F406887
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 323 | 210 | 309 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10192556|Ga0105240_101925563 |
| Length | 163 |
| Sequence | VDYQFMKPSPVMGNTPRVYYLYKKNNLMRRNASAVWNGSGKEGSGHLTTQSTVLNKTQYSFGSRFENGVGTNPEELLAAAHAGCYTMQLSFTLNAAGFTADEIDTNCHVTIENGTITKSELTVRAKIPNIDNEKFMEAATYAKDNCPVSKLFNCEKTLDAALV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 4 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 5 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 6 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 7 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 8 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 9 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 10 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 11 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 12 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 13 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 14 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 15 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 16 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 17 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 136 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 137 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 139 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 148 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 149 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 159 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 162 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 163 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 164 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 165 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 166 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 184 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 185 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 186 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 187 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 188 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 189 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 190 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 191 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 192 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 193 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 194 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 195 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 196 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 197 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 198 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 199 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 200 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 202 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 203 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 204 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 205 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.98 |
| Metatranscriptomes | 0 |
| Isolates | 4.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.02 |
| Nodule | 0 |
| Rhizoplane | 2.17 |
| Rhizosphere | 89.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_1518 | 2124908027 | Bacteria | 895 |
| 2 | SwRhRL2b_contig_3893312 | 2162886007 | Bacteria | 22472 |
| 3 | JGI25152J39213_1000007 | 3300002773 | Bacteria | 156012 |
| 4 | JGI25150J39212_1000013 | 3300002774 | Bacteria | 182307 |
| 5 | JGI25151J46595_10000004 | 3300003187 | Bacteria | 494006 |
| 6 | JGI25153J46596_10000004 | 3300003215 | Bacteria | 494006 |
| 7 | Ga0055536_1000071 | 3300003781 | Bacteria | 93563 |
| 8 | Ga0055530_10007326 | 3300003791 | Bacteria | 4676 |
| 9 | Ga0065714_10004484 | 3300005288 | Bacteria | 19587 |
| 10 | Ga0065714_10004833 | 3300005288 | Bacteria | 4399 |
| 11 | Ga0065714_10065441 | 3300005288 | Bacteria | 10062 |
| 12 | Ga0065714_10065694 | 3300005288 | Bacteria | 8840 |
| 13 | Ga0065714_10098657 | 3300005288 | Bacteria | 1705 |
| 14 | Ga0065714_10477696 | 3300005288 | Bacteria | 537 |
| 15 | Ga0065714_10529251 | 3300005288 | Bacteria | 508 |
| 16 | Ga0065704_10000199 | 3300005289 | Bacteria | 297176 |
| 17 | Ga0065704_10521425 | 3300005289 | Bacteria | 653 |
| 18 | Ga0065715_11038633 | 3300005293 | Bacteria | 535 |
| 19 | Ga0070683_100139689 | 3300005329 | Bacteria | 2295 |
| 20 | Ga0070683_100528751 | 3300005329 | Unclassified | 1127 |
| 21 | Ga0070690_100269691 | 3300005330 | Bacteria | 1210 |
| 22 | Ga0070670_100910318 | 3300005331 | Bacteria | 798 |
| 23 | Ga0070670_101025143 | 3300005331 | Bacteria | 751 |
| 24 | Ga0068869_100529675 | 3300005334 | Bacteria | 987 |
| 25 | Ga0070666_10009910 | 3300005335 | Bacteria | 5947 |
| 26 | Ga0070682_100000008 | 3300005337 | Bacteria | 322125 |
| 27 | Ga0070682_100184081 | 3300005337 | Bacteria | 1461 |
| 28 | Ga0070682_100937401 | 3300005337 | Bacteria | 714 |
| 29 | Ga0070687_100664341 | 3300005343 | Unclassified | 724 |
| 30 | Ga0070661_100277524 | 3300005344 | Bacteria | 1299 |
| 31 | Ga0070668_100314787 | 3300005347 | Bacteria | 1316 |
| 32 | Ga0070669_100131452 | 3300005353 | Bacteria | 1921 |
| 33 | Ga0070675_100507471 | 3300005354 | Bacteria | 1087 |
| 34 | Ga0070675_101062096 | 3300005354 | Bacteria | 744 |
| 35 | Ga0070671_100239199 | 3300005355 | Bacteria | 1541 |
| 36 | Ga0070674_100076979 | 3300005356 | Bacteria | 2373 |
| 37 | Ga0070667_101847932 | 3300005367 | Bacteria | 569 |
| 38 | Ga0070678_100019306 | 3300005456 | Bacteria | 4440 |
| 39 | Ga0070678_101083320 | 3300005456 | Bacteria | 739 |
| 40 | Ga0070662_100199642 | 3300005457 | Bacteria | 1586 |
| 41 | Ga0068867_100707744 | 3300005459 | Bacteria | 889 |
| 42 | Ga0070684_100182599 | 3300005535 | Bacteria | 1908 |
