
242 Ga0587088_079283 3300059508 Bacteria 700
243 Ga0587088_125178 3300059508 Bacteria 599
244 Ga0587089_001140 3300059509 Bacteria 2368
245 Ga0587090_004863 3300059510 Bacteria 1655
246 Ga0587091_022949 3300059511 Bacteria 1107
247 Ga0587106_018963 3300059605 Bacteria 999
248 Ga0587129_011943 3300059608 Bacteria 689
249 Ga0587131_001936 3300059609 Bacteria 1076
250 Ga0587101_048975 3300059623 Bacteria 722
251 Ga0587113_000156 3300059625 Bacteria 2864
252 Ga0587115_025208 3300059626 Bacteria 853
253 Ga0587122_000731 3300059628 Bacteria 1889
254 Ga0587128_000505 3300059630 Bacteria 2934
255 Ga0587067_001327 3300059640 Bacteria 2640
256 Ga0587069_000837 3300059642 Bacteria 2580
257 Ga0587072_012348 3300059643 Bacteria 1410
258 Ga0587076_008973 3300059645 Bacteria 1410
259 Ga0587079_024123 3300059647 Bacteria 1119
260 Ga0587102_022896 3300059649 Bacteria 717
261 Ga0587107_004185 3300059652 Bacteria 1450
262 Ga0587114_000548 3300059655 Bacteria 2606
263 Ga0587119_014640 3300059658 Bacteria 943
264 Ga0587120_001965 3300059659 Bacteria 1348
265 Ga0587120_030251 3300059659 Bacteria 551
266 Ga0587071_026263 3300060344 Bacteria 1098
267 Ga0466962_0056281 3300061719 Bacteria 1879
268 Ga0466962_0158334 3300061719 Bacteria 1100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009092 Ga0105250_10541839 Ga0105250_105418391 98
2 3300049571 Ga0501034_0293676 Ga0501034_0293676_612_1022 110
3 3300031548 Ga0307408_101739015 Ga0307408_1017390152 112
4 3300031665 Ga0316575_10028383 Ga0316575_100283832 112
5 3300033179 Ga0307507_10010720 Ga0307507_100107207 114
6 3300013105 Ga0157369_10912157 Ga0157369_109121572 115
7 3300041443 Ga0451789_0191377 Ga0451789_0191377_13_381 115
8 3300046691 Ga0495670_0219408 Ga0495670_0219408_633_998 115
9 3300049574 Ga0501038_1192684 Ga0501038_1192684_95_496 115
10 3300049586 Ga0501070_1068675 Ga0501070_1068675_153_563 116
11 iso_pu_bacteria 2818991438 2819555422 120
12 3300003791 Ga0055530_10029848 Ga0055530_100298482 124
13 3300025298 Ga0209050_1000813 Ga0209050_100081320 124
14 3300033180 Ga0307510_10160980 Ga0307510_101609802 124
15 3300048919 Ga0496116_0001035 Ga0496116_0001035_26637_27023 124
16 3300048924 Ga0496121_0003157 Ga0496121_0003157_22733_23119 124
17 3300048925 Ga0496122_0001374 Ga0496122_0001374_27848_28234 124
18 3300048926 Ga0496123_0001146 Ga0496123_0001146_27848_28234 124
19 3300048927 Ga0496124_0004559 Ga0496124_0004559_10561_10947 124
20 iso_pu_bacteria 2512564014 2512644790 124
21 iso_pu_bacteria 2643221541 2643731766 124
22 iso_pu_bacteria 2643221606 2644041907 124
23 iso_pu_bacteria 2643221671 2644394450 124
24 iso_pu_bacteria 2808606401 2809065081 124
25 iso_pu_bacteria 2808606404 2809081048 124
26 iso_pu_bacteria 2808606405 2809085413 124
27 iso_pu_bacteria 2880518877 2880520784 124
28 iso_pu_bacteria 2919709256 2919709295 124
29 iso_pu_bacteria 2585427649 2586057776 125
30 iso_pu_bacteria 2739367654 2739605117 125
31 iso_pu_bacteria 2808606522 2809593393 125
32 iso_pu_bacteria 2899370129 2899374801 125
33 iso_pu_bacteria 2915768154 2915769459 125
34 iso_pu_bacteria 2537561592 2537900546 126
35 iso_pu_bacteria 2558860112 2558910430 126
