F406689

General Info

Members Datasets Scaffolds Average Seq Length
322 260 137 360

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2511231119|2511697972
Length 388
Sequence VYSEFVGSDSLLKKCYLKGGGGMLKRIVQAFFIIVGGVVGIFLIPELFVLSNIQDIPLITNAYTSAAIGAIIFFLISIWTTEYVINWVKWIEDSLLRAPVPDLLFGSLGLVFGLIIAYLIVNVIPLDNIPYRIFSTIIPVFLAFFLGYLGFQVGFKKKDELISLFSISARMQKKKGSADEEQEEQDKRLKILDTSVIIDGRIADICQTGFLEGVIVIPQFVLEELQHIADSSDVLKRNRGRRGLDILNRIQKELDITVEIYEGDFEDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQKVAVLNINDLANAVKPVVLPGEEMNVQVIKDGKEHNQGVAYLDDGTMIVVEEGRNYIGKHIDVLVTSVLQTAAGRMIFAKPKLLEKAL

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
3 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
4 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
5 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
6 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
7 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
8 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
9 2554235283 Bacillus safensis VK Isolate Rhizosphere
10 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
11 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
12 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
13 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
14 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
15 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
16 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
17 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
18 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
19 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
20 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
21 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
22 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
23 2643221729 Bacillus sp. Root11 Isolate Unclassified
24 2643221730 Bacillus sp. Root131 Isolate Unclassified
25 2643221731 Bacillus sp. Root147 Isolate Unclassified
26 2643221732 Bacillus sp. Root239 Isolate Unclassified
27 2643221735 Bacillus sp. Root920 Isolate Unclassified
28 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
29 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
30 2671180694 Paenibacillus sp. A3 Isolate Unclassified
31 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
32 2684622632 Bacillus cereus 905 Isolate Unclassified
33 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
34 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
35 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
36 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
37 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
38 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
39 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
40 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
41 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
42 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
43 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
44 2738541295 Bacillus sp. OK085 Isolate Unclassified
45 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
46 2738541358 Bacillus sp. OV752 Isolate Unclassified
47 2738543006 Bacillus sp. OK077 Isolate Unclassified
48 2738543010 Bacillus sp. YR335 Isolate Unclassified
49 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
50 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
51 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
52 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
53 2802429420 Priestia filamentosa HL2HP6 Isolate Unclassified
54 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
55 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
56 2811994870 Bacillus sp. JB4 Isolate Unclassified
57 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
58 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
59 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
60 2818991441 Niallia circulans 3243 Isolate Rhizosphere
61 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
62 2818991459 Paenibacillus sp. 597 Isolate Unclassified
63 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
64 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
65 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
66 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
67 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
68 2842682962 Bacillus sp. R-72492 Isolate Unclassified
69 2842882022 Bacillus sp. R-71893 Isolate Unclassified