| 43 | Ga0068853_100007037 | 3300005539 | Bacteria | 8992 |
| 44 | Ga0068853_100040505 | 3300005539 | Bacteria | 3975 |
| 45 | Ga0070672_100501252 | 3300005543 | Bacteria | 1050 |
| 46 | Ga0070686_100321135 | 3300005544 | Bacteria | 1154 |
| 47 | Ga0070665_100027588 | 3300005548 | Bacteria | 5719 |
| 48 | Ga0068855_100378707 | 3300005563 | Bacteria | 1554 |
| 49 | Ga0068855_101811009 | 3300005563 | Unclassified | 620 |
| 50 | Ga0070664_100429184 | 3300005564 | Bacteria | 1211 |
| 51 | Ga0068857_102176731 | 3300005577 | Bacteria | 544 |
| 52 | Ga0068854_100881911 | 3300005578 | Bacteria | 785 |
| 53 | Ga0068854_102258581 | 3300005578 | Bacteria | 504 |
| 54 | Ga0068852_100163513 | 3300005616 | Bacteria | 2080 |
| 55 | Ga0068852_100206489 | 3300005616 | Bacteria | 1861 |
| 56 | Ga0068852_100844918 | 3300005616 | Bacteria | 931 |
| 57 | Ga0068859_100000903 | 3300005617 | Bacteria | 30294 |
| 58 | Ga0068861_100186992 | 3300005719 | Bacteria | 1728 |
| 59 | Ga0068861_102366950 | 3300005719 | Bacteria | 534 |
| 60 | Ga0068851_10467281 | 3300005834 | Bacteria | 752 |
| 61 | Ga0068863_100659086 | 3300005841 | Bacteria | 1038 |
| 62 | Ga0068860_100244156 | 3300005843 | Unclassified | 1747 |
| 63 | Ga0068862_100587355 | 3300005844 | Bacteria | 1068 |
| 64 | Ga0070717_10944570 | 3300006028 | Bacteria | 785 |
| 65 | Ga0097621_100032088 | 3300006237 | Bacteria | 4173 |
| 66 | Ga0068871_100157490 | 3300006358 | Bacteria | 1940 |
| 67 | Ga0068871_101998692 | 3300006358 | Bacteria | 552 |
| 68 | Ga0075428_101269625 | 3300006844 | Bacteria | 775 |
| 69 | Ga0075431_100004472 | 3300006847 | Bacteria | 13717 |
| 70 | Ga0097620_100000903 | 3300006931 | Bacteria | 30294 |
| 71 | Ga0105244_10039503 | 3300009036 | Bacteria | 2456 |
| 72 | Ga0105240_10000176 | 3300009093 | Bacteria | 130109 |
| 73 | Ga0105240_10192556 | 3300009093 | Unclassified | 2396 |
| 74 | Ga0105240_10204324 | 3300009093 | Bacteria | 2313 |
| 75 | Ga0105240_10216420 | 3300009093 | Bacteria | 2235 |
| 76 | Ga0111539_10022060 | 3300009094 | Bacteria | 7825 |
| 77 | Ga0111539_10072731 | 3300009094 | Bacteria | 4054 |
| 78 | Ga0105245_10192592 | 3300009098 | Bacteria | 1954 |
| 79 | Ga0114129_10188391 | 3300009147 | Bacteria | 2803 |
| 80 | Ga0105241_10241727 | 3300009174 | Bacteria | 1526 |
| 81 | Ga0105242_11217207 | 3300009176 | Bacteria | 773 |
| 82 | Ga0105242_11987014 | 3300009176 | Bacteria | 623 |
| 83 | Ga0105237_10019910 | 3300009545 | Bacteria | 6927 |
| 84 | Ga0105237_10454428 | 3300009545 | Unclassified | 1287 |
| 85 | Ga0105237_10586050 | 3300009545 | Bacteria | 1122 |
| 86 | Ga0105238_10285139 | 3300009551 | Bacteria | 1633 |
| 87 | Ga0105239_10001803 | 3300010375 | Bacteria | 28139 |
| 88 | Ga0105239_10070059 | 3300010375 | Bacteria | 3852 |
| 89 | Ga0157373_10000015 | 3300013100 | Bacteria | 183381 |
| 90 | Ga0157373_10000411 | 3300013100 | Bacteria | 34442 |
| 91 | Ga0157373_10002959 | 3300013100 | Bacteria | 12870 |
| 92 | Ga0157373_10010302 | 3300013100 | Bacteria | 6887 |
| 93 | Ga0157371_10000027 | 3300013102 | Bacteria | 269243 |
| 94 | Ga0157371_10009379 | 3300013102 | Bacteria | 7707 |
| 95 | Ga0157371_10031191 | 3300013102 | Bacteria | 3840 |
| 96 | Ga0157371_10034841 | 3300013102 | Bacteria | 3609 |
| 97 | Ga0157370_10015500 | 3300013104 | Bacteria | 7750 |
| 98 | Ga0157370_10266718 | 3300013104 | Bacteria | 1582 |
| 99 | Ga0157370_10323485 | 3300013104 | Bacteria | 1422 |
| 100 | Ga0157370_10367107 | 3300013104 | Bacteria | 1326 |
| 101 | Ga0157370_10368082 | 3300013104 | Bacteria | 1324 |
| 102 | Ga0157370_11433165 | 3300013104 | Bacteria | 621 |
| 103 | Ga0157370_11520373 | 3300013104 | Bacteria | 602 |
| 104 | Ga0157370_11911615 | 3300013104 | Unclassified | 532 |
| 105 | Ga0157369_10000053 | 3300013105 | Bacteria | 162962 |
| 106 | Ga0157369_10402097 | 3300013105 | Unclassified | 1421 |
| 107 | Ga0157369_11031573 | 3300013105 | Bacteria | 842 |
| 108 | Ga0157369_11427477 | 3300013105 | Bacteria | 704 |
| 109 | Ga0157369_11495280 | 3300013105 | Bacteria | 687 |
| 110 | Ga0157374_10748883 | 3300013296 | Unclassified | 992 |
| 111 | Ga0157374_12266014 | 3300013296 | Bacteria | 570 |
| 112 | Ga0157378_10022322 | 3300013297 | Bacteria | 5571 |
| 113 | Ga0157378_10120579 | 3300013297 | Bacteria | 2417 |
| 114 | Ga0157378_12051458 | 3300013297 | Bacteria | 622 |
| 115 | Ga0163162_10000184 | 3300013306 | Bacteria | 57899 |
| 116 | Ga0163162_10025494 | 3300013306 | Bacteria | 5842 |
| 117 | Ga0163162_10160557 | 3300013306 | Bacteria | 2369 |
| 118 | Ga0163162_11181682 | 3300013306 | Bacteria | 868 |
| 119 | Ga0157372_10006025 | 3300013307 | Bacteria | 12875 |
| 120 | Ga0157372_10073245 | 3300013307 | Bacteria | 3861 |
| 121 | Ga0157372_10173414 | 3300013307 | Bacteria | 2495 |
| 122 | Ga0157372_10220013 | 3300013307 | Bacteria | 2201 |
| 123 | Ga0157372_10236146 | 3300013307 | Bacteria | 2121 |
| 124 | Ga0157372_10371460 | 3300013307 | Unclassified | 1666 |
| 125 | Ga0157375_10013302 | 3300013308 | Bacteria | 7319 |
| 126 | Ga0157375_10114902 | 3300013308 | Bacteria | 2794 |
| 127 | Ga0157375_10256514 | 3300013308 | Bacteria | 1910 |
| 128 | Ga0157375_10504834 | 3300013308 | Bacteria | 1373 |
| 129 | Ga0157375_13269663 | 3300013308 | Bacteria | 540 |
| 130 | Ga0163163_10362058 | 3300014325 | Bacteria | 1507 |
| 131 | Ga0182008_10000001 | 3300014497 | Bacteria | 540790 |
| 132 | Ga0182008_10000005 | 3300014497 | Bacteria | 386556 |
| 133 | Ga0182008_10000221 | 3300014497 | Bacteria | 44804 |
| 134 | Ga0157376_10463362 | 3300014969 | Bacteria | 1239 |
| 135 | Ga0182006_1000126 | 3300015261 | Bacteria | 81813 |
| 136 | Ga0182006_1000296 | 3300015261 | Bacteria | 43777 |
| 137 | Ga0182006_1002358 | 3300015261 | Bacteria | 10369 |
