F406609

General Info

Members Datasets Scaffolds Average Seq Length
322 283 165 290

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0342728|Ga0496102_0342728_258_1133
Length 291
Sequence MTSRGWLNTKFWQKRLRKARNAVAKRFFNTRTGRRLLIESIGPRVVSMTVDAGDHLMTFSPSDYIGRKVFRKGHFEREHVDRLIAVLRERGLMHGRYLLEIGGNIGTQTVYFALSGAYDHIVSIEPDPRNFPLLQTNIRQNRLDQIVTLVNCAAGATAGEIDFFMNADNHGKSSAYRKSASDQKTSVPVRPVTEILDELSIDPLDIGLVWMDIEGYEPVACASMAPLLSRRVPLYMEFTPLFYGAEQTREFIRTLAGYYEDCLVFFEEEEQEMKVVNLPGSIEQYDVLFLP

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
6 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
7 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
8 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
9 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
10 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
11 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
12 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
13 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
14 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
15 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
16 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
17 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
18 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
19 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
20 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
21 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
22 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
23 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
24 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
25 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
26 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
27 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
28 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
29 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
30 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
31 2643221607 Rhizobium sp. Root73 Isolate Unclassified
32 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
33 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
34 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
35 2643221688 Rhizobium sp. Root482 Isolate Unclassified
36 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
37 2643221718 Rhizobium sp. Root268 Isolate Unclassified
38 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
39 2718217882 Rhizobium sp. N741 Isolate Nodule
40 2718217927 Rhizobium sp. N324 Isolate Nodule
41 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
42 2718218009 Rhizobium sp. N561 Isolate Nodule
43 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
44 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
45 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
46 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
47 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
48 2718218363 Rhizobium sp. N113 Isolate Nodule
49 2718218365 Rhizobium sp. N731 Isolate Nodule
50 2718218366 Rhizobium sp. N621 Isolate Nodule
51 2718218423 Rhizobium sp. N941 Isolate Nodule
52 2721755514 Rhizobium sp. N6212 Isolate Nodule
53 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
54 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
55 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
56 2721755809 Rhizobium sp. N541 Isolate Nodule
57 2721755810 Rhizobium sp. N871 Isolate Nodule
58 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
59 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
60 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
61 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
62 2728369365 Rhizobium sp. N1341 Isolate Nodule
63 2728369397 Rhizobium sp. N1314 Isolate Nodule
64 2738541293 Rhizobium sp. GV031 Isolate Unclassified
65 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
66 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
67 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
68 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
69 2791355256 Rhizobium sp. M10 Isolate Nodule
70 2791355260 Rhizobium sp. L9 Isolate Nodule
71 2791355262 Rhizobium sp. M1 Isolate Nodule
72 2791355263 Rhizobium chutanense C5 Isolate Nodule
73 2791355264 Rhizobium sp. S9 Isolate Nodule
74 2791355265 Rhizobium sp. H4 Isolate Nodule
75 2791355267 Rhizobium sp. L18 Isolate Nodule
76 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
77 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
78 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
79 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
80 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
81 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
82 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
83 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
84 2838048938 Rhizobium pisi 27/80 Isolate Nodule
85 2838061910 Rhizobium phaseoli L15 Isolate Nodule