70 2849139964 Bacillus sp. R-71875 Isolate Unclassified
71 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
72 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
73 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
74 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
75 2857581216 Bacillus sp. R-71922 Isolate Unclassified
76 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
77 2860837431 Bacillus sp. WR11 Isolate Unclassified
78 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
79 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
80 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
81 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
82 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
83 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
84 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
85 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
86 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
87 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
88 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
89 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
90 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
91 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
92 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
93 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
94 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
95 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
96 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
97 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
98 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
99 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
100 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
101 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
102 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
103 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
104 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
105 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
106 2919720352 Priestia megaterium 4340 Isolate Unclassified
107 2919726948 Bacillus pumilus 4489 Isolate Unclassified
108 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
109 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
110 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
111 2929004312 Priestia megaterium 1104 Isolate Unclassified
112 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
113 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
114 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
115 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
116 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
117 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
118 2938917290 Bacillus sp. CR71 Isolate Unclassified
119 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
120 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
121 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
122 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
123 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
124 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
125 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
126 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
127 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
128 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
129 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
130 2965761152 Bacillus sp. COPE52 Isolate Unclassified
131 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
132 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
133 2969141011 Bacillus velezensis MH25 Isolate Unclassified
134 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
135 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
136 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
137 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
138 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
139 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
140 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
141 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
142 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
143 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
144 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
145 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
146 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
147 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
