F406641

General Info

Members Datasets Scaffolds Average Seq Length
322 201 644 168

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0034031|Ga0501033_0034031_2335_2937
Length 200
Sequence VVTGQLSGTQPQIESVDTRTGRLSHAGSAVADEKRVWALAATVCDPEVPVLTIEDLGVLRAVHVDSGSGADGAERGDAPAVTVEITPTYSGCPAVDAMRDDILSTLSRAGYRDVTVRTVLAPAWTTDWMSDEGKAKLEAFGIAPPAPRAADGRVGLGLGIRCPRCGSLHTREVSHFGSTSCKALYVCQKCSEPFDHFKAH

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
36 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
37 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
77 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
78 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
79 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
167 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
172 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
173 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
174 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
177 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
183 2643221649 Leifsonia sp. Root4 Isolate Unclassified
184 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
185 2818991444 Filimonas endophytica 3197 Isolate Unclassified
186 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
187 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
188 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
189 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
190 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
191 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
192 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
193 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
194 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
195 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
196 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
197 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
198 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
199 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
200 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
201 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.55
Metatranscriptomes 1.24
Isolates 6.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 4.35
Rhizoplane 1.86
Rhizosphere 80.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0034031 3300049570 Bacteria 3823
2 JGI25406J46586_10010316 3300003203 Bacteria 4149
3 JGI25153J46596_10002250 3300003215 Bacteria 11239
4 JGI25407J50210_10044079 3300003373 Bacteria 1139
5 Ga0006562J51391_1035107 3300003578 Bacteria 9420
6 Ga0006562J51391_1035108 3300003578 Bacteria 9120
7 Ga0006562J51391_1053710 3300003578 Bacteria 3650
8 Ga0006562J51391_1053712 3300003578 Bacteria 2750
9 JGI25404J52841_10014617 3300003659 Bacteria 1704
10 JGI25404J52841_10016292 3300003659 Bacteria 1613
11 Ga0055542_1004155 3300003762 Bacteria 3634
12 Ga0065165_1010203 3300005262 Bacteria 4095
13 Ga0070658_10044576 3300005327 Bacteria 3585
14 Ga0070658_10131800 3300005327 Bacteria 2083
15 Ga0070683_100130044 3300005329 Bacteria 2383
16 Ga0070680_100215167 3300005336 Bacteria 1621
17 Ga0068868_100051666 3300005338 Bacteria 3235
18 Ga0070660_100027328 3300005339 Bacteria 4257
19 Ga0070659_100000749 3300005366 Bacteria 23637