86 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
87 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
88 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
89 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
90 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
91 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
92 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
93 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
94 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
95 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
96 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
97 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
98 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
99 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
100 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
101 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
102 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
103 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
104 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
105 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
106 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
107 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
108 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
109 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
110 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
111 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
112 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
113 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
114 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
115 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
116 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
117 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
118 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
119 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
120 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
121 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
122 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
123 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
124 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
125 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
126 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
127 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
128 2933599457 Rhizobium phaseoli M3 Isolate Nodule
129 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
130 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
131 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
132 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
133 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
134 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
135 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
136 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
137 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
138 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
139 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
140 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
141 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
142 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
143 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
144 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
145 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
146 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
147 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
148 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
149 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
150 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
151 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
152 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
153 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
154 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
155 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
156 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
157 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
158 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
159 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
160 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
161 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
162 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
163 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
164 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
165 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
166 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
167 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
169 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
170 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
171 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
172 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
174 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
175 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
176 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
198 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
203 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
248 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
249 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
252 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
253 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 8005258706 Rhizobium sp. R693 Isolate Nodule
259 8005275841 Rhizobium sp. N4311 Isolate Nodule
260 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
261 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
262 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
263 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
264 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
265 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
266 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
267 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
268 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
269 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
270 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
271 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
272 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
273 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
274 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
275 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
276 8018176218 Rhizobium sp. N122 Isolate Nodule
277 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
278 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
279 8024501048 Rhizobium sp. H4 Isolate Nodule
280 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
281 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
282 8056382006 Rhizobium croatiense 13T Isolate Nodule
283 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.24
Metatranscriptomes 0
Isolates 48.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.84
Nodule 35.09
Rhizoplane 2.48
Rhizosphere 26.4
Stem 0
Stem Tuber 0
Unclassified 20.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000443 3300001979 Bacteria 17700
2 JGI25155J39150_1000020 3300002704 Bacteria 152963
3 JGI25156J39149_1000021 3300002705 Bacteria 152968
4 JGI25162J39368_1000656 3300002737 Bacteria 24441
5 JGI25154J39366_1000039 3300002738 Bacteria 152972
6 JGI25157J39369_1000019 3300002741 Bacteria 176591
7 JGI25150J39212_1000022 3300002774 Bacteria 131963
8 JGI25159J45721_1000310 3300002987 Bacteria 22814
9 JGI25151J46595_10000023 3300003187 Bacteria 221548
10 JGI25165J46597_1000018 3300003214 Bacteria 374701
11 JGI25165J46597_1000407 3300003214 Bacteria 45582
12 JGI25165J46597_1004173 3300003214 Bacteria 3204
13 JGI25153J46596_10000771 3300003215 Bacteria 19624
14 rootL2_10041209 3300003322 Bacteria 11998
15 rootL2_10173307 3300003322 Bacteria 1334
16 rootL2_10312501 3300003322 Bacteria 1331
17 rootH1_10011915 3300003323 Bacteria 12355
18 JGI25160J50197_1000014 3300003354 Bacteria 259862
19 JGI25161J50226_1000022 3300003374 Bacteria 158544
20 Ga0055528_1012721 3300003790 Bacteria 3247
21 Ga0055540_1000050 3300003792 Bacteria 145565
22 Ga0055540_1011434 3300003792 Bacteria 2861
23 Ga0055543_1000005 3300004625 Bacteria 223621
24 Ga0065165_1005083 3300005262 Bacteria 7644
25 Ga0070670_100000315 3300005331 Bacteria 41551
26 Ga0070668_100367513 3300005347 Bacteria 1221
27 Ga0070668_100400181 3300005347 Bacteria 1172
28 Ga0070665_100098028 3300005548 Bacteria 2936
29 Ga0068855_100148382 3300005563 Bacteria 2668
30 Ga0068856_100108800 3300005614 Bacteria 2768
31 Ga0068852_100022904 3300005616 Bacteria 5018
32 Ga0068851_10042031 3300005834 Bacteria 2300
33 Ga0075370_10011103 3300006353 Bacteria 4723
34 Ga0105240_10000012 3300009093 Bacteria 496639
35 Ga0105248_10622297 3300009177 Bacteria 1218
36 Ga0105237_10000165 3300009545 Bacteria 93713
37 Ga0105239_10000471 3300010375 Bacteria 58946
38 Ga0157370_10002150 3300013104 Bacteria 24090
39 Ga0182007_10003699 3300015262 Bacteria 7153
40 Ga0209435_100025 3300025206 Bacteria 198776
41 Ga0209436_113951 3300025208 Bacteria 1296
42 Ga0209672_102419 3300025228 Bacteria 4614
43 Ga0209437_100022 3300025233 Bacteria 625694
44 Ga0209437_100040 3300025233 Bacteria 448096
45 Ga0207425_1000038 3300025245 Bacteria 221600
46 Ga0209646_1000083 3300025246 Bacteria 198777
47 Ga0209646_1001941 3300025246 Bacteria 4999
48 Ga0209026_1000078 3300025250 Bacteria 198777
49 Ga0209677_101057 3300025253 Bacteria 13086
50 Ga0209759_1000060 3300025256 Bacteria 198777
51 Ga0209129_1000036 3300025258 Bacteria 328331
52 Ga0209233_1000031 3300025261 Bacteria 624646
53 Ga0209233_1000051 3300025261 Bacteria 447617
54 Ga0209233_1000146 3300025261 Bacteria 187269
55 Ga0209673_1000738 3300025273 Bacteria 45021
56 Ga0209673_1032959 3300025273 Bacteria 1587
57 Ga0209130_1000013 3300025284 Bacteria 412810
58 Ga0209025_1000108 3300025294 Bacteria 221600
59 Ga0209758_1000104 3300025297 Bacteria 221600
60 Ga0207426_1000022 3300025302 Bacteria 547377
61 Ga0209051_1000249 3300025303 Bacteria 90988
62 Ga0209051_1003027 3300025303 Bacteria 11378
63 Ga0209257_1008764 3300025304 Bacteria 5624
64 Ga0209257_1018724 3300025304 Bacteria 2645
65 Ga0207695_10000120 3300025913 Bacteria 234247
66 Ga0207671_10000513 3300025914 Bacteria 52462
67 Ga0207650_10001035 3300025925 Bacteria 20865
68 Ga0207702_10207475 3300026078 Bacteria 1820
69 Ga0207698_10017455 3300026142 Bacteria 4870
70 Ga0209371_1012986 3300027312 Bacteria 2373
71 Ga0307515_10000017 3300028794 Bacteria 550465
72 Ga0307515_10104236 3300028794 Bacteria 3390
73 Ga0268256_1014228 3300030500 Bacteria 2373
74 Ga0307513_10000717 3300031456 Bacteria 47556
75 Ga0307408_100091882 3300031548 Bacteria 2293
76 Ga0307405_10004543 3300031731 Bacteria 6573
77 Ga0307412_10326640 3300031911 Bacteria 1223
78 Ga0307416_100328340 3300032002 Bacteria 1536
79 Ga0395905_0018821 3300037471 Bacteria 6550
80 Ga0439436_0018813 3300041404 Bacteria 2065
81 Ga0439436_0037548 3300041404 Bacteria 1395
82 Ga0439465_0000577 3300041413 Bacteria 11066
83 Ga0451833_0028430 3300041491 Bacteria 3941
84 Ga0451849_0216942 3300041505 Bacteria 3968
85 Ga0439432_094856 3300042006 Bacteria 896
86 Ga0439452_049207 3300042010 Bacteria 970
87 Ga0450918_001409 3300042531 Bacteria 4779
88 Ga0466967_0116261 3300045976 Bacteria 2464
89 Ga0495592_0041187 3300046454 Bacteria 3462
90 Ga0495629_0013548 3300046459 Bacteria 5882
91 Ga0495585_0030856 3300046492 Bacteria 3047
92 Ga0495606_0002812 3300046507 Bacteria 19361
93 Ga0495606_0151842 3300046507 Bacteria 1359
94 Ga0495610_0000645 3300046512 Bacteria 34146
95 Ga0495616_0015567 3300046513 Bacteria 4228
96 Ga0495620_0033653 3300046515 Bacteria 2325
97 Ga0495628_0063552 3300046516 Bacteria 2892
98 Ga0495631_0009620 3300046518 Bacteria 4820
99 Ga0495632_0000202 3300046519 Bacteria 60620
100 Ga0495643_0019240 3300046522 Bacteria 3953
101 Ga0495609_0008986 3300046538 Bacteria 4858
102 Ga0495633_0046906 3300046558 Bacteria 2043
103 Ga0495668_0003325 3300046616 Bacteria 12137
104 Ga0495611_0004493 3300046648 Bacteria 6027
105 Ga0495625_0011739 3300046660 Bacteria 7119
106 Ga0495625_0051734 3300046660 Bacteria 2944
107 Ga0495625_0076287 3300046660 Bacteria 2344
108 Ga0495588_0083870 3300046674 Bacteria 1665
109 Ga0495657_0023091 3300046675 Bacteria 4449
110 Ga0495671_0080417 3300046692 Bacteria 1597
111 Ga0495660_0008893 3300046810 Bacteria 5869
112 Ga0495604_0174330 3300047317 Bacteria 1509
113 Ga0495672_0014172 3300047320 Bacteria 5470
114 Ga0495687_079174 3300047443 Bacteria 1292
115 Ga0495686_0000618 3300047472 Bacteria 49032
116 Ga0495686_0003574 3300047472 Bacteria 13351
117 Ga0495686_0014715 3300047472 Bacteria 5377
118 Ga0496100_0001093 3300048903 Bacteria 13095
119 Ga0496101_0026482 3300048904 Bacteria 4032
120 Ga0496101_0164405 3300048904 Bacteria 1703
121 Ga0496102_0019751 3300048905 Bacteria 5939
122 Ga0496102_0342728 3300048905 Bacteria 1407
123 Ga0496103_0012234 3300048906 Bacteria 5094
124 Ga0496116_0001783 3300048919 Bacteria 23396
125 Ga0496116_0005516 3300048919 Bacteria 11693
126 Ga0496116_0012891 3300048919 Bacteria 6786
127 Ga0496117_0003574 3300048920 Bacteria 17934
128 Ga0496117_0006725 3300048920 Bacteria 11483
129 Ga0496117_0068984 3300048920 Bacteria 2383
130 Ga0496118_0001436 3300048921 Bacteria 35889
131 Ga0496118_0006617 3300048921 Bacteria 12657
132 Ga0496119_0005562 3300048922 Bacteria 11990
133 Ga0496119_0006412 3300048922 Bacteria 10915
134 Ga0496119_0009043 3300048922 Bacteria 8636
135 Ga0496120_0003155 3300048923 Bacteria 15374
136 Ga0496121_0016838 3300048924 Bacteria 7517
137 Ga0496121_0039145 3300048924 Bacteria 4184
138 Ga0496121_0066943 3300048924 Bacteria 2914
139 Ga0496122_0012053 3300048925 Bacteria 8668
140 Ga0496122_0023015 3300048925 Bacteria 5513
141 Ga0496122_0060469 3300048925 Bacteria 2789
142 Ga0496123_0007152 3300048926 Bacteria 10603
143 Ga0496123_0027099 3300048926 Bacteria 4276
144 Ga0496124_0000153 3300048927 Bacteria 139859
145 Ga0496124_0002778 3300048927 Bacteria 22246
146 Ga0496125_0027648 3300048928 Bacteria 5137
147 Ga0496125_0104954 3300048928 Bacteria 2067
148 Ga0496126_0177583 3300048929 Bacteria 1810
149 Ga0495678_014659 3300049459 Bacteria 3638
150 Ga0501044_0056520 3300049823 Bacteria 4030
151 Ga0500578_0059887 3300053086 Bacteria 2433
152 Ga0500557_015917 3300053105 Bacteria 2043
153 Ga0500569_081201 3300053109 Bacteria 1037
154 Ga0500618_001103 3300053125 Bacteria 13247
155 Ga0500618_005672 3300053125 Bacteria 3765
156 Ga0500658_0095939 3300053134 Bacteria 1288
157 Ga0500568_0003372 3300053139 Bacteria 8928
158 Ga0500573_0011747 3300053140 Bacteria 4907