| 138 | Ga0182006_1047249 | 3300015261 | Bacteria | 1670 |
| 139 | Ga0182007_10000005 | 3300015262 | Bacteria | 442702 |
| 140 | Ga0183373_1007 | 3300015682 | Bacteria | 282776 |
| 141 | Ga0163161_10000182 | 3300017792 | Bacteria | 57700 |
| 142 | Ga0163161_10000350 | 3300017792 | Bacteria | 39043 |
| 143 | Ga0163161_10000485 | 3300017792 | Bacteria | 32611 |
| 144 | Ga0163161_10019485 | 3300017792 | Bacteria | 4761 |
| 145 | Ga0163161_10062388 | 3300017792 | Bacteria | 2715 |
| 146 | Ga0163161_10081442 | 3300017792 | Bacteria | 2384 |
| 147 | Ga0163161_10249972 | 3300017792 | Bacteria | 1382 |
| 148 | Ga0163161_10367874 | 3300017792 | Bacteria | 1146 |
| 149 | Ga0163161_10592639 | 3300017792 | Bacteria | 913 |
| 150 | Ga0207425_1000008 | 3300025245 | Bacteria | 618024 |
| 151 | Ga0209129_1000042 | 3300025258 | Bacteria | 305537 |
| 152 | Ga0209676_1000039 | 3300025292 | Bacteria | 443158 |
| 153 | Ga0209025_1000020 | 3300025294 | Bacteria | 618024 |
| 154 | Ga0209758_1000022 | 3300025297 | Bacteria | 618024 |
| 155 | Ga0209050_1000033 | 3300025298 | Bacteria | 442615 |
| 156 | Ga0207682_10042964 | 3300025893 | Bacteria | 1848 |
| 157 | Ga0207642_10262829 | 3300025899 | Bacteria | 985 |
| 158 | Ga0207680_10075935 | 3300025903 | Unclassified | 2097 |
| 159 | Ga0207647_10059331 | 3300025904 | Bacteria | 2342 |
| 160 | Ga0207654_10338827 | 3300025911 | Bacteria | 1032 |
| 161 | Ga0207695_10000102 | 3300025913 | Bacteria | 257838 |
| 162 | Ga0207695_10035087 | 3300025913 | Bacteria | 5444 |
| 163 | Ga0207695_10051229 | 3300025913 | Bacteria | 4337 |
| 164 | Ga0207695_10324995 | 3300025913 | Bacteria | 1427 |
| 165 | Ga0207671_10000725 | 3300025914 | Bacteria | 41972 |
| 166 | Ga0207671_10223545 | 3300025914 | Unclassified | 1475 |
| 167 | Ga0207671_11471370 | 3300025914 | Bacteria | 526 |
| 168 | Ga0207649_10457707 | 3300025920 | Bacteria | 964 |
| 169 | Ga0207649_10694123 | 3300025920 | Bacteria | 789 |
| 170 | Ga0207681_10777415 | 3300025923 | Unclassified | 799 |
| 171 | Ga0207694_10198146 | 3300025924 | Bacteria | 1633 |
| 172 | Ga0207650_10105298 | 3300025925 | Unclassified | 2177 |
| 173 | Ga0207659_11247960 | 3300025926 | Bacteria | 638 |
| 174 | Ga0207687_11584674 | 3300025927 | Bacteria | 562 |
| 175 | Ga0207644_10274583 | 3300025931 | Bacteria | 1352 |
| 176 | Ga0207706_10782780 | 3300025933 | Bacteria | 811 |
| 177 | Ga0207686_11002317 | 3300025934 | Bacteria | 678 |
| 178 | Ga0207670_10276539 | 3300025936 | Bacteria | 1307 |
| 179 | Ga0207669_10046087 | 3300025937 | Bacteria | 2574 |
| 180 | Ga0207691_10083841 | 3300025940 | Bacteria | 2861 |
| 181 | Ga0207691_10096698 | 3300025940 | Bacteria | 2640 |
| 182 | Ga0207691_10542954 | 3300025940 | Bacteria | 986 |
| 183 | Ga0207689_10460783 | 3300025942 | Bacteria | 1063 |
| 184 | Ga0207661_10040743 | 3300025944 | Bacteria | 3653 |
| 185 | Ga0207679_10120444 | 3300025945 | Bacteria | 2088 |
| 186 | Ga0207667_11497506 | 3300025949 | Unclassified | 646 |
| 187 | Ga0207651_11040110 | 3300025960 | Unclassified | 733 |
| 188 | Ga0207668_10562245 | 3300025972 | Bacteria | 989 |
| 189 | Ga0207640_11451309 | 3300025981 | Bacteria | 615 |
| 190 | Ga0207639_10017064 | 3300026041 | Bacteria | 5143 |
| 191 | Ga0207639_10018418 | 3300026041 | Bacteria | 4961 |
| 192 | Ga0207639_11681521 | 3300026041 | Unclassified | 595 |
| 193 | Ga0207678_10805798 | 3300026067 | Bacteria | 829 |
| 194 | Ga0207641_10124012 | 3300026088 | Bacteria | 2310 |
| 195 | Ga0207641_11163241 | 3300026088 | Bacteria | 771 |
| 196 | Ga0207648_10893516 | 3300026089 | Bacteria | 830 |
| 197 | Ga0207676_10269886 | 3300026095 | Bacteria | 1540 |
| 198 | Ga0207674_11718241 | 3300026116 | Bacteria | 595 |
| 199 | Ga0207675_100222882 | 3300026118 | Bacteria | 1817 |
| 200 | Ga0207683_10030725 | 3300026121 | Bacteria | 4657 |
| 201 | Ga0207683_10458896 | 3300026121 | Bacteria | 1175 |
| 202 | Ga0207683_11031788 | 3300026121 | Bacteria | 763 |
| 203 | Ga0207683_11255560 | 3300026121 | Bacteria | 686 |
| 204 | Ga0207698_10153708 | 3300026142 | Bacteria | 2001 |
| 205 | Ga0207698_10196149 | 3300026142 | Bacteria | 1804 |
| 206 | Ga0207698_12370136 | 3300026142 | Bacteria | 542 |
| 207 | Ga0209974_10158458 | 3300027876 | Bacteria | 820 |
| 208 | Ga0207428_10151152 | 3300027907 | Unclassified | 1767 |
| 209 | Ga0268266_10018627 | 3300028379 | Bacteria | 5916 |
| 210 | Ga0268264_10471558 | 3300028381 | Unclassified | 1219 |
| 211 | Ga0265318_10218800 | 3300028577 | Bacteria | 696 |
| 212 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 213 | Ga0265324_10014351 | 3300029957 | Bacteria | 2934 |
| 214 | Ga0265324_10016058 | 3300029957 | Bacteria | 2743 |
| 215 | Ga0265328_10160323 | 3300031239 | Bacteria | 848 |
| 216 | Ga0265320_10500868 | 3300031240 | Unclassified | 536 |
| 217 | Ga0265331_10146565 | 3300031250 | Bacteria | 1072 |
| 218 | Ga0265331_10207302 | 3300031250 | Bacteria | 882 |
| 219 | Ga0265331_10458727 | 3300031250 | Unclassified | 573 |
| 220 | Ga0265327_10000009 | 3300031251 | Bacteria | 616360 |
| 221 | Ga0265327_10000212 | 3300031251 | Bacteria | 121556 |
| 222 | Ga0265327_10002369 | 3300031251 | Bacteria | 20069 |
| 223 | Ga0265327_10039518 | 3300031251 | Bacteria | 2562 |
| 224 | Ga0307509_10665784 | 3300031507 | Bacteria | 709 |
| 225 | Ga0307408_100602654 | 3300031548 | Bacteria | 976 |
| 226 | Ga0265314_10011723 | 3300031711 | Bacteria | 7211 |
| 227 | Ga0265314_10425853 | 3300031711 | Bacteria | 712 |
| 228 | Ga0265342_10239490 | 3300031712 | Bacteria | 972 |
| 229 | Ga0307405_10000068 | 3300031731 | Bacteria | 47793 |
| 230 | Ga0307405_10170887 | 3300031731 | Bacteria | 1550 |
| 231 | Ga0307405_10815480 | 3300031731 | Bacteria | 783 |
| 232 | Ga0307410_10207071 | 3300031852 | Bacteria | 1501 |
| 233 | Ga0307410_10700006 | 3300031852 | Bacteria | 854 |