148 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
149 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
150 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
151 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
152 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
153 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
154 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
155 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
156 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
157 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
158 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
159 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
160 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
161 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
162 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
163 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
164 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
165 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
166 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
167 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
168 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
169 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
170 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
171 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
172 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
173 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
174 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
178 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
189 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
195 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
237 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
238 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
240 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
241 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
242 8022653035 Bacillus sp. Rc4 Isolate Unclassified
243 8022792930 Bacillus sp. Xin Isolate Rhizosphere
244 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
245 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
246 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
247 8023438354 Bacillus sp. BH2 Isolate Unclassified
248 8023444577 Bacillus sp. BH32 Isolate Unclassified
249 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
250 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
251 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
252 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
253 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
254 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
255 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
256 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
257 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
258 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
259 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
260 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 33.85
Metatranscriptomes 8.7
Isolates 57.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.39
Nodule 0.62
Rhizoplane 1.86
Rhizosphere 51.24
Stem 0
Stem Tuber 0
Unclassified 37.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1003590 3300002987 Bacteria 5422
2 JGI25151J46595_10001136 3300003187 Bacteria 19348
3 JGI25151J46595_10005125 3300003187 Bacteria 6799
4 JGI25151J46595_10022575 3300003187 Bacteria 2609
5 JGI25151J46595_10061220 3300003187 Bacteria 1199
6 Ga0006562J51391_1000677 3300003578 Bacteria 45519
7 Ga0006562J51391_1010897 3300003578 Bacteria 2208
8 Ga0006562J51391_1013051 3300003578 Bacteria 1344
9 Ga0006562J51391_1014331 3300003578 Bacteria 1822
10 Ga0055535_1002867 3300003761 Bacteria 5411
11 Ga0058692_1011499 3300003856 Bacteria 2137
12 Ga0065704_10172749 3300005289 Bacteria 1282
13 Ga0105251_10013724 3300009011 Bacteria 4515
14 Ga0105251_10019992 3300009011 Bacteria 3524
15 Ga0105244_10010829 3300009036 Bacteria 5506
16 Ga0105244_10103843 3300009036 Bacteria 1388
17 Ga0105250_10000941 3300009092 Bacteria 17119
18 Ga0105250_10011530 3300009092 Bacteria 3665
19 Ga0105250_10020929 3300009092 Bacteria 2641
20 Ga0105246_10000975 3300011119 Bacteria 16403
21 Ga0105246_10017967 3300011119 Bacteria 4503
22 Ga0209784_101851 3300025224 Bacteria 2457
23 Ga0209566_100588 3300025225 Bacteria 23106
24 Ga0209147_100210 3300025229 Bacteria 62804