20 Ga0070659_100107474 3300005366 Bacteria 2250
21 Ga0070667_100109359 3300005367 Bacteria 2395
22 Ga0070709_10028748 3300005434 Bacteria 3319
23 Ga0070710_10087789 3300005437 Bacteria 1828
24 Ga0070711_100141936 3300005439 Bacteria 1802
25 Ga0070679_100115818 3300005530 Bacteria 2665
26 Ga0070684_100289558 3300005535 Bacteria 1501
27 Ga0068853_100007366 3300005539 Bacteria 8806
28 Ga0068853_100022507 3300005539 Bacteria 5264
29 Ga0068855_100005961 3300005563 Bacteria 14863
30 Ga0068855_100010153 3300005563 Bacteria 11349
31 Ga0068855_100078793 3300005563 Bacteria 3822
32 Ga0068857_100013829 3300005577 Bacteria 7028
33 Ga0068856_100132918 3300005614 Bacteria 2493
34 Ga0068856_100224594 3300005614 Bacteria 1893
35 Ga0068852_100014526 3300005616 Bacteria 6067
36 Ga0068852_100188304 3300005616 Bacteria 1945
37 Ga0068852_100653962 3300005616 Bacteria 1059
38 Ga0068859_100386412 3300005617 Bacteria 1495
39 Ga0081455_10032257 3300005937 Bacteria 4723
40 Ga0081538_10006496 3300005981 Bacteria 10287
41 Ga0081538_10040819 3300005981 Bacteria 2954
42 Ga0081540_1077265 3300005983 Bacteria 1514
43 Ga0075365_10149580 3300006038 Bacteria 1624
44 Ga0070712_100074012 3300006175 Bacteria 2445
45 Ga0075433_10806350 3300006852 Bacteria 820
46 Ga0075434_100041320 3300006871 Bacteria 4569
47 Ga0097620_100386429 3300006931 Bacteria 1495
48 Ga0099825_1030158 3300006941 Bacteria 2431
49 Ga0099824_1044082 3300006942 Bacteria 975
50 Ga0099822_1064873 3300006943 Bacteria 1125
51 Ga0105240_10344676 3300009093 Bacteria 1691
52 Ga0105240_10429397 3300009093 Bacteria 1483
53 Ga0105240_10944942 3300009093 Bacteria 925
54 Ga0105240_11228978 3300009093 Bacteria 792
55 Ga0105245_10110539 3300009098 Bacteria 2555
56 Ga0105245_10711282 3300009098 Bacteria 1038
57 Ga0105241_10247497 3300009174 Bacteria 1510
58 Ga0105248_10029944 3300009177 Bacteria 6075
59 Ga0105237_10006335 3300009545 Bacteria 13154
60 Ga0105237_10037729 3300009545 Bacteria 4883
61 Ga0105237_10132272 3300009545 Bacteria 2489
62 Ga0105237_10157464 3300009545 Bacteria 2268
63 Ga0105238_10206708 3300009551 Bacteria 1939
64 Ga0105238_10521045 3300009551 Bacteria 1191
65 Ga0105239_10085743 3300010375 Bacteria 3471
66 Ga0105239_10767596 3300010375 Bacteria 1104
67 Ga0105239_11376244 3300010375 Bacteria 814
68 Ga0157342_1053513 3300012507 Bacteria 574
69 Ga0157371_10506756 3300013102 Bacteria 892
70 Ga0157370_10580659 3300013104 Bacteria 1027
71 Ga0209148_1000347 3300025254 Bacteria 60370
72 Ga0209148_1021005 3300025254 Bacteria 1067
73 Ga0209233_1004474 3300025261 Bacteria 4747
74 Ga0209455_1005515 3300025272 Bacteria 3893
75 Ga0209564_1019790 3300025295 Bacteria 2498
76 Ga0209758_1129325 3300025297 Bacteria 670
77 Ga0209256_1009928 3300025299 Bacteria 4084
78 Ga0207692_10160129 3300025898 Bacteria 1296
79 Ga0207685_10136554 3300025905 Bacteria 1095
80 Ga0207699_10022841 3300025906 Bacteria 3396
81 Ga0207654_10085803 3300025911 Bacteria 1907
82 Ga0207695_10000008 3300025913 Bacteria 1058268
83 Ga0207695_10003698 3300025913 Bacteria 21313
84 Ga0207695_10023793 3300025913 Bacteria 6914
85 Ga0207695_10475986 3300025913 Bacteria 1131
86 Ga0207671_10004779 3300025914 Bacteria 12768
87 Ga0207671_10008416 3300025914 Bacteria 8752
88 Ga0207671_10070154 3300025914 Bacteria 2612