| 234 | Ga0307406_10795170 | 3300031901 | Bacteria | 798 |
| 235 | Ga0307407_10000001 | 3300031903 | Bacteria | 570048 |
| 236 | Ga0307412_10000017 | 3300031911 | Bacteria | 294698 |
| 237 | Ga0307412_10065611 | 3300031911 | Bacteria | 2458 |
| 238 | Ga0307412_10175521 | 3300031911 | Bacteria | 1606 |
| 239 | Ga0307409_100031312 | 3300031995 | Bacteria | 3837 |
| 240 | Ga0307416_100000008 | 3300032002 | Bacteria | 401343 |
| 241 | Ga0307416_100717931 | 3300032002 | Bacteria | 1090 |
| 242 | Ga0307416_100775558 | 3300032002 | Bacteria | 1053 |
| 243 | Ga0307414_10006755 | 3300032004 | Bacteria | 6419 |
| 244 | Ga0307414_10372537 | 3300032004 | Bacteria | 1232 |
| 245 | Ga0307414_10442509 | 3300032004 | Bacteria | 1138 |
| 246 | Ga0307411_10864827 | 3300032005 | Bacteria | 801 |
| 247 | Ga0307415_101192356 | 3300032126 | Bacteria | 717 |
| 248 | Ga0395898_0400196 | 3300037466 | Bacteria | 1309 |
| 249 | Ga0395905_0106078 | 3300037471 | Unclassified | 2638 |
| 250 | Ga0436365_1585623 | 3300039437 | Bacteria | 1545 |
| 251 | Ga0451789_1297146 | 3300041443 | Unclassified | 521 |
| 252 | Ga0451807_0579978 | 3300041486 | Unclassified | 1020 |
| 253 | Ga0451839_1140327 | 3300041496 | Bacteria | 920 |
| 254 | Ga0451843_1407527 | 3300041509 | Unclassified | 700 |
| 255 | Ga0453684_0026988 | 3300044712 | Bacteria | 8265 |
| 256 | Ga0466959_0362458 | 3300045049 | Unclassified | 987 |
| 257 | Ga0451576_0320150 | 3300045051 | Bacteria | 1623 |
| 258 | Ga0495650_0177387 | 3300046471 | Unclassified | 751 |
| 259 | Ga0495664_0552591 | 3300046477 | Bacteria | 686 |
| 260 | Ga0495606_0046429 | 3300046507 | Bacteria | 2871 |
| 261 | Ga0495610_0000108 | 3300046512 | Bacteria | 96839 |
| 262 | Ga0495610_0001498 | 3300046512 | Bacteria | 20534 |
| 263 | Ga0495637_0017756 | 3300046520 | Bacteria | 3308 |
| 264 | Ga0495663_0000030 | 3300046525 | Bacteria | 80154 |
| 265 | Ga0495598_0010249 | 3300046537 | Bacteria | 2241 |
| 266 | Ga0495609_0000003 | 3300046538 | Bacteria | 711547 |
| 267 | Ga0495609_0196973 | 3300046538 | Bacteria | 843 |
| 268 | Ga0495633_0079088 | 3300046558 | Unclassified | 1531 |
| 269 | Ga0495667_0586743 | 3300046559 | Bacteria | 695 |
| 270 | Ga0495635_0026156 | 3300046663 | Bacteria | 4064 |
| 271 | Ga0495600_0395872 | 3300046809 | Bacteria | 860 |
| 272 | Ga0495636_0000044 | 3300047318 | Bacteria | 54580 |
| 273 | Ga0495674_0524685 | 3300047319 | Bacteria | 945 |
| 274 | Ga0495672_0026923 | 3300047320 | Bacteria | 3661 |
| 275 | Ga0495672_0102837 | 3300047320 | Bacteria | 1546 |
| 276 | Ga0495672_0334203 | 3300047320 | Bacteria | 708 |
| 277 | Ga0495686_0133374 | 3300047472 | Bacteria | 1471 |
| 278 | Ga0496108_0663522 | 3300048911 | Bacteria | 906 |
| 279 | Ga0496110_1234019 | 3300048913 | Unclassified | 657 |
| 280 | Ga0496114_0026017 | 3300048917 | Bacteria | 4787 |
| 281 | Ga0496114_1192485 | 3300048917 | Unclassified | 647 |
| 282 | Ga0496115_0001141 | 3300048918 | Bacteria | 19184 |
| 283 | Ga0496124_0269058 | 3300048927 | Bacteria | 1249 |
| 284 | Ga0501290_019923 | 3300049513 | Bacteria | 913 |
| 285 | Ga0501297_041022 | 3300049520 | Unclassified | 652 |
| 286 | Ga0501202_055817 | 3300049652 | Bacteria | 883 |
| 287 | Ga0501202_157334 | 3300049652 | Bacteria | 599 |
| 288 | Ga0501207_062742 | 3300049654 | Bacteria | 684 |
| 289 | Ga0501223_049902 | 3300049663 | Bacteria | 812 |
| 290 | Ga0501227_030541 | 3300049665 | Bacteria | 1291 |
| 291 | Ga0501230_099009 | 3300049667 | Bacteria | 627 |
| 292 | Ga0501233_009369 | 3300049668 | Bacteria | 1908 |
| 293 | Ga0501235_047110 | 3300049669 | Bacteria | 994 |
| 294 | Ga0501243_088765 | 3300049675 | Bacteria | 611 |
| 295 | Ga0501249_018888 | 3300049679 | Bacteria | 1493 |
| 296 | Ga0501252_056140 | 3300049682 | Bacteria | 606 |
| 297 | Ga0501257_012152 | 3300049686 | Bacteria | 1969 |
| 298 | Ga0501080_0731265 | 3300049742 | Bacteria | 871 |
| 299 | Ga0501232_033856 | 3300049757 | Unclassified | 723 |
| 300 | Ga0501263_079225 | 3300049760 | Bacteria | 541 |
| 301 | Ga0501266_021876 | 3300049763 | Bacteria | 877 |
| 302 | Ga0501268_071611 | 3300049765 | Bacteria | 702 |
| 303 | Ga0501279_014273 | 3300049775 | Bacteria | 1092 |
| 304 | Ga0501035_0072144 | 3300049822 | Bacteria | 3057 |
| 305 | Ga0501044_0137831 | 3300049823 | Bacteria | 2430 |
| 306 | Ga0501044_0886995 | 3300049823 | Unclassified | 767 |
| 307 | nmdc:mga05p37_233229_c1 | 3300050507 | Bacteria | 2216 |
| 308 | nmdc:mga08y16_38517_c1 | 3300050511 | Bacteria | 5020 |
| 309 | Ga0500651_0002128 | 3300053093 | Bacteria | 10315 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10266718 | Ga0157370_102667181 | 116 |
| 2 | 3300046538 | Ga0495609_0000003 | Ga0495609_0000003_501159_501623 | 116 |
| 3 | iso_pu_bacteria | 2585427687 | 2586209164 | 132 |
| 4 | iso_pu_bacteria | 2738541302 | 2738854672 | 132 |
| 5 | iso_pu_bacteria | 2739367651 | 2739587198 | 132 |
| 6 | iso_pu_bacteria | 2739367656 | 2739617556 | 132 |
| 7 | iso_pu_bacteria | 2739367663 | 2739648010 | 132 |
| 8 | iso_pu_bacteria | 2818991437 | 2819547657 | 132 |
| 9 | iso_pu_bacteria | 2842722452 | 2842726671 | 132 |
| 10 | iso_pu_bacteria | 2842909656 | 2842911514 | 132 |
| 11 | iso_pu_bacteria | 2849281842 | 2849284141 | 132 |
| 12 | iso_pu_bacteria | 2857627736 | 2857630000 | 132 |
| 13 | iso_pu_bacteria | 2904445276 | 2904449617 | 132 |
| 14 | iso_pu_bacteria | 2945997725 | 2946003019 | 132 |
| 15 | iso_pu_bacteria | 2954016120 | 2954019890 | 132 |
| 16 | 2124908027 | MRS2a_Contig_1518 | MRS2a_00398960 | 136 |
| 17 | 2162886007 | SwRhRL2b_contig_3893312 | SwRhRL2b_0247.00001880 | 136 |
| 18 | 3300002773 | JGI25152J39213_1000007 | JGI25152J39213_100000723 | 136 |
| 19 | 3300002774 | JGI25150J39212_1000013 | JGI25150J39212_100001347 | 136 |