25 Ga0209147_102218 3300025229 Bacteria 5197
26 Ga0209437_100331 3300025233 Bacteria 58796
27 Ga0209258_101019 3300025242 Bacteria 12680
28 Ga0209130_1002183 3300025284 Bacteria 10312
29 Ga0209130_1003618 3300025284 Bacteria 6419
30 Ga0209130_1003743 3300025284 Bacteria 6216
31 Ga0209130_1014351 3300025284 Bacteria 1993
32 Ga0209675_1011066 3300025291 Bacteria 3018
33 Ga0209025_1000639 3300025294 Bacteria 61845
34 Ga0209025_1002839 3300025294 Bacteria 17380
35 Ga0209025_1003050 3300025294 Bacteria 16506
36 Ga0209025_1003499 3300025294 Bacteria 14770
37 Ga0209025_1004078 3300025294 Bacteria 13033
38 Ga0209025_1005357 3300025294 Bacteria 10510
39 Ga0209025_1009747 3300025294 Bacteria 6632
40 Ga0209025_1012895 3300025294 Bacteria 5313
41 Ga0209025_1025999 3300025294 Bacteria 2955
42 Ga0209025_1028077 3300025294 Bacteria 2769
43 Ga0207696_1000889 3300025711 Bacteria 18596
44 Ga0207696_1012406 3300025711 Bacteria 3013
45 Ga0207655_1002102 3300025728 Bacteria 16693
46 Ga0207713_1006809 3300025735 Bacteria 6894
47 Ga0207713_1012053 3300025735 Bacteria 4652
48 Ga0207681_10037899 3300025923 Bacteria 3190
49 Ga0209371_1002491 3300027312 Bacteria 10225
50 Ga0209974_10031033 3300027876 Bacteria 1769
51 Ga0237817_10220 3300030083 Bacteria 14618
52 Ga0237817_10407 3300030083 Bacteria 7120
53 Ga0268256_1002217 3300030500 Bacteria 10226
54 Ga0307408_100220113 3300031548 Bacteria 1548
55 Ga0307405_10251444 3300031731 Bacteria 1315
56 Ga0307409_100237337 3300031995 Bacteria 1657
57 Ga0307416_100034970 3300032002 Bacteria 3831
58 Ga0237819_00656 3300038705 Bacteria 11222
59 Ga0439439_0003035 3300041406 Bacteria 3655
60 Ga0439449_0000208 3300042007 Bacteria 20706
61 Ga0439462_0000024 3300042015 Bacteria 23158
62 Ga0466969_0002123 3300044656 Bacteria 10577
63 Ga0466968_0008646 3300044735 Bacteria 3902
64 Ga0466959_0017919 3300045049 Bacteria 5195
65 Ga0466967_0000664 3300045976 Bacteria 17351
66 Ga0495605_0059266 3300046474 Bacteria 1839
67 Ga0495620_0060838 3300046515 Bacteria 1573
68 Ga0495661_0114935 3300046665 Bacteria 1495
69 Ga0495649_0017739 3300046694 Bacteria 4015
70 Ga0495660_0009598 3300046810 Bacteria 5642
71 Ga0495676_0119751 3300047321 Bacteria 1917
72 Ga0495626_0063012 3300048091 Bacteria 1683
73 Ga0496110_0006311 3300048913 Bacteria 9362
74 Ga0496110_0028847 3300048913 Bacteria 4770
75 Ga0496110_0039387 3300048913 Bacteria 4114
76 Ga0496111_0064645 3300048914 Bacteria 2654
77 Ga0496113_0058430 3300048916 Bacteria 2902
78 Ga0496116_0002747 3300048919 Bacteria 18082
79 Ga0496116_0005716 3300048919 Bacteria 11441
80 Ga0496116_0016812 3300048919 Bacteria 5708
81 Ga0496116_0040049 3300048919 Bacteria 3231
82 Ga0496116_0056053 3300048919 Bacteria 2585
83 Ga0496116_0068124 3300048919 Bacteria 2269
84 Ga0496117_0014604 3300048920 Bacteria 6755
85 Ga0496117_0036071 3300048920 Bacteria 3704
86 Ga0496118_0036829 3300048921 Bacteria 3948
87 Ga0496119_0000469 3300048922 Bacteria 54992
88 Ga0496119_0083666 3300048922 Bacteria 1831
89 Ga0496120_0003045 3300048923 Bacteria 15808
90 Ga0496120_0008977 3300048923 Bacteria 7151
91 Ga0496121_0023803 3300048924 Bacteria 5880
92 Ga0496121_0054574 3300048924 Bacteria 3337
93 Ga0496122_0015557 3300048925 Bacteria 7263
94 Ga0496122_0024433 3300048925 Bacteria 5287
95 Ga0496122_0090695 3300048925 Bacteria 2084
96 Ga0496122_0093373 3300048925 Bacteria 2041
97 Ga0496123_0010827 3300048926 Bacteria 7999
98 Ga0496123_0013838 3300048926 Bacteria 6732
99 Ga0496124_0000697 3300048927 Bacteria 55040
100 Ga0496124_0001169 3300048927 Bacteria 41092
101 Ga0496124_0023792 3300048927 Bacteria 5583
102 Ga0496124_0044647 3300048927 Bacteria 3801
103 Ga0496125_0004005 3300048928 Bacteria 17323
104 Ga0496125_0004147 3300048928 Bacteria 16901
105 Ga0496125_0035075 3300048928 Bacteria 4409
106 Ga0496125_0053536 3300048928 Bacteria 3307
107 Ga0496126_0005326 3300048929 Bacteria 14745
108 Ga0496126_0011703 3300048929 Bacteria 9045
109 Ga0496126_0041177 3300048929 Bacteria 4277
110 Ga0501341_00531 3300049131 Bacteria 1640
111 Ga0501343_000127 3300049132 Bacteria 3539
112 Ga0501344_00244 3300049133 Bacteria 2071
113 Ga0501305_000492 3300049161 Bacteria 3258
114 Ga0501305_003231 3300049161 Bacteria 1832
115 Ga0501305_003986 3300049161 Bacteria 1707
116 Ga0501312_000015 3300049528 Bacteria 9271
117 Ga0501312_001602 3300049528 Bacteria 2264
118 Ga0501312_002607 3300049528 Bacteria 1962
119 Ga0501312_007476 3300049528 Bacteria 1392
120 Ga0501316_006408 3300049532 Bacteria 1252