89 Ga0207671_10135608 3300025914 Bacteria 1892
90 Ga0207671_10285785 3300025914 Bacteria 1301
91 Ga0207693_10025498 3300025915 Bacteria 4687
92 Ga0207663_10038528 3300025916 Bacteria 2890
93 Ga0207660_10062821 3300025917 Bacteria 2676
94 Ga0207657_10018714 3300025919 Bacteria 6601
95 Ga0207652_10004961 3300025921 Bacteria 10776
96 Ga0207694_10054762 3300025924 Bacteria 3095
97 Ga0207694_10087958 3300025924 Bacteria 2448
98 Ga0207694_10100084 3300025924 Bacteria 2296
99 Ga0207687_10120152 3300025927 Bacteria 1964
100 Ga0207687_10311490 3300025927 Bacteria 1271
101 Ga0207690_10041728 3300025932 Bacteria 3009
102 Ga0207690_10632437 3300025932 Bacteria 876
103 Ga0207711_10146421 3300025941 Bacteria 2128
104 Ga0207667_10001482 3300025949 Bacteria 29458
105 Ga0207667_10016171 3300025949 Bacteria 8437
106 Ga0207667_10066698 3300025949 Bacteria 3751
107 Ga0207667_10076852 3300025949 Bacteria 3464
108 Ga0207658_10338909 3300025986 Bacteria 1306
109 Ga0207658_10624820 3300025986 Bacteria 969
110 Ga0207639_10026731 3300026041 Bacteria 4195
111 Ga0207639_10104223 3300026041 Bacteria 2299
112 Ga0207639_10286598 3300026041 Bacteria 1450
113 Ga0207702_10055677 3300026078 Bacteria 3355
114 Ga0207702_10070252 3300026078 Bacteria 3012
115 Ga0207702_10153925 3300026078 Bacteria 2094
116 Ga0207702_10527962 3300026078 Bacteria 1153
117 Ga0207676_10019085 3300026095 Bacteria 4997
118 Ga0207674_10035982 3300026116 Bacteria 5164
119 Ga0207698_10000078 3300026142 Bacteria 65050
120 Ga0207698_10060282 3300026142 Bacteria 2950
121 Ga0207698_10160041 3300026142 Bacteria 1968
122 Ga0207698_10863195 3300026142 Bacteria 911
123 Ga0209389_1000014 3300027296 Bacteria 188621
124 Ga0209589_1000020 3300027357 Bacteria 188617
125 Ga0209489_100060 3300027361 Bacteria 147091
126 Ga0307512_10091797 3300030522 Bacteria 2110
127 Ga0265328_10016262 3300031239 Bacteria 2898
128 Ga0265331_10051237 3300031250 Bacteria 1976
129 Ga0265316_10150244 3300031344 Bacteria 1745
130 Ga0307509_10145683 3300031507 Bacteria 2295
131 Ga0265313_10024626 3300031595 Bacteria 3211
132 Ga0307508_10003658 3300031616 Bacteria 15415
133 Ga0307409_100858550 3300031995 Bacteria 919
134 Ga0373955_0018896 3300035172 Bacteria 3436
135 Ga0373924_0035242 3300035410 Bacteria 2029
136 Ga0373931_0349012 3300035691 Bacteria 926
137 Ga0373935_0421865 3300035692 Bacteria 960
138 Ga0373937_0553694 3300036401 Bacteria 1092
139 Ga0373937_1468960 3300036401 Bacteria 629
140 Ga0395900_0293353 3300037418 Bacteria 1614
141 Ga0395898_0197319 3300037466 Bacteria 1922
142 Ga0395901_0271100 3300038443 Bacteria 1765
143 Ga0466972_0093058 3300044658 Bacteria 1429
144 Ga0466963_0013966 3300044694 Bacteria 4946
145 Ga0466968_0201062 3300044735 Bacteria 933
146 Ga0466957_0055018 3300044842 Bacteria 2431
147 Ga0466959_0144234 3300045049 Bacteria 1681
148 Ga0466967_0027164 3300045976 Bacteria 4758
149 Ga0466967_0087185 3300045976 Bacteria 2829
150 Ga0495592_0066877 3300046454 Bacteria 2628
151 Ga0495603_0011302 3300046455 Bacteria 5409
152 Ga0495603_0137184 3300046455 Bacteria 1424
153 Ga0495629_0002502 3300046459 Bacteria 14104
154 Ga0495629_0009638 3300046459 Bacteria 7054
155 Ga0495629_0031676 3300046459 Bacteria 3743
156 Ga0495651_0067009 3300046462 Bacteria 2739