| 20 | 3300003187 | JGI25151J46595_10000004 | JGI25151J46595_10000004123 | 136 |
| 21 | 3300003215 | JGI25153J46596_10000004 | JGI25153J46596_10000004123 | 136 |
| 22 | 3300003781 | Ga0055536_1000071 | Ga0055536_100007180 | 136 |
| 23 | 3300003791 | Ga0055530_10007326 | Ga0055530_100073263 | 136 |
| 24 | 3300005288 | Ga0065714_10004484 | Ga0065714_1000448419 | 136 |
| 25 | 3300005288 | Ga0065714_10004833 | Ga0065714_100048332 | 136 |
| 26 | 3300005288 | Ga0065714_10065441 | Ga0065714_100654415 | 136 |
| 27 | 3300005288 | Ga0065714_10065694 | Ga0065714_1006569410 | 136 |
| 28 | 3300005288 | Ga0065714_10098657 | Ga0065714_100986572 | 136 |
| 29 | 3300005288 | Ga0065714_10477696 | Ga0065714_104776961 | 136 |
| 30 | 3300005288 | Ga0065714_10529251 | Ga0065714_105292511 | 136 |
| 31 | 3300005289 | Ga0065704_10000199 | Ga0065704_10000199132 | 136 |
| 32 | 3300005289 | Ga0065704_10521425 | Ga0065704_105214251 | 136 |
| 33 | 3300005293 | Ga0065715_11038633 | Ga0065715_110386331 | 136 |
| 34 | 3300005329 | Ga0070683_100139689 | Ga0070683_1001396892 | 136 |
| 35 | 3300005329 | Ga0070683_100528751 | Ga0070683_1005287511 | 136 |
| 36 | 3300005330 | Ga0070690_100269691 | Ga0070690_1002696911 | 136 |
| 37 | 3300005331 | Ga0070670_100910318 | Ga0070670_1009103182 | 136 |
| 38 | 3300005331 | Ga0070670_101025143 | Ga0070670_1010251431 | 136 |
| 39 | 3300005334 | Ga0068869_100529675 | Ga0068869_1005296752 | 136 |
| 40 | 3300005335 | Ga0070666_10009910 | Ga0070666_100099102 | 136 |
| 41 | 3300005337 | Ga0070682_100000008 | Ga0070682_10000000862 | 136 |
| 42 | 3300005337 | Ga0070682_100184081 | Ga0070682_1001840811 | 136 |
| 43 | 3300005337 | Ga0070682_100937401 | Ga0070682_1009374011 | 136 |
| 44 | 3300005343 | Ga0070687_100664341 | Ga0070687_1006643411 | 136 |
| 45 | 3300005344 | Ga0070661_100277524 | Ga0070661_1002775243 | 136 |
| 46 | 3300005347 | Ga0070668_100314787 | Ga0070668_1003147872 | 136 |
| 47 | 3300005353 | Ga0070669_100131452 | Ga0070669_1001314522 | 136 |
| 48 | 3300005354 | Ga0070675_100507471 | Ga0070675_1005074712 | 136 |
| 49 | 3300005354 | Ga0070675_101062096 | Ga0070675_1010620962 | 136 |
| 50 | 3300005355 | Ga0070671_100239199 | Ga0070671_1002391992 | 136 |
| 51 | 3300005356 | Ga0070674_100076979 | Ga0070674_1000769794 | 136 |
| 52 | 3300005367 | Ga0070667_101847932 | Ga0070667_1018479321 | 136 |
| 53 | 3300005456 | Ga0070678_100019306 | Ga0070678_1000193064 | 136 |
| 54 | 3300005456 | Ga0070678_101083320 | Ga0070678_1010833201 | 136 |
| 55 | 3300005457 | Ga0070662_100199642 | Ga0070662_1001996421 | 136 |
| 56 | 3300005459 | Ga0068867_100707744 | Ga0068867_1007077441 | 136 |
| 57 | 3300005535 | Ga0070684_100182599 | Ga0070684_1001825992 | 136 |
| 58 | 3300005539 | Ga0068853_100007037 | Ga0068853_1000070373 | 136 |
| 59 | 3300005539 | Ga0068853_100040505 | Ga0068853_1000405053 | 136 |
| 60 | 3300005543 | Ga0070672_100501252 | Ga0070672_1005012521 | 136 |
| 61 | 3300005544 | Ga0070686_100321135 | Ga0070686_1003211352 | 136 |
| 62 | 3300005548 | Ga0070665_100027588 | Ga0070665_1000275886 | 136 |
| 63 | 3300005563 | Ga0068855_100378707 | Ga0068855_1003787072 | 136 |
| 64 | 3300005563 | Ga0068855_101811009 | Ga0068855_1018110091 | 136 |
| 65 | 3300005564 | Ga0070664_100429184 | Ga0070664_1004291843 | 136 |
| 66 | 3300005577 | Ga0068857_102176731 | Ga0068857_1021767311 | 136 |
| 67 | 3300005578 | Ga0068854_100881911 | Ga0068854_1008819112 | 136 |
| 68 | 3300005578 | Ga0068854_102258581 | Ga0068854_1022585811 | 136 |
| 69 | 3300005616 | Ga0068852_100163513 | Ga0068852_1001635134 | 136 |
| 70 | 3300005616 | Ga0068852_100206489 | Ga0068852_1002064891 | 136 |
| 71 | 3300005616 | Ga0068852_100844918 | Ga0068852_1008449182 | 136 |
| 72 | 3300005617 | Ga0068859_100000903 | Ga0068859_10000090327 | 136 |
| 73 | 3300005719 | Ga0068861_100186992 | Ga0068861_1001869923 | 136 |
| 74 | 3300005719 | Ga0068861_102366950 | Ga0068861_1023669501 | 136 |
| 75 | 3300005834 | Ga0068851_10467281 | Ga0068851_104672811 | 136 |
| 76 | 3300005841 | Ga0068863_100659086 | Ga0068863_1006590862 | 136 |
| 77 | 3300005843 | Ga0068860_100244156 | Ga0068860_1002441562 | 136 |
| 78 | 3300005844 | Ga0068862_100587355 | Ga0068862_1005873552 | 136 |
| 79 | 3300006028 | Ga0070717_10944570 | Ga0070717_109445702 | 136 |
| 80 | 3300006237 | Ga0097621_100032088 | Ga0097621_1000320884 | 136 |
| 81 | 3300006358 | Ga0068871_100157490 | Ga0068871_1001574902 | 136 |
| 82 | 3300006358 | Ga0068871_101998692 | Ga0068871_1019986921 | 136 |
| 83 | 3300006844 | Ga0075428_101269625 | Ga0075428_1012696251 | 136 |
| 84 | 3300006847 | Ga0075431_100004472 | Ga0075431_1000044728 | 136 |
| 85 | 3300006931 | Ga0097620_100000903 | Ga0097620_1000009034 | 136 |
| 86 | 3300009036 | Ga0105244_10039503 | Ga0105244_100395032 | 136 |
| 87 | 3300009093 | Ga0105240_10000176 | Ga0105240_1000017616 | 136 |
| 88 | 3300009093 | Ga0105240_10192556 | Ga0105240_101925563 | 136 |
| 89 | 3300009093 | Ga0105240_10204324 | Ga0105240_102043242 | 136 |
| 90 | 3300009093 | Ga0105240_10216420 | Ga0105240_102164203 | 136 |
| 91 | 3300009094 | Ga0111539_10022060 | Ga0111539_100220607 | 136 |
| 92 | 3300009094 | Ga0111539_10072731 | Ga0111539_100727314 | 136 |
| 93 | 3300009098 | Ga0105245_10192592 | Ga0105245_101925922 | 136 |
| 94 | 3300009147 | Ga0114129_10188391 | Ga0114129_101883914 | 136 |
| 95 | 3300009174 | Ga0105241_10241727 | Ga0105241_102417272 | 136 |
| 96 | 3300009176 | Ga0105242_11217207 | Ga0105242_112172072 | 136 |
| 97 | 3300009176 | Ga0105242_11987014 | Ga0105242_119870142 | 136 |
| 98 | 3300009545 | Ga0105237_10019910 | Ga0105237_100199105 | 136 |
| 99 | 3300009545 | Ga0105237_10454428 | Ga0105237_104544282 | 136 |
| 100 | 3300009545 | Ga0105237_10586050 | Ga0105237_105860501 | 136 |
| 101 | 3300009551 | Ga0105238_10285139 | Ga0105238_102851392 | 136 |