121 Ga0501317_000150 3300049533 Bacteria 3930
122 Ga0501317_001164 3300049533 Bacteria 2186
123 Ga0501321_001323 3300049537 Bacteria 1945
124 Ga0501331_01128 3300049547 Bacteria 1251
125 Ga0501332_01123 3300049548 Bacteria 1349
126 Ga0501332_01599 3300049548 Bacteria 1202
127 Ga0501333_000455 3300049549 Bacteria 1872
128 Ga0501333_001470 3300049549 Bacteria 1279
129 Ga0501334_00168 3300049550 Bacteria 2500
130 Ga0501334_00909 3300049550 Bacteria 1528
131 Ga0501335_001519 3300049551 Bacteria 1788
132 Ga0501335_003218 3300049551 Bacteria 1374
133 Ga0501217_002513 3300049661 Bacteria 3619
134 Ga0501217_005651 3300049661 Bacteria 2623
135 Ga0501217_005865 3300049661 Bacteria 2584
136 Ga0501233_005026 3300049668 Bacteria 2447
137 Ga0587067_003990 3300059640 Bacteria 1886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049537 Ga0501321_001323 Ga0501321_001323_919_1935 318
2 3300049550 Ga0501334_00909 Ga0501334_00909_502_1518 318
3 3300025291 Ga0209675_1011066 Ga0209675_10110661 319
4 3300048916 Ga0496113_0058430 Ga0496113_0058430_10_1008 322
5 3300048919 Ga0496116_0068124 Ga0496116_0068124_657_1745 330
6 3300049131 Ga0501341_00531 Ga0501341_00531_554_1606 330
7 3300049548 Ga0501332_01599 Ga0501332_01599_116_1168 330
8 3300044656 Ga0466969_0002123 Ga0466969_0002123_151_1266 331
9 3300044735 Ga0466968_0008646 Ga0466968_0008646_1543_2658 331
10 3300045049 Ga0466959_0017919 Ga0466959_0017919_2647_3762 331
11 iso_pu_bacteria 2929206907 2929211912 332
12 3300059640 Ga0587067_003990 Ga0587067_003990_104_1168 335
13 3300025224 Ga0209784_101851 Ga0209784_1018512 336
14 3300048913 Ga0496110_0006311 Ga0496110_0006311_5877_6932 337
15 3300003578 Ga0006562J51391_1010897 Ga0006562J51391_10108972 338
16 iso_pu_bacteria 8055632911 8055634049 338
17 3300041406 Ga0439439_0003035 Ga0439439_0003035_396_1463 339
18 3300042007 Ga0439449_0000208 Ga0439449_0000208_8059_9126 339
19 3300042015 Ga0439462_0000024 Ga0439462_0000024_20147_21214 339
20 iso_pu_bacteria 2585428059 2587744103 339
21 iso_pu_bacteria 2643221676 2644424523 339
22 iso_pu_bacteria 2971410472 2971410898 339
23 iso_pu_bacteria 8056533031 8056535639 339
24 3300025225 Ga0209566_100588 Ga0209566_10058820 340
25 3300048927 Ga0496124_0023792 Ga0496124_0023792_3471_4610 340
26 3300048928 Ga0496125_0053536 Ga0496125_0053536_1479_2618 340
27 iso_pu_bacteria 2818991459 2819676070 340
28 iso_pu_bacteria 2857453340 2857460073 340
29 iso_pu_bacteria 2904755435 2904755703 340
30 iso_pu_bacteria 2919425241 2919432382 340
31 iso_pu_bacteria 2671180330 2672333558 341
32 iso_pu_bacteria 2857581216 2857586514 341
33 iso_pu_bacteria 2980182181 2980186786 341
34 3300049133 Ga0501344_00244 Ga0501344_00244_115_1224 342
35 3300049161 Ga0501305_003986 Ga0501305_003986_15_1103 342
36 3300049528 Ga0501312_002607 Ga0501312_002607_828_1937 342
37 3300049533 Ga0501317_001164 Ga0501317_001164_969_2078 342
38 3300049547 Ga0501331_01128 Ga0501331_01128_106_1215 342
39 3300049549 Ga0501333_000455 Ga0501333_000455_684_1793 342
40 3300049551 Ga0501335_001519 Ga0501335_001519_591_1700 342
41 3300049661 Ga0501217_005651 Ga0501217_005651_771_1886 343
42 iso_pu_bacteria 2818991441 2819571000 343
43 iso_pu_bacteria 2524023129 2524189968 344
44 iso_pu_bacteria 2643221543 2643738812 344
45 iso_pu_bacteria 2721755693 2723606224 344
46 iso_pu_bacteria 2728369359 2730136847 344
47 iso_pu_bacteria 2738541299 2738838965 344
48 iso_pu_bacteria 2751185905 2753813110 344
49 iso_pu_bacteria 2791355222 2793182104 344
50 iso_pu_bacteria 2802428803 2802440694 344
51 iso_pu_bacteria 2821111986 2821118291 344
52 iso_pu_bacteria 2864733723 2864738901 344
53 iso_pu_bacteria 2885526491 2885529945 344
54 iso_pu_bacteria 2889042446 2889048039 344
55 iso_pu_bacteria 2889276214 2889276777 344
56 iso_pu_bacteria 2904162308 2904168124 344
57 iso_pu_bacteria 2904490793 2904496979 344
58 iso_pu_bacteria 2904595352 2904600750 344
59 iso_pu_bacteria 2919160200 2919166218 344
60 iso_pu_bacteria 2925326138 2925332808 344
61 iso_pu_bacteria 2931384279 2931385145 344
62 iso_pu_bacteria 2939679117 2939685093 344
63 iso_pu_bacteria 2945991243 2945996231 344
64 iso_pu_bacteria 2996706504 2996707515 344
65 iso_pu_bacteria 648028048 648172219 344
66 iso_pu_bacteria 8057473075 8057473415 344
67 iso_pu_bacteria 8057733483 8057735173 344
68 iso_pu_bacteria 2510917027 2511180904 345
69 iso_pu_bacteria 2512564013 2512635710 345
70 iso_pu_bacteria 2571042143 2571530840 345
71 iso_pu_bacteria 2571042588 2573039787 345