36 iso_pu_bacteria 2565956761 2566994038 126
37 iso_pu_bacteria 2582580736 2583149214 126
38 iso_pu_bacteria 2643221587 2643947017 126
39 iso_pu_bacteria 2643221677 2644433511 126
40 iso_pu_bacteria 2643221692 2644512039 126
41 iso_pu_bacteria 2738541308 2738889598 126
42 iso_pu_bacteria 2758568522 2760307966 126
43 iso_pu_bacteria 2773857762 2774396249 126
44 iso_pu_bacteria 2795385470 2795780318 126
45 iso_pu_bacteria 2808606394 2809028322 126
46 iso_pu_bacteria 2808606439 2809197880 126
47 iso_pu_bacteria 2811994878 2812347628 126
48 iso_pu_bacteria 2816332139 2816505930 126
49 iso_pu_bacteria 2839986021 2839989324 126
50 iso_pu_bacteria 2848551377 2848553380 126
51 iso_pu_bacteria 2852646457 2852649668 126
52 iso_pu_bacteria 2863067949 2863069432 126
53 iso_pu_bacteria 2866552031 2866557443 126
54 iso_pu_bacteria 2866612099 2866612642 126
55 iso_pu_bacteria 2870782633 2870782956 126
56 iso_pu_bacteria 2887443736 2887443809 126
57 iso_pu_bacteria 2891326441 2891331048 126
58 iso_pu_bacteria 2891968417 2891968971 126
59 iso_pu_bacteria 2897561785 2897562610 126
60 iso_pu_bacteria 2899359706 2899366043 126
61 iso_pu_bacteria 2904535858 2904539806 126
62 iso_pu_bacteria 2906799679 2906801686 126
63 iso_pu_bacteria 2917736166 2917740650 126
64 iso_pu_bacteria 2922554459 2922560375 126
65 iso_pu_bacteria 2945968032 2945969780 126
66 iso_pu_bacteria 3002998708 3003009067 126
67 iso_pu_bacteria 8003314358 8003319769 126
68 iso_pu_bacteria 8053945823 8053947461 126
69 iso_pu_bacteria 8054472261 8054476942 126
70 iso_pu_bacteria 8056207758 8056209670 126
71 iso_pu_bacteria 8056579771 8056582351 126
72 iso_pu_bacteria 8056681323 8056685611 126
73 3300031251 Ga0265327_10000019 Ga0265327_10000019263 127
74 3300049568 Ga0501031_0759339 Ga0501031_0759339_210_608 127
75 3300049569 Ga0501032_0084302 Ga0501032_0084302_830_1228 127
76 3300049570 Ga0501033_0154725 Ga0501033_0154725_926_1324 127
77 3300049571 Ga0501034_0012231 Ga0501034_0012231_4232_4630 127
78 3300049572 Ga0501036_0025799 Ga0501036_0025799_3677_4075 127
79 3300049573 Ga0501037_0085162 Ga0501037_0085162_423_821 127
80 3300049574 Ga0501038_0010538 Ga0501038_0010538_7744_8142 127
81 3300049575 Ga0501039_0322354 Ga0501039_0322354_370_768 127
82 3300049576 Ga0501040_0317716 Ga0501040_0317716_75_473 127
83 3300049579 Ga0501043_0002029 Ga0501043_0002029_8725_9123 127
84 3300049581 Ga0501047_0007212 Ga0501047_0007212_4954_5352 127
85 3300049584 Ga0501068_0199765 Ga0501068_0199765_266_664 127
86 3300049586 Ga0501070_0052884 Ga0501070_0052884_930_1328 127
87 3300049822 Ga0501035_0213199 Ga0501035_0213199_926_1324 127
88 3300049823 Ga0501044_0154069 Ga0501044_0154069_686_1084 127
89 3300049824 Ga0501045_0077379 Ga0501045_0077379_455_853 127
90 3300005347 Ga0070668_100561664 Ga0070668_1005616642 128
91 3300005834 Ga0068851_10016612 Ga0068851_100166123 128
92 3300031456 Ga0307513_10231907 Ga0307513_102319072 128
93 3300031838 Ga0307518_10522412 Ga0307518_105224121 128
94 3300032004 Ga0307414_10003353 Ga0307414_100033536 128
95 3300032004 Ga0307414_10049660 Ga0307414_100496602 128
96 3300037312 Ga0395899_0216252 Ga0395899_0216252_169_585 128
97 3300044656 Ga0466969_0116904 Ga0466969_0116904_162_548 128
98 3300044706 Ga0466964_0260777 Ga0466964_0260777_248_634 128
99 3300046500 Ga0495596_0000696 Ga0495596_0000696_13826_14242 128
100 3300048903 Ga0496100_0432234 Ga0496100_0432234_395_799 128
101 3300048925 Ga0496122_0003519 Ga0496122_0003519_10535_10939 128
102 3300048926 Ga0496123_0000858 Ga0496123_0000858_27954_28358 128
103 3300048927 Ga0496124_0006202 Ga0496124_0006202_6906_7310 128
104 3300048927 Ga0496124_0211000 Ga0496124_0211000_755_1159 128
105 3300048929 Ga0496126_0003265 Ga0496126_0003265_6767_7171 128
106 3300049569 Ga0501032_0021418 Ga0501032_0021418_3044_3460 128
107 3300049579 Ga0501043_0165526 Ga0501043_0165526_1235_1648 128
108 3300053134 Ga0500658_0070680 Ga0500658_0070680_951_1337 128
109 3300005353 Ga0070669_101651894 Ga0070669_1016518941 129
110 3300005456 Ga0070678_102407904 Ga0070678_1024079041 129
111 3300005843 Ga0068860_100213083 Ga0068860_1002130833 129
112 3300009984 Ga0105029_109539 Ga0105029_1095392 129
113 3300028381 Ga0268264_10173383 Ga0268264_101733833 129
114 3300028794 Ga0307515_10873040 Ga0307515_108730401 129
115 3300030521 Ga0307511_10299542 Ga0307511_102995422 129
116 3300030522 Ga0307512_10011888 Ga0307512_1001188812 129
117 3300031456 Ga0307513_10002686 Ga0307513_1000268616 129
118 3300031456 Ga0307513_10106717 Ga0307513_101067173 129
119 3300031838 Ga0307518_10005350 Ga0307518_100053502 129
120 3300044694 Ga0466963_0110405 Ga0466963_0110405_26_415 129
121 3300044706 Ga0466964_0006225 Ga0466964_0006225_345_734 129
122 3300044735 Ga0466968_0109149 Ga0466968_0109149_27_416 129
123 3300044842 Ga0466957_0037723 Ga0466957_0037723_1253_1642 129
124 3300045836 Ga0466958_0036959 Ga0466958_0036959_320_709 129
125 3300045836 Ga0466958_1059962 Ga0466958_1059962_104_493 129
126 3300045976 Ga0466967_0041700 Ga0466967_0041700_3097_3486 129
127 3300045976 Ga0466967_0041797 Ga0466967_0041797_1507_1896 129
128 3300049586 Ga0501070_0731036 Ga0501070_0731036_198_599 129
129 3300053088 Ga0500644_0061652 Ga0500644_0061652_57_446 129
130 3300053142 Ga0500577_0043064 Ga0500577_0043064_684_1073 129
131 3300053147 Ga0500589_232492 Ga0500589_232492_272_661 129
132 3300053161 Ga0500634_0168130 Ga0500634_0168130_499_888 129
133 3300059477 Ga0587084_010419 Ga0587084_010419_486_887 129
134 3300059490 Ga0587066_030590 Ga0587066_030590_111_512 129
135 3300059492 Ga0587073_0033040 Ga0587073_0033040_235_636 129
136 3300059493 Ga0587077_058352 Ga0587077_058352_265_666 129
137 3300059503 Ga0587080_004029 Ga0587080_004029_447_848 129
138 3300059504 Ga0587082_092930 Ga0587082_092930_49_450 129
139 3300059505 Ga0587083_0015441 Ga0587083_0015441_453_854 129
140 3300059506 Ga0587085_036838 Ga0587085_036838_246_647 129
141 3300059508 Ga0587088_000569 Ga0587088_000569_968_1369 129
142 3300059508 Ga0587088_030479 Ga0587088_030479_502_903 129
143 3300059508 Ga0587088_071217 Ga0587088_071217_299_688 129
144 3300059508 Ga0587088_125178 Ga0587088_125178_153_554 129
145 3300059509 Ga0587089_001140 Ga0587089_001140_184_585 129
146 3300059510 Ga0587090_004863 Ga0587090_004863_618_1019 129
147 3300059511 Ga0587091_022949 Ga0587091_022949_237_638 129
148 3300059605 Ga0587106_018963 Ga0587106_018963_402_803 129
149 3300059608 Ga0587129_011943 Ga0587129_011943_127_528 129
150 3300059609 Ga0587131_001936 Ga0587131_001936_445_846 129
151 3300059623 Ga0587101_048975 Ga0587101_048975_160_561 129
152 3300059625 Ga0587113_000156 Ga0587113_000156_1793_2194 129
153 3300059626 Ga0587115_025208 Ga0587115_025208_222_623 129
154 3300059628 Ga0587122_000731 Ga0587122_000731_795_1196 129
155 3300059630 Ga0587128_000505 Ga0587128_000505_751_1152 129
156 3300059640 Ga0587067_001327 Ga0587067_001327_1784_2185 129
157 3300059642 Ga0587069_000837 Ga0587069_000837_390_791 129
158 3300059643 Ga0587072_012348 Ga0587072_012348_394_795 129
159 3300059645 Ga0587076_008973 Ga0587076_008973_234_635 129
160 3300059647 Ga0587079_024123 Ga0587079_024123_447_848 129
161 3300059649 Ga0587102_022896 Ga0587102_022896_43_432 129
162 3300059652 Ga0587107_004185 Ga0587107_004185_354_755 129
163 3300059655 Ga0587114_000548 Ga0587114_000548_1787_2188 129
164 3300059658 Ga0587119_014640 Ga0587119_014640_400_801 129
165 3300059659 Ga0587120_001965 Ga0587120_001965_457_858 129
166 3300059659 Ga0587120_030251 Ga0587120_030251_91_480 129
167 3300060344 Ga0587071_026263 Ga0587071_026263_466_867 129
168 3300061719 Ga0466962_0158334 Ga0466962_0158334_48_437 129
169 3300003320 rootH2_10242294 rootH2_102422942 130
170 3300003911 JGI25405J52794_10006023 JGI25405J52794_100060231 130
171 3300005331 Ga0070670_101141297 Ga0070670_1011412972 130
172 3300005338 Ga0068868_100172739 Ga0068868_1001727392 130
173 3300005347 Ga0070668_100001325 Ga0070668_10000132514 130
174 3300005347 Ga0070668_100037917 Ga0070668_1000379174 130
175 3300005347 Ga0070668_100124963 Ga0070668_1001249632 130
176 3300005355 Ga0070671_100001069 Ga0070671_10000106919 130
177 3300005367 Ga0070667_100242695 Ga0070667_1002426951 130
178 3300005435 Ga0070714_100165374 Ga0070714_1001653742 130
179 3300005441 Ga0070700_100175956 Ga0070700_1001759562 130
180 3300005455 Ga0070663_100000277 Ga0070663_10000027717 130
181 3300005458 Ga0070681_11734855 Ga0070681_117348551 130
182 3300005544 Ga0070686_100113068 Ga0070686_1001130682 130
183 3300005548 Ga0070665_100006798 Ga0070665_1000067989 130
184 3300005548 Ga0070665_100677759 Ga0070665_1006777592 130
185 3300005618 Ga0068864_100473457 Ga0068864_1004734572 130
186 3300005841 Ga0068863_100011962 Ga0068863_1000119626 130
187 3300005841 Ga0068863_100937834 Ga0068863_1009378341 130
188 3300005843 Ga0068860_100029208 Ga0068860_1000292084 130
189 3300005843 Ga0068860_100720887 Ga0068860_1007208871 130
190 3300005937 Ga0081455_10000037 Ga0081455_1000003772 130
191 3300005985 Ga0081539_10074506 Ga0081539_100745062 130
192 3300006048 Ga0075363_100242761 Ga0075363_1002427612 130
193 3300006051 Ga0075364_10491642 Ga0075364_104916421 130
194 3300006058 Ga0075432_10110686 Ga0075432_101106862 130
195 3300006177 Ga0075362_10537258 Ga0075362_105372582 130
196 3300006353 Ga0075370_10143683 Ga0075370_101436832 130
197 3300009101 Ga0105247_10328972 Ga0105247_103289722 130
198 3300009553 Ga0105249_13018372 Ga0105249_130183722 130
199 3300009986 Ga0105033_113304 Ga0105033_1133042 130
200 3300009993 Ga0105028_108049 Ga0105028_1080492 130
201 3300014968 Ga0157379_10016033 Ga0157379_100160333 130
202 3300020080 Ga0206350_10870357 Ga0206350_108703572 130
203 3300022467 Ga0224712_10487504 Ga0224712_104875041 130
204 3300025900 Ga0207710_10221128 Ga0207710_102211282 130
205 3300025915 Ga0207693_10358773 Ga0207693_103587732 130
206 3300025929 Ga0207664_10076034 Ga0207664_100760343 130
207 3300025929 Ga0207664_10319097 Ga0207664_103190972 130
208 3300025931 Ga0207644_10001360 Ga0207644_1000136014 130
209 3300025972 Ga0207668_10062385 Ga0207668_100623852 130
210 3300025972 Ga0207668_10111554 Ga0207668_101115543 130
211 3300026023 Ga0207677_10192420 Ga0207677_101924202 130
212 3300026067 Ga0207678_10000108 Ga0207678_1000010826 130
213 3300026075 Ga0207708_10400477 Ga0207708_104004772 130
214 3300026088 Ga0207641_10019785 Ga0207641_100197854 130
215 3300026088 Ga0207641_10506623 Ga0207641_105066231 130
216 3300028379 Ga0268266_10025934 Ga0268266_100259344 130
217 3300028379 Ga0268266_10236335 Ga0268266_102363352 130
218 3300028381 Ga0268264_10056432 Ga0268264_100564322 130
219 3300028381 Ga0268264_10232883 Ga0268264_102328832 130
220 3300028794 Ga0307515_10068648 Ga0307515_100686483 130
221 3300030732 Ga0316176_1117183 Ga0316176_11171832 130
222 3300030733 Ga0314311_1236085 Ga0314311_12360852 130
223 3300030744 Ga0316181_1060726 Ga0316181_10607262 130
224 3300031251 Ga0265327_10000367 Ga0265327_1000036729 130
225 3300031251 Ga0265327_10012133 Ga0265327_100121335 130
226 3300031456 Ga0307513_10049091 Ga0307513_100490913 130
227 3300031456 Ga0307513_10147820 Ga0307513_101478202 130
228 3300031548 Ga0307408_100046133 Ga0307408_1000461333 130
229 3300031548 Ga0307408_100069318 Ga0307408_1000693183 130
230 3300031548 Ga0307408_100895648 Ga0307408_1008956482 130
231 3300031731 Ga0307405_10013619 Ga0307405_100136192 130
232 3300031731 Ga0307405_10045609 Ga0307405_100456092 130
233 3300031731 Ga0307405_10763879 Ga0307405_107638792 130
234 3300031731 Ga0307405_11272715 Ga0307405_112727151 130
235 3300031824 Ga0307413_10026127 Ga0307413_100261273 130
236 3300031824 Ga0307413_10029738 Ga0307413_100297382 130
237 3300031824 Ga0307413_10185307 Ga0307413_101853072 130
238 3300031852 Ga0307410_10084392 Ga0307410_100843923 130
239 3300031852 Ga0307410_10251844 Ga0307410_102518442 130
240 3300031852 Ga0307410_10279518 Ga0307410_102795182 130
241 3300031852 Ga0307410_11409153 Ga0307410_114091532 130
242 3300031901 Ga0307406_10033107 Ga0307406_100331072 130
243 3300031903 Ga0307407_10030292 Ga0307407_100302923 130
244 3300031911 Ga0307412_10216105 Ga0307412_102161051 130
245 3300031995 Ga0307409_100141313 Ga0307409_1001413132 130
246 3300031995 Ga0307409_100221520 Ga0307409_1002215202 130
247 3300031995 Ga0307409_102637231 Ga0307409_1026372312 130
248 3300032002 Ga0307416_100200577 Ga0307416_1002005772 130
249 3300032002 Ga0307416_100473655 Ga0307416_1004736552 130
250 3300032004 Ga0307414_10031554 Ga0307414_100315542 130
251 3300032005 Ga0307411_10299459 Ga0307411_102994591 130
252 3300032005 Ga0307411_10687002 Ga0307411_106870022 130
253 3300032005 Ga0307411_11947722 Ga0307411_119477221 130
254 3300032126 Ga0307415_100056906 Ga0307415_1000569062 130
255 3300032126 Ga0307415_100116073 Ga0307415_1001160732 130
256 3300037418 Ga0395900_0174885 Ga0395900_0174885_817_1257 130
257 3300039447 Ga0436361_0419572 Ga0436361_0419572_3721_4119 130
258 3300041405 Ga0439438_022406 Ga0439438_022406_701_1117 130
259 3300041406 Ga0439439_0020360 Ga0439439_0020360_496_909 130
260 3300041453 Ga0451797_0961830 Ga0451797_0961830_112_504 130
261 3300041486 Ga0451807_2034116 Ga0451807_2034116_41_439 130
262 3300041512 Ga0451853_1149488 Ga0451853_1149488_247_645 130
263 3300041997 Ga0439431_0269240 Ga0439431_0269240_30_431 130
264 3300042007 Ga0439449_0004255 Ga0439449_0004255_276_689 130
265 3300042007 Ga0439449_0011822 Ga0439449_0011822_2037_2453 130
266 3300042014 Ga0439457_001603 Ga0439457_001603_3522_3935 130
267 3300044658 Ga0466972_0009899 Ga0466972_0009899_580_972 130
268 3300044658 Ga0466972_0015397 Ga0466972_0015397_2687_3097 130
269 3300044683 Ga0466965_0000227 Ga0466965_0000227_2687_3097 130
270 3300044684 Ga0466966_0342867 Ga0466966_0342867_409_801 130
271 3300044693 Ga0466961_0270167 Ga0466961_0270167_383_775 130
272 3300044706 Ga0466964_0117297 Ga0466964_0117297_706_1116 130
273 3300044719 Ga0466971_0276778 Ga0466971_0276778_46_456 130
274 3300044735 Ga0466968_0365167 Ga0466968_0365167_177_569 130
275 3300044765 Ga0466970_0025556 Ga0466970_0025556_1790_2200 130
276 3300044842 Ga0466957_0096694 Ga0466957_0096694_919_1329 130
277 3300044901 Ga0466960_0006272 Ga0466960_0006272_3446_3856 130
278 3300045836 Ga0466958_0336135 Ga0466958_0336135_79_489 130
279 3300046453 Ga0495627_029126 Ga0495627_029126_209_610 130
280 3300046531 Ga0495665_0034942 Ga0495665_0034942_2142_2540 130
281 3300046615 Ga0495656_0022023 Ga0495656_0022023_1142_1540 130
282 3300046616 Ga0495668_0000043 Ga0495668_0000043_169616_170014 130
283 3300046674 Ga0495588_0340619 Ga0495588_0340619_116_514 130
284 3300047315 Ga0495581_0265445 Ga0495581_0265445_22_420 130
285 3300047321 Ga0495676_0478988 Ga0495676_0478988_82_477 130
286 3300048903 Ga0496100_0003124 Ga0496100_0003124_3977_4384 130
287 3300048905 Ga0496102_0000574 Ga0496102_0000574_33946_34353 130
288 3300048906 Ga0496103_0000380 Ga0496103_0000380_34646_35053 130
289 3300048914 Ga0496111_0035275 Ga0496111_0035275_1933_2340 130
290 3300048917 Ga0496114_0731182 Ga0496114_0731182_90_497 130
291 3300048919 Ga0496116_0000183 Ga0496116_0000183_33974_34381 130
292 3300048920 Ga0496117_0000059 Ga0496117_0000059_33953_34360 130
293 3300048921 Ga0496118_0001225 Ga0496118_0001225_5053_5460 130
294 3300048922 Ga0496119_0000955 Ga0496119_0000955_33970_34377 130
295 3300048923 Ga0496120_0004216 Ga0496120_0004216_2835_3242 130
296 3300048924 Ga0496121_0021696 Ga0496121_0021696_1734_2141 130
297 3300048925 Ga0496122_0167543 Ga0496122_0167543_273_680 130
298 3300048927 Ga0496124_0011877 Ga0496124_0011877_6008_6415 130
299 3300048928 Ga0496125_0042757 Ga0496125_0042757_733_1131 130
300 3300048928 Ga0496125_0122556 Ga0496125_0122556_719_1126 130
301 3300048929 Ga0496126_0001443 Ga0496126_0001443_33974_34381 130
302 3300049127 Ga0501306_025561 Ga0501306_025561_10_408 130
303 3300049527 Ga0501311_069903 Ga0501311_069903_172_570 130
304 3300049533 Ga0501317_075516 Ga0501317_075516_43_441 130
305 3300049539 Ga0501323_013443 Ga0501323_013443_260_658 130
306 3300049541 Ga0501325_011067 Ga0501325_011067_321_719 130
307 3300049541 Ga0501325_019232 Ga0501325_019232_282_680 130
308 3300049586 Ga0501070_0020861 Ga0501070_0020861_3257_3670 130
309 3300049589 Ga0501073_0578071 Ga0501073_0578071_240_653 130
310 3300049649 Ga0501198_098710 Ga0501198_098710_91_489 130
311 3300049742 Ga0501080_0009086 Ga0501080_0009086_8407_8820 130
312 3300050490 nmdc:mga03n38_299230_c1 nmdc:mga03n38_299230_c1_375_773 130
313 3300050490 nmdc:mga03n38_54348_c1 nmdc:mga03n38_54348_c1_991_1383 130
314 3300050490 nmdc:mga03n38_76706_c1 nmdc:mga03n38_76706_c1_72_473 130
315 3300050496 nmdc:mga07m45_89443_c1 nmdc:mga07m45_89443_c1_616_1017 130
316 3300050496 nmdc:mga07m45_89749_c1 nmdc:mga07m45_89749_c1_457_855 130
317 3300053085 Ga0495619_0680903 Ga0495619_0680903_149_541 130
318 3300053136 Ga0500559_0006914 Ga0500559_0006914_3256_3666 130
319 3300053139 Ga0500568_0036001 Ga0500568_0036001_1015_1416 130
320 3300053149 Ga0500600_0304742 Ga0500600_0304742_66_467 130
321 3300059508 Ga0587088_079283 Ga0587088_079283_167_571 130
322 3300061719 Ga0466962_0056281 Ga0466962_0056281_1097_1489 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06339

Ectoine_synth

Ectoine synthase

1

127

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bxx-assembly2.cif.gz_C crystal structure of the ectoine synthase from the cold-adapted marine bacterium sphingopyxis alaskensis 0.9666 1 111
5bxx-assembly2.cif.gz_C crystal structure of the ectoine synthase from the cold-adapted marine bacterium sphingopyxis alaskensis 0.9581 1 111
2pyt-assembly1.cif.gz_B crystal structure of a putative ethanolamine utilization protein q (eutq, stm2468) from salmonella typhimurium lt2 at 1.90 a resolution 0.9058 21 109
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8737 23 109
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.8649 34 106
ID Description Score Start End Superfamily
5bxxC00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9666 1 111 2.60.120.10
5bxxC00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9581 1 111 2.60.120.10
2pytB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8978 22 109 2.60.120.10
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8812 13 108 2.60.120.10
af_I1N5B5_339_414_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8749 33 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A829HXN5-F1-model_v4 L-ectoine synthase (EC 4.2.1.108) (N-acetyldiaminobutyrate dehydratase) 0.997 33 109 GO:0019491
GO:0033990
AF-A0A1U1PDY6-F1-model_v4 deleted 0.9941 1 109
AF-A0A142BYK3-F1-model_v4 L-ectoine synthase (EC 4.2.1.108) (N-acetyldiaminobutyrate dehydratase) 0.9896 1 94 GO:0019491
GO:0033990
AF-A0A356U6S8-F1-model_v4 L-ectoine synthase (EC 4.2.1.108) (N-acetyldiaminobutyrate dehydratase) 0.987 1 101 GO:0019491
GO:0033990
AF-A0A7X9JYF4-F1-model_v4 L-ectoine synthase (EC 4.2.1.108) (N-acetyldiaminobutyrate dehydratase) 0.9752 1 108 GO:0019491
GO:0033990

Feature Viewer

pLDDT pTM Quality
86.68 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map