| 102 | 3300010375 | Ga0105239_10001803 | Ga0105239_1000180312 | 136 |
| 103 | 3300010375 | Ga0105239_10070059 | Ga0105239_100700593 | 136 |
| 104 | 3300013100 | Ga0157373_10000015 | Ga0157373_10000015118 | 136 |
| 105 | 3300013100 | Ga0157373_10000411 | Ga0157373_1000041125 | 136 |
| 106 | 3300013100 | Ga0157373_10002959 | Ga0157373_100029596 | 136 |
| 107 | 3300013100 | Ga0157373_10010302 | Ga0157373_100103024 | 136 |
| 108 | 3300013102 | Ga0157371_10000027 | Ga0157371_1000002795 | 136 |
| 109 | 3300013102 | Ga0157371_10009379 | Ga0157371_100093792 | 136 |
| 110 | 3300013102 | Ga0157371_10031191 | Ga0157371_100311912 | 136 |
| 111 | 3300013102 | Ga0157371_10034841 | Ga0157371_100348413 | 136 |
| 112 | 3300013104 | Ga0157370_10015500 | Ga0157370_100155007 | 136 |
| 113 | 3300013104 | Ga0157370_10323485 | Ga0157370_103234852 | 136 |
| 114 | 3300013104 | Ga0157370_10367107 | Ga0157370_103671071 | 136 |
| 115 | 3300013104 | Ga0157370_10368082 | Ga0157370_103680821 | 136 |
| 116 | 3300013104 | Ga0157370_11433165 | Ga0157370_114331651 | 136 |
| 117 | 3300013104 | Ga0157370_11520373 | Ga0157370_115203731 | 136 |
| 118 | 3300013104 | Ga0157370_11911615 | Ga0157370_119116151 | 136 |
| 119 | 3300013105 | Ga0157369_10000053 | Ga0157369_1000005359 | 136 |
| 120 | 3300013105 | Ga0157369_10402097 | Ga0157369_104020973 | 136 |
| 121 | 3300013105 | Ga0157369_11031573 | Ga0157369_110315732 | 136 |
| 122 | 3300013105 | Ga0157369_11427477 | Ga0157369_114274772 | 136 |
| 123 | 3300013105 | Ga0157369_11495280 | Ga0157369_114952801 | 136 |
| 124 | 3300013296 | Ga0157374_10748883 | Ga0157374_107488832 | 136 |
| 125 | 3300013296 | Ga0157374_12266014 | Ga0157374_122660142 | 136 |
| 126 | 3300013297 | Ga0157378_10022322 | Ga0157378_100223224 | 136 |
| 127 | 3300013297 | Ga0157378_10120579 | Ga0157378_101205793 | 136 |
| 128 | 3300013297 | Ga0157378_12051458 | Ga0157378_120514581 | 136 |
| 129 | 3300013306 | Ga0163162_10000184 | Ga0163162_1000018440 | 136 |
| 130 | 3300013306 | Ga0163162_10025494 | Ga0163162_100254944 | 136 |
| 131 | 3300013306 | Ga0163162_10160557 | Ga0163162_101605573 | 136 |
| 132 | 3300013306 | Ga0163162_11181682 | Ga0163162_111816821 | 136 |
| 133 | 3300013307 | Ga0157372_10006025 | Ga0157372_100060253 | 136 |
| 134 | 3300013307 | Ga0157372_10073245 | Ga0157372_100732453 | 136 |
| 135 | 3300013307 | Ga0157372_10173414 | Ga0157372_101734143 | 136 |
| 136 | 3300013307 | Ga0157372_10220013 | Ga0157372_102200134 | 136 |
| 137 | 3300013307 | Ga0157372_10236146 | Ga0157372_102361462 | 136 |
| 138 | 3300013307 | Ga0157372_10371460 | Ga0157372_103714601 | 136 |
| 139 | 3300013308 | Ga0157375_10013302 | Ga0157375_100133022 | 136 |
| 140 | 3300013308 | Ga0157375_10114902 | Ga0157375_101149022 | 136 |
| 141 | 3300013308 | Ga0157375_10256514 | Ga0157375_102565145 | 136 |
| 142 | 3300013308 | Ga0157375_10504834 | Ga0157375_105048342 | 136 |
| 143 | 3300013308 | Ga0157375_13269663 | Ga0157375_132696631 | 136 |
| 144 | 3300014325 | Ga0163163_10362058 | Ga0163163_103620582 | 136 |
| 145 | 3300014497 | Ga0182008_10000001 | Ga0182008_10000001383 | 136 |
| 146 | 3300014497 | Ga0182008_10000005 | Ga0182008_100000058 | 136 |
| 147 | 3300014497 | Ga0182008_10000221 | Ga0182008_1000022138 | 136 |
| 148 | 3300014969 | Ga0157376_10463362 | Ga0157376_104633622 | 136 |
| 149 | 3300015261 | Ga0182006_1000126 | Ga0182006_100012646 | 136 |
| 150 | 3300015261 | Ga0182006_1000296 | Ga0182006_100029613 | 136 |
| 151 | 3300015261 | Ga0182006_1002358 | Ga0182006_10023584 | 136 |
| 152 | 3300015261 | Ga0182006_1047249 | Ga0182006_10472491 | 136 |
| 153 | 3300015262 | Ga0182007_10000005 | Ga0182007_10000005355 | 136 |
| 154 | 3300015682 | Ga0183373_1007 | Ga0183373_1007129 | 136 |
| 155 | 3300017792 | Ga0163161_10000182 | Ga0163161_1000018213 | 136 |
| 156 | 3300017792 | Ga0163161_10000182 | Ga0163161_1000018258 | 136 |
| 157 | 3300017792 | Ga0163161_10000350 | Ga0163161_100003507 | 136 |
| 158 | 3300017792 | Ga0163161_10000485 | Ga0163161_100004853 | 136 |
| 159 | 3300017792 | Ga0163161_10019485 | Ga0163161_100194856 | 136 |
| 160 | 3300017792 | Ga0163161_10062388 | Ga0163161_100623882 | 136 |
| 161 | 3300017792 | Ga0163161_10081442 | Ga0163161_100814422 | 136 |
| 162 | 3300017792 | Ga0163161_10249972 | Ga0163161_102499722 | 136 |
| 163 | 3300017792 | Ga0163161_10367874 | Ga0163161_103678741 | 136 |
| 164 | 3300017792 | Ga0163161_10592639 | Ga0163161_105926392 | 136 |
| 165 | 3300025245 | Ga0207425_1000008 | Ga0207425_1000008311 | 136 |
| 166 | 3300025258 | Ga0209129_1000042 | Ga0209129_100004246 | 136 |
| 167 | 3300025292 | Ga0209676_1000039 | Ga0209676_100003976 | 136 |
| 168 | 3300025294 | Ga0209025_1000020 | Ga0209025_1000020311 | 136 |
| 169 | 3300025297 | Ga0209758_1000022 | Ga0209758_1000022311 | 136 |
| 170 | 3300025298 | Ga0209050_1000033 | Ga0209050_1000033373 | 136 |
| 171 | 3300025893 | Ga0207682_10042964 | Ga0207682_100429643 | 136 |
| 172 | 3300025899 | Ga0207642_10262829 | Ga0207642_102628292 | 136 |
| 173 | 3300025903 | Ga0207680_10075935 | Ga0207680_100759353 | 136 |
| 174 | 3300025904 | Ga0207647_10059331 | Ga0207647_100593312 | 136 |
| 175 | 3300025911 | Ga0207654_10338827 | Ga0207654_103388272 | 136 |
| 176 | 3300025913 | Ga0207695_10000102 | Ga0207695_10000102128 | 136 |
| 177 | 3300025913 | Ga0207695_10035087 | Ga0207695_100350876 | 136 |
| 178 | 3300025913 | Ga0207695_10051229 | Ga0207695_100512292 | 136 |
| 179 | 3300025913 | Ga0207695_10324995 | Ga0207695_103249952 | 136 |
| 180 | 3300025914 | Ga0207671_10000725 | Ga0207671_1000072539 | 136 |
| 181 | 3300025914 | Ga0207671_10223545 | Ga0207671_102235452 | 136 |
| 182 | 3300025914 | Ga0207671_11471370 | Ga0207671_114713701 | 136 |
| 183 | 3300025920 | Ga0207649_10457707 | Ga0207649_104577072 | 136 |