72 iso_pu_bacteria 2576861424 2578338915 345
73 iso_pu_bacteria 2579778775 2580932103 345
74 iso_pu_bacteria 2600255286 2601641721 345
75 iso_pu_bacteria 2619619294 2621273327 345
76 iso_pu_bacteria 2728368933 2728529859 345
77 iso_pu_bacteria 2816332295 2817478161 345
78 iso_pu_bacteria 2857465823 2857472320 345
79 iso_pu_bacteria 2857591370 2857597814 345
80 iso_pu_bacteria 2881636855 2881639840 345
81 iso_pu_bacteria 2915597211 2915598671 345
82 iso_pu_bacteria 2915606848 2915609966 345
83 iso_pu_bacteria 2929183550 2929183818 345
84 iso_pu_bacteria 2938649242 2938653421 345
85 iso_pu_bacteria 2939702853 2939707572 345
86 iso_pu_bacteria 2968558590 2968562398 345
87 iso_pu_bacteria 2971403814 2971406722 345
88 iso_pu_bacteria 2971511577 2971513759 345
89 iso_pu_bacteria 2980176882 2980179412 345
90 iso_pu_bacteria 2988225383 2988229905 345
91 iso_pu_bacteria 2996632988 2996636908 345
92 iso_pu_bacteria 3006858327 3006858488 345
93 iso_pu_bacteria 8054465665 8054471344 345
94 iso_pu_bacteria 8054795415 8054802025 345
95 3300025294 Ga0209025_1003050 Ga0209025_100305010 346
96 3300049549 Ga0501333_001470 Ga0501333_001470_14_1093 346
97 iso_pu_bacteria 2512564039 2512736556 346
98 iso_pu_bacteria 2593339198 2595320903 346
99 iso_pu_bacteria 2671180694 2673821692 346
100 iso_pu_bacteria 2744054657 2745170143 346
101 iso_pu_bacteria 2816332336 2817616425 346
102 iso_pu_bacteria 2831905167 2831907815 346
103 iso_pu_bacteria 2857460504 2857464306 346
104 iso_pu_bacteria 2864997549 2865001992 346
105 iso_pu_bacteria 2889295896 2889298975 346
106 iso_pu_bacteria 2898907183 2898908914 346
107 iso_pu_bacteria 2980125574 2980128544 346
108 iso_pu_bacteria 2981284811 2981289490 346
109 iso_pu_bacteria 2981289755 2981294490 346
110 iso_pu_bacteria 2981980479 2981985146 346
111 iso_pu_bacteria 2981985349 2981990077 346
112 iso_pu_bacteria 3006978542 3006980059 346
113 iso_pu_bacteria 8057632132 8057632252 346
114 3300046515 Ga0495620_0060838 Ga0495620_0060838_86_1183 347
115 iso_pu_bacteria 2738541295 2738817073 347
116 iso_pu_bacteria 2816332186 2816866410 347
117 iso_pu_bacteria 2842682962 2842688243 347
118 iso_pu_bacteria 2849139964 2849144937 347
119 iso_pu_bacteria 2964375228 2964375255 347
120 3300003578 Ga0006562J51391_1013051 Ga0006562J51391_10130511 348
121 3300003761 Ga0055535_1002867 Ga0055535_10028675 348
122 3300009036 Ga0105244_10103843 Ga0105244_101038431 348
123 3300011119 Ga0105246_10017967 Ga0105246_100179675 348
124 3300025233 Ga0209437_100331 Ga0209437_10033165 348
125 3300025242 Ga0209258_101019 Ga0209258_1010195 348
126 3300025294 Ga0209025_1025999 Ga0209025_10259993 348
127 3300048919 Ga0496116_0002747 Ga0496116_0002747_6047_7156 348
128 3300048919 Ga0496116_0016812 Ga0496116_0016812_2427_3593 348
129 3300048919 Ga0496116_0056053 Ga0496116_0056053_178_1263 348
130 3300048920 Ga0496117_0036071 Ga0496117_0036071_864_1949 348
131 3300048921 Ga0496118_0036829 Ga0496118_0036829_1109_2194 348
132 3300048922 Ga0496119_0083666 Ga0496119_0083666_584_1669 348
133 3300048923 Ga0496120_0008977 Ga0496120_0008977_3246_4331 348
134 3300048924 Ga0496121_0023803 Ga0496121_0023803_1924_3009 348
135 3300048924 Ga0496121_0054574 Ga0496121_0054574_898_2118 348
136 3300048925 Ga0496122_0024433 Ga0496122_0024433_3680_4774 348
137 3300048925 Ga0496122_0090695 Ga0496122_0090695_919_2028 348
138 3300048925 Ga0496122_0093373 Ga0496122_0093373_73_1158 348
139 3300048926 Ga0496123_0010827 Ga0496123_0010827_6078_7172 348
140 3300048926 Ga0496123_0013838 Ga0496123_0013838_612_1697 348
141 3300048927 Ga0496124_0001169 Ga0496124_0001169_2754_3848 348
142 3300048927 Ga0496124_0044647 Ga0496124_0044647_2603_3712 348
143 3300048928 Ga0496125_0004005 Ga0496125_0004005_1827_2921 348
144 3300048928 Ga0496125_0004147 Ga0496125_0004147_10466_11551 348
145 3300048928 Ga0496125_0035075 Ga0496125_0035075_819_1904 348
146 3300048929 Ga0496126_0041177 Ga0496126_0041177_679_1764 348
147 iso_pu_bacteria 2808606364 2808871148 348
148 iso_pu_bacteria 2919414237 2919419323 348
149 iso_pu_bacteria 2936361878 2936363662 348
150 iso_pu_bacteria 2946053406 2946058921 348
151 iso_pu_bacteria 2977254563 2977254725 348
152 iso_pu_bacteria 2990275345 2990275727 348
153 iso_pu_bacteria 3001892409 3001898826 348
154 iso_pu_bacteria 8022948649 8022950801 348
155 3300003856 Ga0058692_1011499 Ga0058692_10114993 349
156 3300025229 Ga0209147_100210 Ga0209147_10021073 349
157 3300027312 Ga0209371_1002491 Ga0209371_100249113 349