157 Ga0495662_0392778 3300046476 Bacteria 681
158 Ga0495664_0180127 3300046477 Bacteria 1281
159 Ga0495594_0007430 3300046499 Bacteria 5637
160 Ga0495618_0025131 3300046514 Bacteria 3695
161 Ga0495628_0076413 3300046516 Bacteria 2606
162 Ga0495652_0034365 3300046529 Bacteria 4419
163 Ga0495652_0034613 3300046529 Bacteria 4402
164 Ga0495652_0297192 3300046529 Bacteria 1175
165 Ga0495640_0015376 3300046533 Bacteria 5761
166 Ga0495640_0050554 3300046533 Bacteria 2863
167 Ga0495640_0139987 3300046533 Bacteria 1560
168 Ga0495645_0107938 3300046543 Bacteria 1972
169 Ga0495622_0006010 3300046557 Bacteria 5637
170 Ga0495667_0104273 3300046559 Bacteria 1833
171 Ga0495634_0023617 3300046642 Bacteria 4319
172 Ga0495634_0037467 3300046642 Bacteria 3313
173 Ga0495634_0390591 3300046642 Bacteria 828
174 Ga0495635_0020009 3300046663 Bacteria 4664
175 Ga0495635_0095817 3300046663 Bacteria 2028
176 Ga0495661_0421661 3300046665 Bacteria 646
177 Ga0495657_0004507 3300046675 Bacteria 11139
178 Ga0495657_0039667 3300046675 Bacteria 3234
179 Ga0495657_0068033 3300046675 Bacteria 2336
180 Ga0495599_0058092 3300046678 Bacteria 2420
181 Ga0495623_0422216 3300046679 Bacteria 714
182 Ga0495646_0036208 3300046680 Bacteria 3058
183 Ga0495658_0289549 3300046683 Bacteria 1035
184 Ga0495613_0004215 3300046689 Bacteria 10766
185 Ga0495624_0011486 3300046690 Bacteria 6087
186 Ga0495624_0031529 3300046690 Bacteria 3444
187 Ga0495600_0066129 3300046809 Bacteria 2363
188 Ga0495600_0229780 3300046809 Bacteria 1184
189 Ga0495581_0030178 3300047315 Bacteria 3143
190 Ga0495581_0340801 3300047315 Bacteria 875
191 Ga0495604_0003557 3300047317 Bacteria 12433
192 Ga0495604_0022993 3300047317 Bacteria 4974
193 Ga0495604_0183884 3300047317 Bacteria 1460
194 Ga0495676_0001886 3300047321 Bacteria 18381
195 Ga0495676_0021328 3300047321 Bacteria 5661
196 Ga0495680_0111527 3300047322 Bacteria 2026
197 Ga0495675_0040381 3300047444 Bacteria 2973
198 Ga0495602_0111020 3300048088 Bacteria 2227
199 Ga0496101_0058093 3300048904 Bacteria 2800
200 Ga0496102_0201166 3300048905 Bacteria 1878
201 Ga0496105_0017252 3300048908 Bacteria 5783
202 Ga0496112_0096385 3300048915 Bacteria 2928
203 Ga0496113_0371015 3300048916 Bacteria 1149
204 Ga0496115_0103832 3300048918 Bacteria 2332
205 Ga0496120_0003177 3300048923 Bacteria 15298
206 Ga0496121_0076569 3300048924 Bacteria 2667
207 Ga0496125_0115847 3300048928 Bacteria 1926
208 Ga0501031_0017856 3300049568 Bacteria 4614
209 Ga0501031_0653762 3300049568 Bacteria 676
210 Ga0501032_0003551 3300049569 Bacteria 11896
211 Ga0501032_0025989 3300049569 Bacteria 4032
212 Ga0501032_0113647 3300049569 Bacteria 1791
213 Ga0501033_0014144 3300049570 Bacteria 6066
214 Ga0501033_0016148 3300049570 Bacteria 5653
215 Ga0501033_0110655 3300049570 Bacteria 1999
216 Ga0501034_0004610 3300049571 Bacteria 15275
217 Ga0501034_0006003 3300049571 Bacteria 13134
218 Ga0501034_0070210 3300049571 Bacteria 3514
219 Ga0501034_0160462 3300049571 Bacteria 2220
220 Ga0501034_0308268 3300049571 Bacteria 1518
221 Ga0501036_0053658 3300049572 Bacteria 3413
222 Ga0501036_0089720 3300049572 Bacteria 2597
223 Ga0501036_0142827 3300049572 Bacteria 2019
224 Ga0501036_0493181 3300049572 Bacteria 1019
225 Ga0501037_0017291 3300049573 Bacteria 5310
226 Ga0501037_0046673 3300049573 Bacteria 3176
227 Ga0501037_0151255 3300049573 Bacteria 1659
228 Ga0501037_0185592 3300049573 Bacteria 1474
229 Ga0501037_0200540 3300049573 Bacteria 1410
230 Ga0501038_0023554 3300049574 Bacteria 5502
231 Ga0501038_0110868 3300049574 Bacteria 2273
232 Ga0501038_0507827 3300049574 Bacteria 921
233 Ga0501039_0151081 3300049575 Bacteria 1824
234 Ga0501039_0352936 3300049575 Bacteria 1156
235 Ga0501042_0108804 3300049578 Bacteria 1995
236 Ga0501043_0009585 3300049579 Bacteria 7589
237 Ga0501043_0024382 3300049579 Bacteria 4747
238 Ga0501043_0048266 3300049579 Bacteria 3347
239 Ga0501043_0069707 3300049579 Bacteria 2762
240 Ga0501043_0215143 3300049579 Bacteria 1488
241 Ga0501046_0011229 3300049580 Bacteria 7669
242 Ga0501046_0031793 3300049580 Bacteria 4276
243 Ga0501046_0222328 3300049580 Bacteria 1397
244 Ga0501047_0027390 3300049581 Bacteria 5490
245 Ga0501047_0038755 3300049581 Bacteria 4610
246 Ga0501047_0052582 3300049581 Bacteria 3937
247 Ga0501047_0061023 3300049581 Bacteria 3638
248 Ga0501047_0077241 3300049581 Bacteria 3204
249 Ga0501047_0242273 3300049581 Bacteria 1654
250 Ga0501048_0011137 3300049582 Bacteria 6703
251 Ga0501069_0148149 3300049585 Bacteria 1348
252 Ga0501070_0000569 3300049586 Bacteria 33672
253 Ga0501070_0012631 3300049586 Bacteria 7123
254 Ga0501070_0064856 3300049586 Bacteria 3024
255 Ga0501070_0144470 3300049586 Bacteria 1964
256 Ga0501070_0454792 3300049586 Bacteria 1032
257 Ga0501070_0622160 3300049586 Bacteria 859
258 Ga0501073_0014893 3300049589 Bacteria 5643
259 Ga0501073_0077304 3300049589 Bacteria 2316
260 Ga0501073_0119074 3300049589 Bacteria 1830
261 Ga0501076_0930661 3300049592 Bacteria 716
262 Ga0501080_0000134 3300049742 Bacteria 52384
263 Ga0501080_0266351 3300049742 Bacteria 1560
264 Ga0501080_0517500 3300049742 Bacteria 1065
265 Ga0501083_0018646 3300049744 Bacteria 4835
266 Ga0501035_0015489 3300049822 Bacteria 7034
267 Ga0501035_0020195 3300049822 Bacteria 6117
268 Ga0501035_0072246 3300049822 Bacteria 3054
269 Ga0501035_0081438 3300049822 Bacteria 2857
270 Ga0501035_0110426 3300049822 Bacteria 2410
271 Ga0501035_0126546 3300049822 Bacteria 2230
272 Ga0501035_0284600 3300049822 Bacteria 1396
273 Ga0501035_0542266 3300049822 Bacteria 953
274 Ga0501044_0017479 3300049823 Bacteria 7697
275 Ga0501044_0022498 3300049823 Bacteria 6716
276 Ga0501044_0060280 3300049823 Bacteria 3885
277 Ga0501044_0127953 3300049823 Bacteria 2536
278 Ga0501044_0205265 3300049823 Bacteria 1927
279 Ga0501044_0271440 3300049823 Bacteria 1631
280 Ga0501044_0279152 3300049823 Bacteria 1604
281 Ga0501045_0013294 3300049824 Bacteria 5811
282 nmdc:mga0n895_32050_c1 3300050512 Bacteria 5040
283 nmdc:mga0rr50_109597_c1 3300050513 Bacteria 2183
284 nmdc:mga0a205_143565_c1 3300050515 Bacteria 1424
285 Ga0495601_0430951 3300053077 Bacteria 853
286 Ga0500610_0091107 3300053079 Bacteria 1584
287 Ga0500635_0021452 3300053080 Bacteria 1990
288 Ga0495619_0105005 3300053085 Bacteria 1926
289 Ga0500578_0270697 3300053086 Bacteria 1016
290 Ga0500651_0000155 3300053093 Bacteria 43944
291 Ga0500651_0173345 3300053093 Bacteria 1284
292 Ga0500569_022899 3300053109 Bacteria 1671
293 Ga0500595_002551 3300053119 Bacteria 8923
294 Ga0500597_321827 3300053120 Bacteria 611
295 Ga0500655_024254 3300053133 Bacteria 1147
296 Ga0500658_0167108 3300053134 Bacteria 998
297 Ga0500590_033670 3300053148 Bacteria 2655
298 Ga0500609_001501 3300053731 Bacteria 3412
299 Ga0501084_0638024 3300054114 Bacteria 899
300 Ga0590071_023902 3300059421 Bacteria 1447
301 Ga0590074_001200 3300059423 Bacteria 4090
302 Ga0590077_019475 3300059426 Bacteria 1438
303 2513701522 2513237102 Bacteria 7703324
304 2644279678 2643221649 Bacteria 3867359
305 2808842562 2808606359 Bacteria 9866990
306 2819586161 2818991444 Bacteria 6968812
307 2842040705 2842038055 Bacteria 8002051
308 2842046349 2842045827 Bacteria 8006841
309 2844320083 2844315083 Bacteria 8138177
310 2857512721 2857509624 Bacteria 7472071
311 2873155256 2873151551 Bacteria 8625867
312 2874614516 2874612657 Bacteria 8252029
313 2874628133 2874620515 Bacteria 8290088
314 2881371408 2881364244 Bacteria 7710352
315 2903730243 2903727486 Bacteria 8281579
316 2904674249 2904666416 Bacteria 8226587
317 2906609908 2906602504 Bacteria 8295279
318 2906627649 2906626472 Bacteria 8826946
319 2922361897 2922361189 Bacteria 7436256
320 3005600369 3005594810 Bacteria 8716512
321 3005723218 3005718088 Bacteria 8283608
322 8016594411 8016583857 Bacteria 10421953
323 Ga0501033_0034031
324 JGI25406J46586_10010316
325 JGI25153J46596_10002250
326 JGI25407J50210_10044079
327 Ga0006562J51391_1035107
328 Ga0006562J51391_1035108
329 Ga0006562J51391_1053710
330 Ga0006562J51391_1053712
331 JGI25404J52841_10014617
332 JGI25404J52841_10016292
333 Ga0055542_1004155
334 Ga0065165_1010203
335 Ga0070658_10044576
336 Ga0070658_10131800
337 Ga0070683_100130044
338 Ga0070680_100215167
339 Ga0068868_100051666
340 Ga0070660_100027328
341 Ga0070659_100000749
342 Ga0070659_100107474
343 Ga0070667_100109359
344 Ga0070709_10028748
345 Ga0070710_10087789
346 Ga0070711_100141936
347 Ga0070679_100115818
348 Ga0070684_100289558
349 Ga0068853_100007366
350 Ga0068853_100022507
351 Ga0068855_100005961
352 Ga0068855_100010153
353 Ga0068855_100078793
354 Ga0068857_100013829
355 Ga0068856_100132918
356 Ga0068856_100224594
357 Ga0068852_100014526
358 Ga0068852_100188304
359 Ga0068852_100653962
360 Ga0068859_100386412
361 Ga0081455_10032257
362 Ga0081538_10006496
363 Ga0081538_10040819
364 Ga0081540_1077265
365 Ga0075365_10149580
366 Ga0070712_100074012
367 Ga0075433_10806350
368 Ga0075434_100041320
369 Ga0097620_100386429
370 Ga0099825_1030158
371 Ga0099824_1044082
372 Ga0099822_1064873
373 Ga0105240_10344676
374 Ga0105240_10429397
375 Ga0105240_10944942
376 Ga0105240_11228978
377 Ga0105245_10110539
378 Ga0105245_10711282
379 Ga0105241_10247497
380 Ga0105248_10029944
381 Ga0105237_10006335
382 Ga0105237_10037729
383 Ga0105237_10132272
384 Ga0105237_10157464
385 Ga0105238_10206708
386 Ga0105238_10521045
387 Ga0105239_10085743
388 Ga0105239_10767596
389 Ga0105239_11376244
390 Ga0157342_1053513
391 Ga0157371_10506756
392 Ga0157370_10580659
393 Ga0209148_1000347
394 Ga0209148_1021005
395 Ga0209233_1004474
396 Ga0209455_1005515
397 Ga0209564_1019790
398 Ga0209758_1129325
399 Ga0209256_1009928
400 Ga0207692_10160129
401 Ga0207685_10136554
402 Ga0207699_10022841
403 Ga0207654_10085803
404 Ga0207695_10000008
405 Ga0207695_10003698
406 Ga0207695_10023793
407 Ga0207695_10475986
408 Ga0207671_10004779
409 Ga0207671_10008416
410 Ga0207671_10070154
411 Ga0207671_10135608
412 Ga0207671_10285785
413 Ga0207693_10025498
414 Ga0207663_10038528
415 Ga0207660_10062821
416 Ga0207657_10018714
417 Ga0207652_10004961
418 Ga0207694_10054762
419 Ga0207694_10087958
420 Ga0207694_10100084
421 Ga0207687_10120152
422 Ga0207687_10311490
423 Ga0207690_10041728
424 Ga0207690_10632437
425 Ga0207711_10146421
426 Ga0207667_10001482
427 Ga0207667_10016171
428 Ga0207667_10066698
429 Ga0207667_10076852
430 Ga0207658_10338909
431 Ga0207658_10624820
432 Ga0207639_10026731
433 Ga0207639_10104223
434 Ga0207639_10286598
435 Ga0207702_10055677
436 Ga0207702_10070252
437 Ga0207702_10153925
438 Ga0207702_10527962
439 Ga0207676_10019085
440 Ga0207674_10035982
441 Ga0207698_10000078
442 Ga0207698_10060282
443 Ga0207698_10160041
444 Ga0207698_10863195
445 Ga0209389_1000014
446 Ga0209589_1000020
447 Ga0209489_100060
448 Ga0307512_10091797
449 Ga0265328_10016262
450 Ga0265331_10051237
451 Ga0265316_10150244
452 Ga0307509_10145683
453 Ga0265313_10024626
454 Ga0307508_10003658
455 Ga0307409_100858550
456 Ga0373955_0018896
457 Ga0373924_0035242
458 Ga0373931_0349012
459 Ga0373935_0421865
460 Ga0373937_0553694
461 Ga0373937_1468960
462 Ga0395900_0293353
463 Ga0395898_0197319
464 Ga0395901_0271100
465 Ga0466972_0093058
466 Ga0466963_0013966
467 Ga0466968_0201062
468 Ga0466957_0055018
469 Ga0466959_0144234
470 Ga0466967_0027164
471 Ga0466967_0087185
472 Ga0495592_0066877
473 Ga0495603_0011302
474 Ga0495603_0137184
475 Ga0495629_0002502
476 Ga0495629_0009638
477 Ga0495629_0031676
478 Ga0495651_0067009
479 Ga0495662_0392778
480 Ga0495664_0180127
481 Ga0495594_0007430
482 Ga0495618_0025131
483 Ga0495628_0076413
484 Ga0495652_0034365
485 Ga0495652_0034613
486 Ga0495652_0297192
487 Ga0495640_0015376
488 Ga0495640_0050554
489 Ga0495640_0139987
490 Ga0495645_0107938
491 Ga0495622_0006010
492 Ga0495667_0104273
493 Ga0495634_0023617
494 Ga0495634_0037467
495 Ga0495634_0390591
496 Ga0495635_0020009
497 Ga0495635_0095817
498 Ga0495661_0421661
499 Ga0495657_0004507
500 Ga0495657_0039667
501 Ga0495657_0068033
502 Ga0495599_0058092
503 Ga0495623_0422216
504 Ga0495646_0036208
505 Ga0495658_0289549
506 Ga0495613_0004215
507 Ga0495624_0011486
508 Ga0495624_0031529
509 Ga0495600_0066129
510 Ga0495600_0229780
511 Ga0495581_0030178
512 Ga0495581_0340801
513 Ga0495604_0003557
514 Ga0495604_0022993
515 Ga0495604_0183884
516 Ga0495676_0001886
517 Ga0495676_0021328
518 Ga0495680_0111527
519 Ga0495675_0040381
520 Ga0495602_0111020
521 Ga0496101_0058093
522 Ga0496102_0201166
523 Ga0496105_0017252
524 Ga0496112_0096385
525 Ga0496113_0371015
526 Ga0496115_0103832
527 Ga0496120_0003177
528 Ga0496121_0076569
529 Ga0496125_0115847
530 Ga0501031_0017856
531 Ga0501031_0653762
532 Ga0501032_0003551
533 Ga0501032_0025989
534 Ga0501032_0113647
535 Ga0501033_0014144
536 Ga0501033_0016148
537 Ga0501033_0110655
538 Ga0501034_0004610
539 Ga0501034_0006003
540 Ga0501034_0070210
541 Ga0501034_0160462
542 Ga0501034_0308268
543 Ga0501036_0053658
544 Ga0501036_0089720
545 Ga0501036_0142827
546 Ga0501036_0493181
547 Ga0501037_0017291
548 Ga0501037_0046673
549 Ga0501037_0151255
550 Ga0501037_0185592
551 Ga0501037_0200540
552 Ga0501038_0023554
553 Ga0501038_0110868
554 Ga0501038_0507827
555 Ga0501039_0151081
556 Ga0501039_0352936
557 Ga0501042_0108804
558 Ga0501043_0009585
559 Ga0501043_0024382
560 Ga0501043_0048266
561 Ga0501043_0069707
562 Ga0501043_0215143
563 Ga0501046_0011229
564 Ga0501046_0031793
565 Ga0501046_0222328
566 Ga0501047_0027390
567 Ga0501047_0038755
568 Ga0501047_0052582
569 Ga0501047_0061023
570 Ga0501047_0077241
571 Ga0501047_0242273
572 Ga0501048_0011137
573 Ga0501069_0148149
574 Ga0501070_0000569
575 Ga0501070_0012631
576 Ga0501070_0064856
577 Ga0501070_0144470
578 Ga0501070_0454792
579 Ga0501070_0622160
580 Ga0501073_0014893
581 Ga0501073_0077304
582 Ga0501073_0119074
583 Ga0501076_0930661
584 Ga0501080_0000134
585 Ga0501080_0266351
586 Ga0501080_0517500
587 Ga0501083_0018646
588 Ga0501035_0015489
589 Ga0501035_0020195
590 Ga0501035_0072246
591 Ga0501035_0081438
592 Ga0501035_0110426
593 Ga0501035_0126546
594 Ga0501035_0284600
595 Ga0501035_0542266
596 Ga0501044_0017479
597 Ga0501044_0022498
598 Ga0501044_0060280
599 Ga0501044_0127953
600 Ga0501044_0205265
601 Ga0501044_0271440
602 Ga0501044_0279152
603 Ga0501045_0013294
604 nmdc:mga0n895_32050_c1
605 nmdc:mga0rr50_109597_c1
606 nmdc:mga0a205_143565_c1
607 Ga0495601_0430951
608 Ga0500610_0091107
609 Ga0500635_0021452
610 Ga0495619_0105005
611 Ga0500578_0270697
612 Ga0500651_0000155
613 Ga0500651_0173345
614 Ga0500569_022899
615 Ga0500595_002551
616 Ga0500597_321827
617 Ga0500655_024254
618 Ga0500658_0167108
619 Ga0500590_033670
620 Ga0500609_001501
621 Ga0501084_0638024
622 Ga0590071_023902
623 Ga0590074_001200
624 Ga0590077_019475
625 2513701522
626 2644279678
627 2808842562
628 2819586161
629 2842040705
630 2842046349
631 2844320083
632 2857512721
633 2873155256
634 2874614516
635 2874628133
636 2881371408
637 2903730243
638 2904674249
639 2906609908
640 2906627649
641 2922361897
642 3005600369
643 3005723218
644 8016594411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23451

146

198

0.91

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

33

118

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.8919 6 105
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8478 11 105
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.8376 6 105
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8221 11 99
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.817 11 105
ID Description Score Start End Superfamily
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9344 12 105 3.30.300.130
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8982 12 105 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8657 21 105 3.30.300.130
af_O53157_4_110_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8622 5 105 3.30.300.130
af_Q1G391_89_370_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8619 136 164 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A257S6A0-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9735 125 167
AF-A0A4R4MCF4-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9459 15 118
AF-A0A0A0D1F0-F1-model_v4 Phenylacetate-CoA oxygenase 0.944 11 84
AF-A0A2E0SYA7-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9421 15 101
AF-A0A7Y1V914-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9367 13 113

Map