| 184 | 3300025920 | Ga0207649_10694123 | Ga0207649_106941232 | 136 |
| 185 | 3300025923 | Ga0207681_10777415 | Ga0207681_107774152 | 136 |
| 186 | 3300025924 | Ga0207694_10198146 | Ga0207694_101981462 | 136 |
| 187 | 3300025925 | Ga0207650_10105298 | Ga0207650_101052982 | 136 |
| 188 | 3300025926 | Ga0207659_11247960 | Ga0207659_112479601 | 136 |
| 189 | 3300025927 | Ga0207687_11584674 | Ga0207687_115846741 | 136 |
| 190 | 3300025931 | Ga0207644_10274583 | Ga0207644_102745832 | 136 |
| 191 | 3300025933 | Ga0207706_10782780 | Ga0207706_107827802 | 136 |
| 192 | 3300025934 | Ga0207686_11002317 | Ga0207686_110023172 | 136 |
| 193 | 3300025936 | Ga0207670_10276539 | Ga0207670_102765392 | 136 |
| 194 | 3300025937 | Ga0207669_10046087 | Ga0207669_100460872 | 136 |
| 195 | 3300025940 | Ga0207691_10083841 | Ga0207691_100838412 | 136 |
| 196 | 3300025940 | Ga0207691_10096698 | Ga0207691_100966984 | 136 |
| 197 | 3300025940 | Ga0207691_10542954 | Ga0207691_105429541 | 136 |
| 198 | 3300025942 | Ga0207689_10460783 | Ga0207689_104607832 | 136 |
| 199 | 3300025944 | Ga0207661_10040743 | Ga0207661_100407432 | 136 |
| 200 | 3300025945 | Ga0207679_10120444 | Ga0207679_101204441 | 136 |
| 201 | 3300025949 | Ga0207667_11497506 | Ga0207667_114975061 | 136 |
| 202 | 3300025960 | Ga0207651_11040110 | Ga0207651_110401102 | 136 |
| 203 | 3300025972 | Ga0207668_10562245 | Ga0207668_105622451 | 136 |
| 204 | 3300025981 | Ga0207640_11451309 | Ga0207640_114513092 | 136 |
| 205 | 3300026041 | Ga0207639_10017064 | Ga0207639_100170643 | 136 |
| 206 | 3300026041 | Ga0207639_10018418 | Ga0207639_100184183 | 136 |
| 207 | 3300026041 | Ga0207639_11681521 | Ga0207639_116815211 | 136 |
| 208 | 3300026067 | Ga0207678_10805798 | Ga0207678_108057982 | 136 |
| 209 | 3300026088 | Ga0207641_10124012 | Ga0207641_101240124 | 136 |
| 210 | 3300026088 | Ga0207641_11163241 | Ga0207641_111632411 | 136 |
| 211 | 3300026089 | Ga0207648_10893516 | Ga0207648_108935162 | 136 |
| 212 | 3300026095 | Ga0207676_10269886 | Ga0207676_102698862 | 136 |
| 213 | 3300026116 | Ga0207674_11718241 | Ga0207674_117182411 | 136 |
| 214 | 3300026118 | Ga0207675_100222882 | Ga0207675_1002228822 | 136 |
| 215 | 3300026121 | Ga0207683_10030725 | Ga0207683_100307254 | 136 |
| 216 | 3300026121 | Ga0207683_10458896 | Ga0207683_104588961 | 136 |
| 217 | 3300026121 | Ga0207683_11031788 | Ga0207683_110317882 | 136 |
| 218 | 3300026121 | Ga0207683_11255560 | Ga0207683_112555601 | 136 |
| 219 | 3300026142 | Ga0207698_10153708 | Ga0207698_101537083 | 136 |
| 220 | 3300026142 | Ga0207698_10196149 | Ga0207698_101961492 | 136 |
| 221 | 3300026142 | Ga0207698_12370136 | Ga0207698_123701361 | 136 |
| 222 | 3300027876 | Ga0209974_10158458 | Ga0209974_101584582 | 136 |
| 223 | 3300027907 | Ga0207428_10151152 | Ga0207428_101511523 | 136 |
| 224 | 3300028379 | Ga0268266_10018627 | Ga0268266_100186276 | 136 |
| 225 | 3300028381 | Ga0268264_10471558 | Ga0268264_104715581 | 136 |
| 226 | 3300028577 | Ga0265318_10218800 | Ga0265318_102188002 | 136 |
| 227 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000013221 | 136 |
| 228 | 3300029957 | Ga0265324_10014351 | Ga0265324_100143511 | 136 |
| 229 | 3300029957 | Ga0265324_10016058 | Ga0265324_100160583 | 136 |
| 230 | 3300031239 | Ga0265328_10160323 | Ga0265328_101603232 | 136 |
| 231 | 3300031240 | Ga0265320_10500868 | Ga0265320_105008681 | 136 |
| 232 | 3300031250 | Ga0265331_10146565 | Ga0265331_101465652 | 136 |
| 233 | 3300031250 | Ga0265331_10207302 | Ga0265331_102073022 | 136 |
| 234 | 3300031250 | Ga0265331_10458727 | Ga0265331_104587271 | 136 |
| 235 | 3300031251 | Ga0265327_10000009 | Ga0265327_10000009500 | 136 |
| 236 | 3300031251 | Ga0265327_10000212 | Ga0265327_1000021249 | 136 |
| 237 | 3300031251 | Ga0265327_10002369 | Ga0265327_100023698 | 136 |
| 238 | 3300031251 | Ga0265327_10039518 | Ga0265327_100395182 | 136 |
| 239 | 3300031507 | Ga0307509_10665784 | Ga0307509_106657841 | 136 |
| 240 | 3300031548 | Ga0307408_100602654 | Ga0307408_1006026542 | 136 |
| 241 | 3300031711 | Ga0265314_10011723 | Ga0265314_100117237 | 136 |
| 242 | 3300031711 | Ga0265314_10425853 | Ga0265314_104258532 | 136 |
| 243 | 3300031712 | Ga0265342_10239490 | Ga0265342_102394902 | 136 |
| 244 | 3300031731 | Ga0307405_10000068 | Ga0307405_1000006835 | 136 |
| 245 | 3300031731 | Ga0307405_10170887 | Ga0307405_101708872 | 136 |
| 246 | 3300031731 | Ga0307405_10815480 | Ga0307405_108154802 | 136 |
| 247 | 3300031852 | Ga0307410_10207071 | Ga0307410_102070712 | 136 |
| 248 | 3300031852 | Ga0307410_10700006 | Ga0307410_107000062 | 136 |
| 249 | 3300031901 | Ga0307406_10795170 | Ga0307406_107951702 | 136 |
| 250 | 3300031903 | Ga0307407_10000001 | Ga0307407_10000001113 | 136 |
| 251 | 3300031911 | Ga0307412_10000017 | Ga0307412_10000017198 | 136 |
| 252 | 3300031911 | Ga0307412_10065611 | Ga0307412_100656113 | 136 |
| 253 | 3300031911 | Ga0307412_10175521 | Ga0307412_101755211 | 136 |
| 254 | 3300031995 | Ga0307409_100031312 | Ga0307409_1000313122 | 136 |
| 255 | 3300032002 | Ga0307416_100000008 | Ga0307416_100000008276 | 136 |
| 256 | 3300032002 | Ga0307416_100717931 | Ga0307416_1007179311 | 136 |
| 257 | 3300032002 | Ga0307416_100775558 | Ga0307416_1007755582 | 136 |
| 258 | 3300032004 | Ga0307414_10006755 | Ga0307414_100067552 | 136 |
| 259 | 3300032004 | Ga0307414_10372537 | Ga0307414_103725371 | 136 |
| 260 | 3300032004 | Ga0307414_10442509 | Ga0307414_104425092 | 136 |
| 261 | 3300032005 | Ga0307411_10864827 | Ga0307411_108648271 | 136 |
| 262 | 3300032126 | Ga0307415_101192356 | Ga0307415_1011923561 | 136 |
| 263 | 3300037466 | Ga0395898_0400196 | Ga0395898_0400196_270_680 | 136 |
| 264 | 3300037471 | Ga0395905_0106078 | Ga0395905_0106078_1944_2354 | 136 |
| 265 | 3300039437 | Ga0436365_1585623 | Ga0436365_1585623_632_1042 | 136 |