158 3300030500 Ga0268256_1002217 Ga0268256_100221713 349
159 iso_pu_bacteria 2540341094 2540605197 349
160 iso_pu_bacteria 2545555800 2545559789 349
161 iso_pu_bacteria 2576861599 2578930746 349
162 iso_pu_bacteria 2630968484 2631982493 349
163 iso_pu_bacteria 2648501850 2651530357 349
164 iso_pu_bacteria 2671180844 2674421088 349
165 iso_pu_bacteria 2695420354 2695629892 349
166 iso_pu_bacteria 2711768088 2712198839 349
167 iso_pu_bacteria 2716884898 2717918209 349
168 iso_pu_bacteria 2808606399 2809057216 349
169 iso_pu_bacteria 2823526263 2823526386 349
170 iso_pu_bacteria 2860837431 2860837549 349
171 iso_pu_bacteria 2877768649 2877768769 349
172 iso_pu_bacteria 2880169592 2880169711 349
173 iso_pu_bacteria 2897109615 2897109738 349
174 iso_pu_bacteria 2904560550 2904564560 349
175 iso_pu_bacteria 2908665501 2908669349 349
176 iso_pu_bacteria 2919093281 2919097107 349
177 iso_pu_bacteria 2919726948 2919730736 349
178 iso_pu_bacteria 2962290636 2962290761 349
179 iso_pu_bacteria 2969136845 2969136968 349
180 iso_pu_bacteria 2969141011 2969141136 349
181 iso_pu_bacteria 2969765954 2969766283 349
182 iso_pu_bacteria 2969770375 2969774951 349
183 iso_pu_bacteria 2971893375 2971893498 349
184 iso_pu_bacteria 2980492589 2980492712 349
185 iso_pu_bacteria 3001267043 3001271838 349
186 iso_pu_bacteria 3001272096 3001275925 349
187 iso_pu_bacteria 3006826541 3006831025 349
188 iso_pu_bacteria 3006879489 3006883599 349
189 iso_pu_bacteria 3006969106 3006973783 349
190 iso_pu_bacteria 3006973921 3006978386 349
191 iso_pu_bacteria 3006984091 3006988381 349
192 iso_pu_bacteria 8022630665 8022631670 349
193 iso_pu_bacteria 8022653035 8022655847 349
194 iso_pu_bacteria 8046991243 8046991350 349
195 iso_pu_bacteria 8051952484 8051956481 349
196 iso_pu_bacteria 8052174270 8052174957 349
197 iso_pu_bacteria 8054280661 8054282834 349
198 3300046474 Ga0495605_0059266 Ga0495605_0059266_634_1716 350
199 3300046694 Ga0495649_0017739 Ga0495649_0017739_2363_3445 350
200 3300048919 Ga0496116_0005716 Ga0496116_0005716_9024_10106 350
201 3300048919 Ga0496116_0040049 Ga0496116_0040049_1952_3049 350
202 3300048920 Ga0496117_0014604 Ga0496117_0014604_2097_3179 350
203 3300048922 Ga0496119_0000469 Ga0496119_0000469_9024_10106 350
204 3300048923 Ga0496120_0003045 Ga0496120_0003045_9023_10105 350
205 3300048925 Ga0496122_0015557 Ga0496122_0015557_2594_3676 350
206 3300048927 Ga0496124_0000697 Ga0496124_0000697_9023_10105 350
207 3300048929 Ga0496126_0005326 Ga0496126_0005326_4268_5350 350
208 3300048929 Ga0496126_0011703 Ga0496126_0011703_225_1307 350
209 iso_pu_bacteria 2554235469 2556065823 350
210 iso_pu_bacteria 2643221731 2644721371 350
211 iso_pu_bacteria 2643221732 2644723356 350
212 iso_pu_bacteria 2738543010 2739234665 350
213 iso_pu_bacteria 2818991465 2819711968 350
214 iso_pu_bacteria 2842882022 2842887755 350
215 iso_pu_bacteria 2852673933 2852676586 350
216 iso_pu_bacteria 2904524088 2904530135 350
217 iso_pu_bacteria 2916971899 2916972048 350
218 iso_pu_bacteria 2919143609 2919149604 350
219 iso_pu_bacteria 2919517244 2919523223 350
220 iso_pu_bacteria 2919720352 2919726444 350
221 iso_pu_bacteria 2928093941 2928099883 350
222 iso_pu_bacteria 2928510474 2928513079 350
223 iso_pu_bacteria 2929004312 2929009934 350
224 iso_pu_bacteria 2960319331 2960324315 350
225 iso_pu_bacteria 2960375949 2960378862 350
226 iso_pu_bacteria 8022893055 8022893403 350
227 iso_pu_bacteria 8022914991 8022917947 350
228 3300005289 Ga0065704_10172749 Ga0065704_101727491 351
229 3300025294 Ga0209025_1028077 Ga0209025_10280772 351
230 3300031548 Ga0307408_100220113 Ga0307408_1002201132 351
231 3300031731 Ga0307405_10251444 Ga0307405_102514442 351
232 3300031995 Ga0307409_100237337 Ga0307409_1002373372 351
233 3300032002 Ga0307416_100034970 Ga0307416_1000349703 351
234 3300048913 Ga0496110_0039387 Ga0496110_0039387_744_1841 351
235 3300048914 Ga0496111_0064645 Ga0496111_0064645_469_1566 351
236 3300049132 Ga0501343_000127 Ga0501343_000127_1381_2493 351
237 3300049528 Ga0501312_001602 Ga0501312_001602_10_1101 351
238 3300049533 Ga0501317_000150 Ga0501317_000150_1404_2516 351
239 3300049550 Ga0501334_00168 Ga0501334_00168_601_1713 351
240 3300049661 Ga0501217_002513 Ga0501217_002513_1953_3059 351
241 3300049661 Ga0501217_005865 Ga0501217_005865_1240_2352 351
242 3300049668 Ga0501233_005026 Ga0501233_005026_1267_2379 351
243 iso_pu_bacteria 2881644220 2881646604 351
244 iso_pu_bacteria 2956897341 2956900768 351
245 3300025284 Ga0209130_1003618 Ga0209130_10036184 352
246 3300025294 Ga0209025_1004078 Ga0209025_10040784 352
247 3300030083 Ga0237817_10220 Ga0237817_102204 352
248 3300046665 Ga0495661_0114935 Ga0495661_0114935_34_1143 352
249 3300046810 Ga0495660_0009598 Ga0495660_0009598_3335_4426 352
250 3300047321 Ga0495676_0119751 Ga0495676_0119751_598_1686 352
251 3300048091 Ga0495626_0063012 Ga0495626_0063012_545_1654 352
252 3300048913 Ga0496110_0028847 Ga0496110_0028847_2295_3419 352
253 iso_pu_bacteria 2802429420 2805348301 352
254 3300003187 JGI25151J46595_10001136 JGI25151J46595_1000113615 353
255 3300003578 Ga0006562J51391_1000677 Ga0006562J51391_10006777 353
256 3300009092 Ga0105250_10020929 Ga0105250_100209291 353
257 3300025294 Ga0209025_1000639 Ga0209025_100063972 353
258 3300049161 Ga0501305_000492 Ga0501305_000492_1512_2621 353
259 3300049161 Ga0501305_003231 Ga0501305_003231_163_1260 353
260 3300049528 Ga0501312_000015 Ga0501312_000015_352_1461 353
261 3300049528 Ga0501312_007476 Ga0501312_007476_214_1311 353
262 3300049532 Ga0501316_006408 Ga0501316_006408_123_1220 353
263 3300049548 Ga0501332_01123 Ga0501332_01123_107_1216 353
264 3300049551 Ga0501335_003218 Ga0501335_003218_205_1302 353
265 iso_pu_bacteria 2511231119 2511697972 353
266 iso_pu_bacteria 2551306519 2553395080 353
267 iso_pu_bacteria 2554235283 2555470851 353
268 iso_pu_bacteria 2643221729 2644705760 353
269 iso_pu_bacteria 2643221730 2644713281 353
270 iso_pu_bacteria 2643221735 2644741831 353
271 iso_pu_bacteria 2684622632 2685148237 353
272 iso_pu_bacteria 2684623153 2686995295 353
273 iso_pu_bacteria 2687453109 2687496544 353
274 iso_pu_bacteria 2695420987 2698319662 353
275 iso_pu_bacteria 2703719227 2705991979 353
276 iso_pu_bacteria 2718218445 2721503406 353
277 iso_pu_bacteria 2738541358 2739160135 353
278 iso_pu_bacteria 2738543006 2739212609 353
279 iso_pu_bacteria 2811994870 2812314433 353
280 iso_pu_bacteria 2818991443 2819585007 353
281 iso_pu_bacteria 2818991468 2819726098 353
282 iso_pu_bacteria 2929233124 2929233232 353
283 iso_pu_bacteria 2938917290 2938917402 353
284 iso_pu_bacteria 2947426588 2947426700 353
285 iso_pu_bacteria 2954773129 2954776110 353
286 iso_pu_bacteria 2965761152 2965761296 353
287 iso_pu_bacteria 2979083700 2979083710 353
288 iso_pu_bacteria 8022621104 8022621185 353
289 iso_pu_bacteria 8022792930 8022799025 353
290 iso_pu_bacteria 8023438354 8023439781 353
291 iso_pu_bacteria 8023444577 8023447360 353
292 iso_pu_bacteria 8057582654 8057582767 353
293 3300003187 JGI25151J46595_10005125 JGI25151J46595_100051253 354
294 3300003578 Ga0006562J51391_1014331 Ga0006562J51391_10143312 354
295 3300009011 Ga0105251_10013724 Ga0105251_100137241 354
296 3300009036 Ga0105244_10010829 Ga0105244_100108294 354
297 3300009092 Ga0105250_10000941 Ga0105250_1000094112 354
298 3300011119 Ga0105246_10000975 Ga0105246_1000097512 354
299 3300025284 Ga0209130_1003743 Ga0209130_10037432 354
300 3300025294 Ga0209025_1002839 Ga0209025_100283912 354
301 3300025294 Ga0209025_1005357 Ga0209025_10053579 354
302 3300025711 Ga0207696_1000889 Ga0207696_10008899 354
303 3300025735 Ga0207713_1006809 Ga0207713_10068094 354
304 3300025923 Ga0207681_10037899 Ga0207681_100378992 354
305 3300025229 Ga0209147_102218 Ga0209147_1022182 355
306 3300027876 Ga0209974_10031033 Ga0209974_100310332 355
307 3300030083 Ga0237817_10407 Ga0237817_104072 355
308 3300045976 Ga0466967_0000664 Ga0466967_0000664_7746_8855 355
309 3300009092 Ga0105250_10011530 Ga0105250_100115303 356
310 3300025711 Ga0207696_1012406 Ga0207696_10124062 356
311 3300002987 JGI25159J45721_1003590 JGI25159J45721_10035904 357
312 3300003187 JGI25151J46595_10022575 JGI25151J46595_100225751 357
313 3300003187 JGI25151J46595_10061220 JGI25151J46595_100612201 357
314 3300009011 Ga0105251_10019992 Ga0105251_100199924 357
315 3300025284 Ga0209130_1002183 Ga0209130_10021838 357
316 3300025284 Ga0209130_1014351 Ga0209130_10143511 357
317 3300025294 Ga0209025_1003499 Ga0209025_10034998 357
318 3300025294 Ga0209025_1009747 Ga0209025_10097476 357
319 3300025294 Ga0209025_1012895 Ga0209025_10128953 357
320 3300025728 Ga0207655_1002102 Ga0207655_100210219 357
321 3300025735 Ga0207713_1012053 Ga0207713_10120534 357
322 3300038705 Ga0237819_00656 Ga0237819_00656_1861_2964 357

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

190

299

0.94

Feature Viewer

pLDDT pTM Quality
81.66 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map