159 Ga0500573_0018042 3300053140 Bacteria 4021
160 Ga0500590_000698 3300053148 Bacteria 12170
161 Ga0500616_0004345 3300053153 Bacteria 10141
162 Ga0500616_0082132 3300053153 Unclassified 1617
163 Ga0500622_0000375 3300053156 Bacteria 43118
164 Ga0500627_0154526 3300053158 Bacteria 1036
165 Ga0500636_0034506 3300053177 Bacteria 2995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041404 Ga0439436_0018813 Ga0439436_0018813_1254_2027 257
2 3300042010 Ga0439452_049207 Ga0439452_049207_34_807 257
3 iso_pu_bacteria 2838668709 2838674670 258
4 3300046660 Ga0495625_0076287 Ga0495625_0076287_1269_2132 264
5 3300042006 Ga0439432_094856 Ga0439432_094856_46_879 277
6 3300047317 Ga0495604_0174330 Ga0495604_0174330_365_1216 280
7 iso_pu_bacteria 2582581283 2585167683 280
8 iso_pu_bacteria 2582581306 2585265941 280
9 iso_pu_bacteria 2582581865 2585390132 280
10 iso_pu_bacteria 2643221688 2644494131 280
11 iso_pu_bacteria 2643221689 2644500526 280
12 iso_pu_bacteria 2791355253 2793283422 280
13 3300003322 rootL2_10173307 rootL2_101733071 281
14 3300049823 Ga0501044_0056520 Ga0501044_0056520_2989_3834 281
15 3300053153 Ga0500616_0082132 Ga0500616_0082132_641_1486 281
16 3300053156 Ga0500622_0000375 Ga0500622_0000375_12118_12963 281
17 iso_pu_bacteria 2767802442 2770197133 281
18 3300037471 Ga0395905_0018821 Ga0395905_0018821_435_1286 283
19 iso_pu_bacteria 2643221607 2644052177 283
20 iso_pu_bacteria 2643221636 2644204971 283
21 iso_pu_bacteria 2643221686 2644484920 283
22 iso_pu_bacteria 2775506902 2776267665 283
23 iso_pu_bacteria 3002141150 3002146453 283
24 iso_pu_bacteria 2643221637 2644208598 284
25 iso_pu_bacteria 2643221718 2644652128 284
26 3300028794 Ga0307515_10000017 Ga0307515_10000017341 287
27 3300028794 Ga0307515_10104236 Ga0307515_101042361 287
28 3300031456 Ga0307513_10000717 Ga0307513_1000071729 287
29 3300031548 Ga0307408_100091882 Ga0307408_1000918822 287
30 3300032002 Ga0307416_100328340 Ga0307416_1003283401 287
31 3300041413 Ga0439465_0000577 Ga0439465_0000577_4763_5626 287
32 3300042531 Ga0450918_001409 Ga0450918_001409_849_1712 287
33 3300046516 Ga0495628_0063552 Ga0495628_0063552_581_1453 287
34 3300046558 Ga0495633_0046906 Ga0495633_0046906_50_913 287
35 3300046660 Ga0495625_0051734 Ga0495625_0051734_1845_2708 287
36 3300053140 Ga0500573_0011747 Ga0500573_0011747_2680_3543 287
37 3300053140 Ga0500573_0018042 Ga0500573_0018042_1808_2671 287
38 3300046454 Ga0495592_0041187 Ga0495592_0041187_2051_2926 288
39 3300046459 Ga0495629_0013548 Ga0495629_0013548_1065_1940 288
40 3300053148 Ga0500590_000698 Ga0500590_000698_7508_8383 288
41 iso_pu_bacteria 2509276021 2509385838 288
42 iso_pu_bacteria 2509276033 2509448104 288
43 iso_pu_bacteria 2510065019 2510136823 288
44 iso_pu_bacteria 2510917022 2511132901 288
45 iso_pu_bacteria 2513237084 2513569770 288
46 iso_pu_bacteria 2513237088 2513595710 288
47 iso_pu_bacteria 2513237144 2513911649 288
48 iso_pu_bacteria 2515075009 2515115405 288
49 iso_pu_bacteria 2524023209 2524457127 288
50 iso_pu_bacteria 2529292951 2530644379 288
51 iso_pu_bacteria 2534681796 2535519956 288
52 iso_pu_bacteria 2582581307 2585272384 288
53 iso_pu_bacteria 2582581308 2585278446 288
54 iso_pu_bacteria 2582581315 2585324710 288
55 iso_pu_bacteria 2582581316 2585332142 288
56 iso_pu_bacteria 2585427527 2585531898 288
57 iso_pu_bacteria 2585427530 2585552257 288
58 iso_pu_bacteria 2585427531 2585561553 288
59 iso_pu_bacteria 2585427594 2585842526 288
60 iso_pu_bacteria 2585427608 2585899404 288
61 iso_pu_bacteria 2585427609 2585906781 288
62 iso_pu_bacteria 2585428125 2587982202 288
63 iso_pu_bacteria 2615840626 2616307964 288
64 iso_pu_bacteria 2615840698 2616552537 288
65 iso_pu_bacteria 2617270742 2617381722 288
66 iso_pu_bacteria 2667528174 2671112957 288
67 iso_pu_bacteria 2718217882 2719183562 288
68 iso_pu_bacteria 2718217927 2719388304 288
69 iso_pu_bacteria 2718217997 2719667919 288
70 iso_pu_bacteria 2718218009 2719728003 288
71 iso_pu_bacteria 2718218199 2720494682 288
72 iso_pu_bacteria 2718218232 2720611018 288
73 iso_pu_bacteria 2718218233 2720616186 288
74 iso_pu_bacteria 2718218235 2720629267 288
75 iso_pu_bacteria 2718218269 2720771839 288
76 iso_pu_bacteria 2718218363 2721144864 288
77 iso_pu_bacteria 2718218365 2721155603 288
78 iso_pu_bacteria 2718218366 2721166951 288
79 iso_pu_bacteria 2718218423 2721402927 288
80 iso_pu_bacteria 2721755514 2722837929 288
81 iso_pu_bacteria 2721755556 2723029243 288
82 iso_pu_bacteria 2721755684 2723562876 288
83 iso_pu_bacteria 2721755685 2723570866 288
84 iso_pu_bacteria 2721755809 2724035284 288
85 iso_pu_bacteria 2721755810 2724042197 288
86 iso_pu_bacteria 2721755819 2724086659 288
87 iso_pu_bacteria 2721755822 2724106817 288
88 iso_pu_bacteria 2721755823 2724107623 288
89 iso_pu_bacteria 2728369352 2730105557 288
90 iso_pu_bacteria 2728369365 2730161702 288
91 iso_pu_bacteria 2728369397 2730300710 288
92 iso_pu_bacteria 2738541293 2738801780 288
93 iso_pu_bacteria 2775507266 2778178205 288
94 iso_pu_bacteria 2791355256 2793296557 288
95 iso_pu_bacteria 2791355260 2793321552 288
96 iso_pu_bacteria 2791355262 2793332939 288
97 iso_pu_bacteria 2791355263 2793340262 288
98 iso_pu_bacteria 2791355264 2793346041 288
99 iso_pu_bacteria 2791355265 2793355253 288
100 iso_pu_bacteria 2791355267 2793366689 288
101 iso_pu_bacteria 2802429605 2805927933 288
102 iso_pu_bacteria 2802429606 2805933779 288
103 iso_pu_bacteria 2818991453 2819640141 288
104 iso_pu_bacteria 2838016132 2838019336 288
105 iso_pu_bacteria 2838022645 2838024881 288
106 iso_pu_bacteria 2838029111 2838033800 288
107 iso_pu_bacteria 2838042994 2838046498 288
108 iso_pu_bacteria 2838048938 2838050412 288
109 iso_pu_bacteria 2838061910 2838063114 288
110 iso_pu_bacteria 2838068647 2838071675 288
111 iso_pu_bacteria 2838661181 2838662007 288
112 iso_pu_bacteria 2838701080 2838705229 288
113 iso_pu_bacteria 2841864319 2841869636 288
114 iso_pu_bacteria 2842146304 2842150280 288
115 iso_pu_bacteria 2842192696 2842195101 288
116 iso_pu_bacteria 2842198810 2842201966 288
117 iso_pu_bacteria 2842205361 2842210482 288
118 iso_pu_bacteria 2842250916 2842254966 288
119 iso_pu_bacteria 2842264693 2842267875 288
120 iso_pu_bacteria 2842278818 2842283936 288
121 iso_pu_bacteria 2842285085 2842289819 288
122 iso_pu_bacteria 2842298080 2842299320 288
123 iso_pu_bacteria 2842304105 2842310556 288
124 iso_pu_bacteria 2842311132 2842311920 288
125 iso_pu_bacteria 2842317721 2842319285 288
126 iso_pu_bacteria 2842341865 2842343880 288
127 iso_pu_bacteria 2842357229 2842358787 288
128 iso_pu_bacteria 2842363717 2842368257 288
129 iso_pu_bacteria 2842395702 2842396754 288
130 iso_pu_bacteria 2842402390 2842407040 288
131 iso_pu_bacteria 2842409023 2842413933 288
132 iso_pu_bacteria 2842415677 2842420574 288
133 iso_pu_bacteria 2842422224 2842425308 288
134 iso_pu_bacteria 2842428310 2842432038 288
135 iso_pu_bacteria 2842434925 2842438150 288
136 iso_pu_bacteria 2842441272 2842443846 288
137 iso_pu_bacteria 2842447887 2842449891 288
138 iso_pu_bacteria 2842462802 2842466136 288
139 iso_pu_bacteria 2842469257 2842472880 288
140 iso_pu_bacteria 2842475841 2842480547 288
141 iso_pu_bacteria 2842482326 2842484121 288
142 iso_pu_bacteria 2842489311 2842491732 288
143 iso_pu_bacteria 2842495871 2842502049 288
144 iso_pu_bacteria 2842502639 2842507172 288
145 iso_pu_bacteria 2842509118 2842512215 288
146 iso_pu_bacteria 2852387548 2852394517 288
147 iso_pu_bacteria 2857516855 2857522314 288
148 iso_pu_bacteria 2919408235 2919412746 288
149 iso_pu_bacteria 2933570622 2933577021 288
150 iso_pu_bacteria 2933599457 2933602471 288
151 iso_pu_bacteria 2936375103 2936378178 288
152 iso_pu_bacteria 3005416602 3005421062 288
153 iso_pu_bacteria 8005258706 8005263947 288
154 iso_pu_bacteria 8005275841 8005277020 288
155 iso_pu_bacteria 8005282627 8005287967 288
156 iso_pu_bacteria 8005289223 8005290521 288
157 iso_pu_bacteria 8005301065 8005305182 288
158 iso_pu_bacteria 8005314921 8005319203 288
159 iso_pu_bacteria 8005430974 8005431342 288
160 iso_pu_bacteria 8005460587 8005466629 288
161 iso_pu_bacteria 8005484373 8005489464 288
162 iso_pu_bacteria 8005497431 8005502931 288
163 iso_pu_bacteria 8005542996 8005547682 288
164 iso_pu_bacteria 8005619151 8005625470 288
165 iso_pu_bacteria 8005626139 8005630455 288
166 iso_pu_bacteria 8005668836 8005674850 288
167 iso_pu_bacteria 8005682033 8005684003 288
168 iso_pu_bacteria 8005688590 8005689204 288
169 iso_pu_bacteria 8005695170 8005696938 288
170 iso_pu_bacteria 8018176218 8018182873 288
171 iso_pu_bacteria 8024479707 8024484034 288
172 iso_pu_bacteria 8024501048 8024505407 288
173 iso_pu_bacteria 8056375014 8056375302 288
174 iso_pu_bacteria 8056382006 8056383159 288
175 iso_pu_bacteria 2582581866 2585395287 290
176 3300002987 JGI25159J45721_1000310 JGI25159J45721_10003105 291
177 3300003354 JGI25160J50197_1000014 JGI25160J50197_1000014159 291
178 3300003374 JGI25161J50226_1000022 JGI25161J50226_100002259 291
179 3300004625 Ga0055543_1000005 Ga0055543_100000574 291
180 3300005262 Ga0065165_1005083 Ga0065165_10050834 291
181 3300005347 Ga0070668_100367513 Ga0070668_1003675132 291
182 3300025208 Ga0209436_113951 Ga0209436_1139512 291
183 3300025284 Ga0209130_1000013 Ga0209130_1000013307 291
184 3300025302 Ga0207426_1000022 Ga0207426_100002274 291
185 3300046507 Ga0495606_0151842 Ga0495606_0151842_350_1234 291
186 3300046675 Ga0495657_0023091 Ga0495657_0023091_1701_2609 291
187 3300048905 Ga0496102_0342728 Ga0496102_0342728_258_1133 291
188 iso_pu_bacteria 8024486573 8024491237 291
189 iso_pu_bacteria 8046767195 8046774649 291
190 iso_pu_bacteria 8057575449 8057577695 291
191 3300001979 JGI24740J21852_10000443 JGI24740J21852_100004436 292
192 3300002704 JGI25155J39150_1000020 JGI25155J39150_1000020142 292
193 3300002705 JGI25156J39149_1000021 JGI25156J39149_10000217 292
194 3300002737 JGI25162J39368_1000656 JGI25162J39368_100065622 292
195 3300002738 JGI25154J39366_1000039 JGI25154J39366_1000039142 292
196 3300002741 JGI25157J39369_1000019 JGI25157J39369_10000197 292
197 3300002774 JGI25150J39212_1000022 JGI25150J39212_100002257 292
198 3300003187 JGI25151J46595_10000023 JGI25151J46595_1000002386 292
199 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018266 292
200 3300003214 JGI25165J46597_1000407 JGI25165J46597_100040722 292
201 3300003214 JGI25165J46597_1004173 JGI25165J46597_10041734 292
202 3300003215 JGI25153J46596_10000771 JGI25153J46596_1000077112 292
203 3300003322 rootL2_10041209 rootL2_100412097 292
204 3300003322 rootL2_10312501 rootL2_103125012 292
205 3300003323 rootH1_10011915 rootH1_100119155 292
206 3300003790 Ga0055528_1012721 Ga0055528_10127212 292
207 3300003792 Ga0055540_1000050 Ga0055540_100005017 292
208 3300003792 Ga0055540_1011434 Ga0055540_10114342 292
209 3300005331 Ga0070670_100000315 Ga0070670_10000031535 292
210 3300005347 Ga0070668_100400181 Ga0070668_1004001811 292
211 3300005548 Ga0070665_100098028 Ga0070665_1000980282 292
212 3300005563 Ga0068855_100148382 Ga0068855_1001483823 292
213 3300005614 Ga0068856_100108800 Ga0068856_1001088002 292
214 3300005616 Ga0068852_100022904 Ga0068852_1000229044 292
215 3300005834 Ga0068851_10042031 Ga0068851_100420312 292
216 3300006353 Ga0075370_10011103 Ga0075370_100111034 292
217 3300009093 Ga0105240_10000012 Ga0105240_1000001247 292
218 3300009177 Ga0105248_10622297 Ga0105248_106222972 292
219 3300009545 Ga0105237_10000165 Ga0105237_1000016558 292
220 3300010375 Ga0105239_10000471 Ga0105239_1000047141 292
221 3300013104 Ga0157370_10002150 Ga0157370_100021509 292
222 3300015262 Ga0182007_10003699 Ga0182007_100036995 292
223 3300025206 Ga0209435_100025 Ga0209435_100025162 292
224 3300025228 Ga0209672_102419 Ga0209672_1024192 292
225 3300025233 Ga0209437_100022 Ga0209437_100022326 292
226 3300025233 Ga0209437_100040 Ga0209437_100040333 292
227 3300025245 Ga0207425_1000038 Ga0207425_1000038142 292
228 3300025246 Ga0209646_1000083 Ga0209646_1000083162 292
229 3300025246 Ga0209646_1001941 Ga0209646_10019414 292
230 3300025250 Ga0209026_1000078 Ga0209026_1000078162 292
231 3300025253 Ga0209677_101057 Ga0209677_1010575 292
232 3300025256 Ga0209759_1000060 Ga0209759_1000060162 292
233 3300025258 Ga0209129_1000036 Ga0209129_1000036142 292
234 3300025261 Ga0209233_1000031 Ga0209233_1000031326 292
235 3300025261 Ga0209233_1000051 Ga0209233_1000051334 292
236 3300025261 Ga0209233_1000146 Ga0209233_1000146165 292
237 3300025273 Ga0209673_1000738 Ga0209673_100073820 292
238 3300025273 Ga0209673_1032959 Ga0209673_10329592 292
239 3300025294 Ga0209025_1000108 Ga0209025_1000108142 292
240 3300025297 Ga0209758_1000104 Ga0209758_100010485 292
241 3300025303 Ga0209051_1000249 Ga0209051_100024934 292
242 3300025303 Ga0209051_1003027 Ga0209051_10030276 292
243 3300025304 Ga0209257_1008764 Ga0209257_10087645 292
244 3300025304 Ga0209257_1018724 Ga0209257_10187243 292
245 3300025913 Ga0207695_10000120 Ga0207695_10000120167 292
246 3300025914 Ga0207671_10000513 Ga0207671_100005139 292
247 3300025925 Ga0207650_10001035 Ga0207650_100010352 292
248 3300026078 Ga0207702_10207475 Ga0207702_102074752 292
249 3300026142 Ga0207698_10017455 Ga0207698_100174552 292
250 3300027312 Ga0209371_1012986 Ga0209371_10129862 292
251 3300030500 Ga0268256_1014228 Ga0268256_10142282 292
252 3300031731 Ga0307405_10004543 Ga0307405_100045433 292
253 3300031911 Ga0307412_10326640 Ga0307412_103266402 292
254 3300041404 Ga0439436_0037548 Ga0439436_0037548_22_900 292
255 3300041491 Ga0451833_0028430 Ga0451833_0028430_175_1053 292
256 3300041505 Ga0451849_0216942 Ga0451849_0216942_202_1080 292
257 3300045976 Ga0466967_0116261 Ga0466967_0116261_291_1178 292
258 3300046492 Ga0495585_0030856 Ga0495585_0030856_622_1500 292
259 3300046507 Ga0495606_0002812 Ga0495606_0002812_15864_16781 292
260 3300046512 Ga0495610_0000645 Ga0495610_0000645_3616_4494 292
261 3300046513 Ga0495616_0015567 Ga0495616_0015567_2170_3048 292
262 3300046515 Ga0495620_0033653 Ga0495620_0033653_471_1349 292
263 3300046518 Ga0495631_0009620 Ga0495631_0009620_3565_4443 292
264 3300046519 Ga0495632_0000202 Ga0495632_0000202_46266_47144 292
265 3300046522 Ga0495643_0019240 Ga0495643_0019240_600_1478 292
266 3300046538 Ga0495609_0008986 Ga0495609_0008986_3225_4103 292
267 3300046616 Ga0495668_0003325 Ga0495668_0003325_10530_11408 292
268 3300046648 Ga0495611_0004493 Ga0495611_0004493_1576_2454 292
269 3300046660 Ga0495625_0011739 Ga0495625_0011739_3429_4307 292
270 3300046674 Ga0495588_0083870 Ga0495588_0083870_647_1525 292
271 3300046692 Ga0495671_0080417 Ga0495671_0080417_499_1377 292
272 3300046810 Ga0495660_0008893 Ga0495660_0008893_2291_3169 292
273 3300047320 Ga0495672_0014172 Ga0495672_0014172_1269_2147 292
274 3300047443 Ga0495687_079174 Ga0495687_079174_323_1201 292
275 3300047472 Ga0495686_0000618 Ga0495686_0000618_23519_24400 292
276 3300047472 Ga0495686_0003574 Ga0495686_0003574_2041_2922 292
277 3300047472 Ga0495686_0014715 Ga0495686_0014715_2030_2908 292
278 3300048903 Ga0496100_0001093 Ga0496100_0001093_1298_2176 292
279 3300048904 Ga0496101_0026482 Ga0496101_0026482_673_1551 292
280 3300048904 Ga0496101_0164405 Ga0496101_0164405_297_1175 292
281 3300048905 Ga0496102_0019751 Ga0496102_0019751_2186_3064 292
282 3300048906 Ga0496103_0012234 Ga0496103_0012234_1522_2400 292
283 3300048919 Ga0496116_0001783 Ga0496116_0001783_5804_6682 292
284 3300048919 Ga0496116_0005516 Ga0496116_0005516_7953_8831 292
285 3300048919 Ga0496116_0012891 Ga0496116_0012891_2381_3259 292
286 3300048920 Ga0496117_0003574 Ga0496117_0003574_9869_10747 292
287 3300048920 Ga0496117_0006725 Ga0496117_0006725_5914_6792 292
288 3300048920 Ga0496117_0068984 Ga0496117_0068984_1106_1984 292
289 3300048921 Ga0496118_0001436 Ga0496118_0001436_29145_30023 292
290 3300048921 Ga0496118_0006617 Ga0496118_0006617_9297_10175 292
291 3300048922 Ga0496119_0005562 Ga0496119_0005562_347_1225 292
292 3300048922 Ga0496119_0006412 Ga0496119_0006412_2267_3145 292
293 3300048922 Ga0496119_0009043 Ga0496119_0009043_3899_4786 292
294 3300048923 Ga0496120_0003155 Ga0496120_0003155_8164_9042 292
295 3300048924 Ga0496121_0016838 Ga0496121_0016838_2754_3632 292
296 3300048924 Ga0496121_0039145 Ga0496121_0039145_3092_3970 292
297 3300048924 Ga0496121_0066943 Ga0496121_0066943_41_919 292
298 3300048925 Ga0496122_0012053 Ga0496122_0012053_2070_2948 292
299 3300048925 Ga0496122_0023015 Ga0496122_0023015_2838_3716 292
300 3300048925 Ga0496122_0060469 Ga0496122_0060469_533_1411 292
301 3300048926 Ga0496123_0007152 Ga0496123_0007152_5287_6165 292
302 3300048926 Ga0496123_0027099 Ga0496123_0027099_2881_3768 292
303 3300048927 Ga0496124_0000153 Ga0496124_0000153_97720_98598 292
304 3300048927 Ga0496124_0002778 Ga0496124_0002778_13416_14294 292
305 3300048928 Ga0496125_0027648 Ga0496125_0027648_237_1115 292
306 3300048928 Ga0496125_0104954 Ga0496125_0104954_144_1022 292
307 3300048929 Ga0496126_0177583 Ga0496126_0177583_126_1004 292
308 3300049459 Ga0495678_014659 Ga0495678_014659_1537_2415 292
309 3300053086 Ga0500578_0059887 Ga0500578_0059887_521_1399 292
310 3300053105 Ga0500557_015917 Ga0500557_015917_295_1173 292
311 3300053109 Ga0500569_081201 Ga0500569_081201_86_964 292
312 3300053125 Ga0500618_001103 Ga0500618_001103_10967_11929 292
313 3300053125 Ga0500618_005672 Ga0500618_005672_130_1008 292
314 3300053134 Ga0500658_0095939 Ga0500658_0095939_392_1270 292
315 3300053139 Ga0500568_0003372 Ga0500568_0003372_2396_3274 292
316 3300053153 Ga0500616_0004345 Ga0500616_0004345_5238_6116 292
317 3300053158 Ga0500627_0154526 Ga0500627_0154526_110_994 292
318 3300053177 Ga0500636_0034506 Ga0500636_0034506_1347_2225 292
319 iso_pu_bacteria 2513237159 2513997462 292
320 iso_pu_bacteria 2818991448 2819610250 292
321 iso_pu_bacteria 2842521101 2842522297 292
322 iso_pu_bacteria 8005645114 8005648024 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05050

Methyltransf_21

Methyltransferase FkbM domain

100

269

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bva-assembly1.cif.gz_A-2 crystal structure of mus musculus protein arginine methyltransferase 2 in complex with rsf1_114-126 0.9294 95 151
8g2g-assembly1.cif.gz_A crystal structure of prmt3 with compound yd1113 0.8576 91 152
5eku-assembly1.cif.gz_B crystal structure of trypanosoma brucei protein arginine methyltransferase prmt7 in complex with s-adenosyl-l-homocysteine 0.8409 85 154
5z9o-assembly2.cif.gz_B the crystal structure of cyclopropane-fatty-acyl-phospholipid synthase from lactobacillus acidophilus 0.8107 94 151
3wst-assembly1.cif.gz_A crystal structure of c.elegans prmt7 in complex with sah(p31) 0.7839 74 158
ID Description Score Start End Superfamily
af_K7MAL3_1_105_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9484 97 152 3.40.50.150
af_Q20240_116_302_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9046 95 152 3.40.50.150
af_A1Z909_427_794_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9019 96 152 3.40.50.150
af_Q8IHP7_693_845_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8869 96 153 3.40.50.150
af_Q4CX97_260_523_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8822 97 154 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W4N1L8-F1-model_v4 deleted 0.98 203 292
AF-A0A7W4N1L8-F1-model_v4 deleted 0.9489 203 292
AF-A0A368YYN7-F1-model_v4 FkbM family methyltransferase 0.9477 80 292 GO:0008168
GO:0032259
AF-S4RQZ8-F1-model_v4 THUMP domain containing 2 0.9163 94 154 GO:0003723
GO:0016423
GO:0030488
AF-A0A1V4XSL2-F1-model_v4 Methyltransferase domain protein 0.8693 47 292 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.76 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map