| 266 | 3300041443 | Ga0451789_1297146 | Ga0451789_1297146_57_467 | 136 |
| 267 | 3300041486 | Ga0451807_0579978 | Ga0451807_0579978_261_680 | 136 |
| 268 | 3300041496 | Ga0451839_1140327 | Ga0451839_1140327_251_667 | 136 |
| 269 | 3300041509 | Ga0451843_1407527 | Ga0451843_1407527_122_538 | 136 |
| 270 | 3300044712 | Ga0453684_0026988 | Ga0453684_0026988_3386_3796 | 136 |
| 271 | 3300045049 | Ga0466959_0362458 | Ga0466959_0362458_56_466 | 136 |
| 272 | 3300045051 | Ga0451576_0320150 | Ga0451576_0320150_207_617 | 136 |
| 273 | 3300046471 | Ga0495650_0177387 | Ga0495650_0177387_151_561 | 136 |
| 274 | 3300046477 | Ga0495664_0552591 | Ga0495664_0552591_148_576 | 136 |
| 275 | 3300046507 | Ga0495606_0046429 | Ga0495606_0046429_2224_2640 | 136 |
| 276 | 3300046512 | Ga0495610_0000108 | Ga0495610_0000108_83328_83744 | 136 |
| 277 | 3300046512 | Ga0495610_0001498 | Ga0495610_0001498_18306_18722 | 136 |
| 278 | 3300046520 | Ga0495637_0017756 | Ga0495637_0017756_2659_3075 | 136 |
| 279 | 3300046525 | Ga0495663_0000030 | Ga0495663_0000030_55380_55799 | 136 |
| 280 | 3300046537 | Ga0495598_0010249 | Ga0495598_0010249_420_836 | 136 |
| 281 | 3300046538 | Ga0495609_0196973 | Ga0495609_0196973_327_743 | 136 |
| 282 | 3300046558 | Ga0495633_0079088 | Ga0495633_0079088_742_1182 | 136 |
| 283 | 3300046559 | Ga0495667_0586743 | Ga0495667_0586743_95_523 | 136 |
| 284 | 3300046663 | Ga0495635_0026156 | Ga0495635_0026156_144_572 | 136 |
| 285 | 3300046809 | Ga0495600_0395872 | Ga0495600_0395872_385_813 | 136 |
| 286 | 3300047318 | Ga0495636_0000044 | Ga0495636_0000044_47649_48059 | 136 |
| 287 | 3300047319 | Ga0495674_0524685 | Ga0495674_0524685_158_586 | 136 |
| 288 | 3300047320 | Ga0495672_0026923 | Ga0495672_0026923_1014_1424 | 136 |
| 289 | 3300047320 | Ga0495672_0102837 | Ga0495672_0102837_400_810 | 136 |
| 290 | 3300047320 | Ga0495672_0334203 | Ga0495672_0334203_237_653 | 136 |
| 291 | 3300047472 | Ga0495686_0133374 | Ga0495686_0133374_577_993 | 136 |
| 292 | 3300048911 | Ga0496108_0663522 | Ga0496108_0663522_280_696 | 136 |
| 293 | 3300048913 | Ga0496110_1234019 | Ga0496110_1234019_135_551 | 136 |
| 294 | 3300048917 | Ga0496114_0026017 | Ga0496114_0026017_1571_1987 | 136 |
| 295 | 3300048917 | Ga0496114_1192485 | Ga0496114_1192485_88_504 | 136 |
| 296 | 3300048918 | Ga0496115_0001141 | Ga0496115_0001141_10113_10523 | 136 |
| 297 | 3300048927 | Ga0496124_0269058 | Ga0496124_0269058_704_1117 | 136 |
| 298 | 3300049513 | Ga0501290_019923 | Ga0501290_019923_469_888 | 136 |
| 299 | 3300049520 | Ga0501297_041022 | Ga0501297_041022_194_607 | 136 |
| 300 | 3300049652 | Ga0501202_055817 | Ga0501202_055817_423_842 | 136 |
| 301 | 3300049652 | Ga0501202_157334 | Ga0501202_157334_85_498 | 136 |
| 302 | 3300049654 | Ga0501207_062742 | Ga0501207_062742_186_599 | 136 |
| 303 | 3300049663 | Ga0501223_049902 | Ga0501223_049902_313_732 | 136 |
| 304 | 3300049665 | Ga0501227_030541 | Ga0501227_030541_603_1022 | 136 |
| 305 | 3300049667 | Ga0501230_099009 | Ga0501230_099009_103_516 | 136 |
| 306 | 3300049668 | Ga0501233_009369 | Ga0501233_009369_438_857 | 136 |
| 307 | 3300049669 | Ga0501235_047110 | Ga0501235_047110_460_870 | 136 |
| 308 | 3300049675 | Ga0501243_088765 | Ga0501243_088765_108_527 | 136 |
| 309 | 3300049679 | Ga0501249_018888 | Ga0501249_018888_77_493 | 136 |
| 310 | 3300049682 | Ga0501252_056140 | Ga0501252_056140_82_495 | 136 |
| 311 | 3300049686 | Ga0501257_012152 | Ga0501257_012152_690_1103 | 136 |
| 312 | 3300049742 | Ga0501080_0731265 | Ga0501080_0731265_384_797 | 136 |
| 313 | 3300049757 | Ga0501232_033856 | Ga0501232_033856_98_511 | 136 |
| 314 | 3300049760 | Ga0501263_079225 | Ga0501263_079225_25_435 | 136 |
| 315 | 3300049763 | Ga0501266_021876 | Ga0501266_021876_339_758 | 136 |
| 316 | 3300049765 | Ga0501268_071611 | Ga0501268_071611_35_448 | 136 |
| 317 | 3300049775 | Ga0501279_014273 | Ga0501279_014273_61_480 | 136 |
| 318 | 3300049822 | Ga0501035_0072144 | Ga0501035_0072144_160_570 | 136 |
| 319 | 3300049823 | Ga0501044_0137831 | Ga0501044_0137831_858_1268 | 136 |
| 320 | 3300049823 | Ga0501044_0886995 | Ga0501044_0886995_138_548 | 136 |
| 321 | 3300050507 | nmdc:mga05p37_233229_c1 | nmdc:mga05p37_233229_c1_1788_2198 | 136 |
| 322 | 3300050511 | nmdc:mga08y16_38517_c1 | nmdc:mga08y16_38517_c1_4487_4912 | 136 |
| 323 | 3300053093 | Ga0500651_0002128 | Ga0500651_0002128_382_792 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9627 | 1 | 136 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.9606 | 1 | 135 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9559 | 1 | 136 |
| 1nye-assembly2.cif.gz_D | crystal structure of osmc from e. coli | 0.9504 | 1 | 135 |
| 1nye-assembly2.cif.gz_C | crystal structure of osmc from e. coli | 0.9477 | 1 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9492 | 1 | 135 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9357 | 1 | 135 | 3.30.300.20 |
| af_Q57993_77_188_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8991 | 42 | 135 | 3.30.300.20 |
| 1lqlE02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8892 | 43 | 136 | 3.30.300.20 |
| 1ml8A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8828 | 45 | 136 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258Y8I4-F1-model_v4 | OsmC family peroxiredoxin | 0.9959 | 51 | 136 |
GO:0004601
GO:0006979 |
| AF-A0A2W5FXT9-F1-model_v4 | OsmC family peroxiredoxin | 0.991 | 43 | 136 |
GO:0004601
GO:0006979 |
| AF-A0A257KYW8-F1-model_v4 | OsmC family peroxiredoxin | 0.989 | 42 | 136 |
GO:0004601
GO:0006979 |
| AF-A0A2A2KGB6-F1-model_v4 | Uncharacterized protein | 0.9868 | 60 | 136 |
GO:0004601
GO:0006979 |
| AF-A0A5U9RK24-F1-model_v4 | deleted | 0.9854 | 54 | 136 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar