F406887

General Info

Members Datasets Scaffolds Average Seq Length
323 210 309 138

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10192556|Ga0105240_101925563
Length 163
Sequence VDYQFMKPSPVMGNTPRVYYLYKKNNLMRRNASAVWNGSGKEGSGHLTTQSTVLNKTQYSFGSRFENGVGTNPEELLAAAHAGCYTMQLSFTLNAAGFTADEIDTNCHVTIENGTITKSELTVRAKIPNIDNEKFMEAATYAKDNCPVSKLFNCEKTLDAALV

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2739367651 Pedobacter sp. OK291 Isolate Unclassified
6 2739367656 Pedobacter sp. CF523 Isolate Unclassified
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2818991437 Pedobacter terrae 518 Isolate Unclassified
9 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
10 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
11 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
12 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
13 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
14 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
15 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
16 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
162 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
188 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
189 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
190 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
191 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
192 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
193 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
194 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
195 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
196 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
197 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
198 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
199 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
202 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
203 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
204 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
205 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.98
Metatranscriptomes 0
Isolates 4.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 0
Rhizoplane 2.17
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 4.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1518 2124908027 Bacteria 895
2 SwRhRL2b_contig_3893312 2162886007 Bacteria 22472
3 JGI25152J39213_1000007 3300002773 Bacteria 156012
4 JGI25150J39212_1000013 3300002774 Bacteria 182307
5 JGI25151J46595_10000004 3300003187 Bacteria 494006
6 JGI25153J46596_10000004 3300003215 Bacteria 494006
7 Ga0055536_1000071 3300003781 Bacteria 93563
8 Ga0055530_10007326 3300003791 Bacteria 4676
9 Ga0065714_10004484 3300005288 Bacteria 19587
10 Ga0065714_10004833 3300005288 Bacteria 4399
11 Ga0065714_10065441 3300005288 Bacteria 10062
12 Ga0065714_10065694 3300005288 Bacteria 8840
13 Ga0065714_10098657 3300005288 Bacteria 1705
14 Ga0065714_10477696 3300005288 Bacteria 537
15 Ga0065714_10529251 3300005288 Bacteria 508
16 Ga0065704_10000199 3300005289 Bacteria 297176
17 Ga0065704_10521425 3300005289 Bacteria 653
18 Ga0065715_11038633 3300005293 Bacteria 535
19 Ga0070683_100139689 3300005329 Bacteria 2295
20 Ga0070683_100528751 3300005329 Unclassified 1127
21 Ga0070690_100269691 3300005330 Bacteria 1210
22 Ga0070670_100910318 3300005331 Bacteria 798
23 Ga0070670_101025143 3300005331 Bacteria 751
24 Ga0068869_100529675 3300005334 Bacteria 987
25 Ga0070666_10009910 3300005335 Bacteria 5947
26 Ga0070682_100000008 3300005337 Bacteria 322125
27 Ga0070682_100184081 3300005337 Bacteria 1461
28 Ga0070682_100937401 3300005337 Bacteria 714
29 Ga0070687_100664341 3300005343 Unclassified 724
30 Ga0070661_100277524 3300005344 Bacteria 1299
31 Ga0070668_100314787 3300005347 Bacteria 1316
32 Ga0070669_100131452 3300005353 Bacteria 1921
33 Ga0070675_100507471 3300005354 Bacteria 1087
34 Ga0070675_101062096 3300005354 Bacteria 744
35 Ga0070671_100239199 3300005355 Bacteria 1541
36 Ga0070674_100076979 3300005356 Bacteria 2373
37 Ga0070667_101847932 3300005367 Bacteria 569
38 Ga0070678_100019306 3300005456 Bacteria 4440
39 Ga0070678_101083320 3300005456 Bacteria 739
40 Ga0070662_100199642 3300005457 Bacteria 1586
41 Ga0068867_100707744 3300005459 Bacteria 889
42 Ga0070684_100182599 3300005535 Bacteria 1908
43 Ga0068853_100007037 3300005539 Bacteria 8992
44 Ga0068853_100040505 3300005539 Bacteria 3975
45 Ga0070672_100501252 3300005543 Bacteria 1050
46 Ga0070686_100321135 3300005544 Bacteria 1154
47 Ga0070665_100027588 3300005548 Bacteria 5719
48 Ga0068855_100378707 3300005563 Bacteria 1554
49 Ga0068855_101811009 3300005563 Unclassified 620
50 Ga0070664_100429184 3300005564 Bacteria 1211
51 Ga0068857_102176731 3300005577 Bacteria 544
52 Ga0068854_100881911 3300005578 Bacteria 785
53 Ga0068854_102258581 3300005578 Bacteria 504
54 Ga0068852_100163513 3300005616 Bacteria 2080
55 Ga0068852_100206489 3300005616 Bacteria 1861
56 Ga0068852_100844918 3300005616 Bacteria 931
57 Ga0068859_100000903 3300005617 Bacteria 30294
58 Ga0068861_100186992 3300005719 Bacteria 1728
59 Ga0068861_102366950 3300005719 Bacteria 534
60 Ga0068851_10467281 3300005834 Bacteria 752
61 Ga0068863_100659086 3300005841 Bacteria 1038
62 Ga0068860_100244156 3300005843 Unclassified 1747
63 Ga0068862_100587355 3300005844 Bacteria 1068
64 Ga0070717_10944570 3300006028 Bacteria 785
65 Ga0097621_100032088 3300006237 Bacteria 4173
66 Ga0068871_100157490 3300006358 Bacteria 1940
67 Ga0068871_101998692 3300006358 Bacteria 552
68 Ga0075428_101269625 3300006844 Bacteria 775
69 Ga0075431_100004472 3300006847 Bacteria 13717
70 Ga0097620_100000903 3300006931 Bacteria 30294
71 Ga0105244_10039503 3300009036 Bacteria 2456
72 Ga0105240_10000176 3300009093 Bacteria 130109
73 Ga0105240_10192556 3300009093 Unclassified 2396
74 Ga0105240_10204324 3300009093 Bacteria 2313
75 Ga0105240_10216420 3300009093 Bacteria 2235
76 Ga0111539_10022060 3300009094 Bacteria 7825
77 Ga0111539_10072731 3300009094 Bacteria 4054
78 Ga0105245_10192592 3300009098 Bacteria 1954
79 Ga0114129_10188391 3300009147 Bacteria 2803
80 Ga0105241_10241727 3300009174 Bacteria 1526
81 Ga0105242_11217207 3300009176 Bacteria 773
82 Ga0105242_11987014 3300009176 Bacteria 623
83 Ga0105237_10019910 3300009545 Bacteria 6927
84 Ga0105237_10454428 3300009545 Unclassified 1287
85 Ga0105237_10586050 3300009545 Bacteria 1122
86 Ga0105238_10285139 3300009551 Bacteria 1633
87 Ga0105239_10001803 3300010375 Bacteria 28139
88 Ga0105239_10070059 3300010375 Bacteria 3852
89 Ga0157373_10000015 3300013100 Bacteria 183381
90 Ga0157373_10000411 3300013100 Bacteria 34442
91 Ga0157373_10002959 3300013100 Bacteria 12870
92 Ga0157373_10010302 3300013100 Bacteria 6887
93 Ga0157371_10000027 3300013102 Bacteria 269243
94 Ga0157371_10009379 3300013102 Bacteria 7707
95 Ga0157371_10031191 3300013102 Bacteria 3840
96 Ga0157371_10034841 3300013102 Bacteria 3609
97 Ga0157370_10015500 3300013104 Bacteria 7750
98 Ga0157370_10266718 3300013104 Bacteria 1582
99 Ga0157370_10323485 3300013104 Bacteria 1422
100 Ga0157370_10367107 3300013104 Bacteria 1326
101 Ga0157370_10368082 3300013104 Bacteria 1324
102 Ga0157370_11433165 3300013104 Bacteria 621
103 Ga0157370_11520373 3300013104 Bacteria 602
104 Ga0157370_11911615 3300013104 Unclassified 532
105 Ga0157369_10000053 3300013105 Bacteria 162962
106 Ga0157369_10402097 3300013105 Unclassified 1421
107 Ga0157369_11031573 3300013105 Bacteria 842
108 Ga0157369_11427477 3300013105 Bacteria 704
109 Ga0157369_11495280 3300013105 Bacteria 687
110 Ga0157374_10748883 3300013296 Unclassified 992
111 Ga0157374_12266014 3300013296 Bacteria 570
112 Ga0157378_10022322 3300013297 Bacteria 5571
113 Ga0157378_10120579 3300013297 Bacteria 2417
114 Ga0157378_12051458 3300013297 Bacteria 622
115 Ga0163162_10000184 3300013306 Bacteria 57899
116 Ga0163162_10025494 3300013306 Bacteria 5842
117 Ga0163162_10160557 3300013306 Bacteria 2369
118 Ga0163162_11181682 3300013306 Bacteria 868
119 Ga0157372_10006025 3300013307 Bacteria 12875
120 Ga0157372_10073245 3300013307 Bacteria 3861
121 Ga0157372_10173414 3300013307 Bacteria 2495
122 Ga0157372_10220013 3300013307 Bacteria 2201
123 Ga0157372_10236146 3300013307 Bacteria 2121
124 Ga0157372_10371460 3300013307 Unclassified 1666
125 Ga0157375_10013302 3300013308 Bacteria 7319
126 Ga0157375_10114902 3300013308 Bacteria 2794
127 Ga0157375_10256514 3300013308 Bacteria 1910
128 Ga0157375_10504834 3300013308 Bacteria 1373
129 Ga0157375_13269663 3300013308 Bacteria 540
130 Ga0163163_10362058 3300014325 Bacteria 1507
131 Ga0182008_10000001 3300014497 Bacteria 540790
132 Ga0182008_10000005 3300014497 Bacteria 386556
133 Ga0182008_10000221 3300014497 Bacteria 44804
134 Ga0157376_10463362 3300014969 Bacteria 1239
135 Ga0182006_1000126 3300015261 Bacteria 81813
136 Ga0182006_1000296 3300015261 Bacteria 43777
137 Ga0182006_1002358 3300015261 Bacteria 10369
138 Ga0182006_1047249 3300015261 Bacteria 1670
139 Ga0182007_10000005 3300015262 Bacteria 442702
140 Ga0183373_1007 3300015682 Bacteria 282776
141 Ga0163161_10000182 3300017792 Bacteria 57700
142 Ga0163161_10000350 3300017792 Bacteria 39043
143 Ga0163161_10000485 3300017792 Bacteria 32611
144 Ga0163161_10019485 3300017792 Bacteria 4761
145 Ga0163161_10062388 3300017792 Bacteria 2715
146 Ga0163161_10081442 3300017792 Bacteria 2384
147 Ga0163161_10249972 3300017792 Bacteria 1382
148 Ga0163161_10367874 3300017792 Bacteria 1146
149 Ga0163161_10592639 3300017792 Bacteria 913
150 Ga0207425_1000008 3300025245 Bacteria 618024
151 Ga0209129_1000042 3300025258 Bacteria 305537
152 Ga0209676_1000039 3300025292 Bacteria 443158
153 Ga0209025_1000020 3300025294 Bacteria 618024
154 Ga0209758_1000022 3300025297 Bacteria 618024
155 Ga0209050_1000033 3300025298 Bacteria 442615
156 Ga0207682_10042964 3300025893 Bacteria 1848
157 Ga0207642_10262829 3300025899 Bacteria 985
158 Ga0207680_10075935 3300025903 Unclassified 2097
159 Ga0207647_10059331 3300025904 Bacteria 2342
160 Ga0207654_10338827 3300025911 Bacteria 1032
161 Ga0207695_10000102 3300025913 Bacteria 257838
162 Ga0207695_10035087 3300025913 Bacteria 5444
163 Ga0207695_10051229 3300025913 Bacteria 4337
164 Ga0207695_10324995 3300025913 Bacteria 1427
165 Ga0207671_10000725 3300025914 Bacteria 41972
166 Ga0207671_10223545 3300025914 Unclassified 1475
167 Ga0207671_11471370 3300025914 Bacteria 526
168 Ga0207649_10457707 3300025920 Bacteria 964
169 Ga0207649_10694123 3300025920 Bacteria 789
170 Ga0207681_10777415 3300025923 Unclassified 799
171 Ga0207694_10198146 3300025924 Bacteria 1633
172 Ga0207650_10105298 3300025925 Unclassified 2177
173 Ga0207659_11247960 3300025926 Bacteria 638
174 Ga0207687_11584674 3300025927 Bacteria 562
175 Ga0207644_10274583 3300025931 Bacteria 1352
176 Ga0207706_10782780 3300025933 Bacteria 811
177 Ga0207686_11002317 3300025934 Bacteria 678
178 Ga0207670_10276539 3300025936 Bacteria 1307
179 Ga0207669_10046087 3300025937 Bacteria 2574
180 Ga0207691_10083841 3300025940 Bacteria 2861
181 Ga0207691_10096698 3300025940 Bacteria 2640
182 Ga0207691_10542954 3300025940 Bacteria 986
183 Ga0207689_10460783 3300025942 Bacteria 1063
184 Ga0207661_10040743 3300025944 Bacteria 3653
185 Ga0207679_10120444 3300025945 Bacteria 2088
186 Ga0207667_11497506 3300025949 Unclassified 646
187 Ga0207651_11040110 3300025960 Unclassified 733
188 Ga0207668_10562245 3300025972 Bacteria 989
189 Ga0207640_11451309 3300025981 Bacteria 615
190 Ga0207639_10017064 3300026041 Bacteria 5143
191 Ga0207639_10018418 3300026041 Bacteria 4961
192 Ga0207639_11681521 3300026041 Unclassified 595
193 Ga0207678_10805798 3300026067 Bacteria 829
194 Ga0207641_10124012 3300026088 Bacteria 2310
195 Ga0207641_11163241 3300026088 Bacteria 771
196 Ga0207648_10893516 3300026089 Bacteria 830
197 Ga0207676_10269886 3300026095 Bacteria 1540
198 Ga0207674_11718241 3300026116 Bacteria 595
199 Ga0207675_100222882 3300026118 Bacteria 1817
200 Ga0207683_10030725 3300026121 Bacteria 4657
201 Ga0207683_10458896 3300026121 Bacteria 1175
202 Ga0207683_11031788 3300026121 Bacteria 763
203 Ga0207683_11255560 3300026121 Bacteria 686
204 Ga0207698_10153708 3300026142 Bacteria 2001
205 Ga0207698_10196149 3300026142 Bacteria 1804
206 Ga0207698_12370136 3300026142 Bacteria 542
207 Ga0209974_10158458 3300027876 Bacteria 820
208 Ga0207428_10151152 3300027907 Unclassified 1767
209 Ga0268266_10018627 3300028379 Bacteria 5916
210 Ga0268264_10471558 3300028381 Unclassified 1219
211 Ga0265318_10218800 3300028577 Bacteria 696
212 Ga0307515_10000001 3300028794 Bacteria 4259510
213 Ga0265324_10014351 3300029957 Bacteria 2934
214 Ga0265324_10016058 3300029957 Bacteria 2743
215 Ga0265328_10160323 3300031239 Bacteria 848
216 Ga0265320_10500868 3300031240 Unclassified 536
217 Ga0265331_10146565 3300031250 Bacteria 1072
218 Ga0265331_10207302 3300031250 Bacteria 882
219 Ga0265331_10458727 3300031250 Unclassified 573
220 Ga0265327_10000009 3300031251 Bacteria 616360
221 Ga0265327_10000212 3300031251 Bacteria 121556
222 Ga0265327_10002369 3300031251 Bacteria 20069
223 Ga0265327_10039518 3300031251 Bacteria 2562
224 Ga0307509_10665784 3300031507 Bacteria 709
225 Ga0307408_100602654 3300031548 Bacteria 976
226 Ga0265314_10011723 3300031711 Bacteria 7211
227 Ga0265314_10425853 3300031711 Bacteria 712
228 Ga0265342_10239490 3300031712 Bacteria 972
229 Ga0307405_10000068 3300031731 Bacteria 47793
230 Ga0307405_10170887 3300031731 Bacteria 1550
231 Ga0307405_10815480 3300031731 Bacteria 783
232 Ga0307410_10207071 3300031852 Bacteria 1501
233 Ga0307410_10700006 3300031852 Bacteria 854
234 Ga0307406_10795170 3300031901 Bacteria 798
235 Ga0307407_10000001 3300031903 Bacteria 570048
236 Ga0307412_10000017 3300031911 Bacteria 294698
237 Ga0307412_10065611 3300031911 Bacteria 2458
238 Ga0307412_10175521 3300031911 Bacteria 1606
239 Ga0307409_100031312 3300031995 Bacteria 3837
240 Ga0307416_100000008 3300032002 Bacteria 401343
241 Ga0307416_100717931 3300032002 Bacteria 1090
242 Ga0307416_100775558 3300032002 Bacteria 1053
243 Ga0307414_10006755 3300032004 Bacteria 6419
244 Ga0307414_10372537 3300032004 Bacteria 1232
245 Ga0307414_10442509 3300032004 Bacteria 1138
246 Ga0307411_10864827 3300032005 Bacteria 801
247 Ga0307415_101192356 3300032126 Bacteria 717
248 Ga0395898_0400196 3300037466 Bacteria 1309
249 Ga0395905_0106078 3300037471 Unclassified 2638
250 Ga0436365_1585623 3300039437 Bacteria 1545
251 Ga0451789_1297146 3300041443 Unclassified 521
252 Ga0451807_0579978 3300041486 Unclassified 1020
253 Ga0451839_1140327 3300041496 Bacteria 920
254 Ga0451843_1407527 3300041509 Unclassified 700
255 Ga0453684_0026988 3300044712 Bacteria 8265
256 Ga0466959_0362458 3300045049 Unclassified 987
257 Ga0451576_0320150 3300045051 Bacteria 1623
258 Ga0495650_0177387 3300046471 Unclassified 751
259 Ga0495664_0552591 3300046477 Bacteria 686
260 Ga0495606_0046429 3300046507 Bacteria 2871
261 Ga0495610_0000108 3300046512 Bacteria 96839
262 Ga0495610_0001498 3300046512 Bacteria 20534
263 Ga0495637_0017756 3300046520 Bacteria 3308
264 Ga0495663_0000030 3300046525 Bacteria 80154
265 Ga0495598_0010249 3300046537 Bacteria 2241
266 Ga0495609_0000003 3300046538 Bacteria 711547
267 Ga0495609_0196973 3300046538 Bacteria 843
268 Ga0495633_0079088 3300046558 Unclassified 1531
269 Ga0495667_0586743 3300046559 Bacteria 695
270 Ga0495635_0026156 3300046663 Bacteria 4064
271 Ga0495600_0395872 3300046809 Bacteria 860
272 Ga0495636_0000044 3300047318 Bacteria 54580
273 Ga0495674_0524685 3300047319 Bacteria 945
274 Ga0495672_0026923 3300047320 Bacteria 3661
275 Ga0495672_0102837 3300047320 Bacteria 1546
276 Ga0495672_0334203 3300047320 Bacteria 708
277 Ga0495686_0133374 3300047472 Bacteria 1471
278 Ga0496108_0663522 3300048911 Bacteria 906
279 Ga0496110_1234019 3300048913 Unclassified 657
280 Ga0496114_0026017 3300048917 Bacteria 4787
281 Ga0496114_1192485 3300048917 Unclassified 647
282 Ga0496115_0001141 3300048918 Bacteria 19184
283 Ga0496124_0269058 3300048927 Bacteria 1249
284 Ga0501290_019923 3300049513 Bacteria 913
285 Ga0501297_041022 3300049520 Unclassified 652
286 Ga0501202_055817 3300049652 Bacteria 883
287 Ga0501202_157334 3300049652 Bacteria 599
288 Ga0501207_062742 3300049654 Bacteria 684
289 Ga0501223_049902 3300049663 Bacteria 812
290 Ga0501227_030541 3300049665 Bacteria 1291
291 Ga0501230_099009 3300049667 Bacteria 627
292 Ga0501233_009369 3300049668 Bacteria 1908
293 Ga0501235_047110 3300049669 Bacteria 994
294 Ga0501243_088765 3300049675 Bacteria 611
295 Ga0501249_018888 3300049679 Bacteria 1493
296 Ga0501252_056140 3300049682 Bacteria 606
297 Ga0501257_012152 3300049686 Bacteria 1969
298 Ga0501080_0731265 3300049742 Bacteria 871
299 Ga0501232_033856 3300049757 Unclassified 723
300 Ga0501263_079225 3300049760 Bacteria 541
301 Ga0501266_021876 3300049763 Bacteria 877
302 Ga0501268_071611 3300049765 Bacteria 702
303 Ga0501279_014273 3300049775 Bacteria 1092
304 Ga0501035_0072144 3300049822 Bacteria 3057
305 Ga0501044_0137831 3300049823 Bacteria 2430
306 Ga0501044_0886995 3300049823 Unclassified 767
307 nmdc:mga05p37_233229_c1 3300050507 Bacteria 2216
308 nmdc:mga08y16_38517_c1 3300050511 Bacteria 5020
309 Ga0500651_0002128 3300053093 Bacteria 10315

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10266718 Ga0157370_102667181 116
2 3300046538 Ga0495609_0000003 Ga0495609_0000003_501159_501623 116
3 iso_pu_bacteria 2585427687 2586209164 132
4 iso_pu_bacteria 2738541302 2738854672 132
5 iso_pu_bacteria 2739367651 2739587198 132
6 iso_pu_bacteria 2739367656 2739617556 132
7 iso_pu_bacteria 2739367663 2739648010 132
8 iso_pu_bacteria 2818991437 2819547657 132
9 iso_pu_bacteria 2842722452 2842726671 132
10 iso_pu_bacteria 2842909656 2842911514 132
11 iso_pu_bacteria 2849281842 2849284141 132
12 iso_pu_bacteria 2857627736 2857630000 132
13 iso_pu_bacteria 2904445276 2904449617 132
14 iso_pu_bacteria 2945997725 2946003019 132
15 iso_pu_bacteria 2954016120 2954019890 132
16 2124908027 MRS2a_Contig_1518 MRS2a_00398960 136
17 2162886007 SwRhRL2b_contig_3893312 SwRhRL2b_0247.00001880 136
18 3300002773 JGI25152J39213_1000007 JGI25152J39213_100000723 136
19 3300002774 JGI25150J39212_1000013 JGI25150J39212_100001347 136
20 3300003187 JGI25151J46595_10000004 JGI25151J46595_10000004123 136
21 3300003215 JGI25153J46596_10000004 JGI25153J46596_10000004123 136
22 3300003781 Ga0055536_1000071 Ga0055536_100007180 136
23 3300003791 Ga0055530_10007326 Ga0055530_100073263 136
24 3300005288 Ga0065714_10004484 Ga0065714_1000448419 136
25 3300005288 Ga0065714_10004833 Ga0065714_100048332 136
26 3300005288 Ga0065714_10065441 Ga0065714_100654415 136
27 3300005288 Ga0065714_10065694 Ga0065714_1006569410 136
28 3300005288 Ga0065714_10098657 Ga0065714_100986572 136
29 3300005288 Ga0065714_10477696 Ga0065714_104776961 136
30 3300005288 Ga0065714_10529251 Ga0065714_105292511 136
31 3300005289 Ga0065704_10000199 Ga0065704_10000199132 136
32 3300005289 Ga0065704_10521425 Ga0065704_105214251 136
33 3300005293 Ga0065715_11038633 Ga0065715_110386331 136
34 3300005329 Ga0070683_100139689 Ga0070683_1001396892 136
35 3300005329 Ga0070683_100528751 Ga0070683_1005287511 136
36 3300005330 Ga0070690_100269691 Ga0070690_1002696911 136
37 3300005331 Ga0070670_100910318 Ga0070670_1009103182 136
38 3300005331 Ga0070670_101025143 Ga0070670_1010251431 136
39 3300005334 Ga0068869_100529675 Ga0068869_1005296752 136
40 3300005335 Ga0070666_10009910 Ga0070666_100099102 136
41 3300005337 Ga0070682_100000008 Ga0070682_10000000862 136
42 3300005337 Ga0070682_100184081 Ga0070682_1001840811 136
43 3300005337 Ga0070682_100937401 Ga0070682_1009374011 136
44 3300005343 Ga0070687_100664341 Ga0070687_1006643411 136
45 3300005344 Ga0070661_100277524 Ga0070661_1002775243 136
46 3300005347 Ga0070668_100314787 Ga0070668_1003147872 136
47 3300005353 Ga0070669_100131452 Ga0070669_1001314522 136
48 3300005354 Ga0070675_100507471 Ga0070675_1005074712 136
49 3300005354 Ga0070675_101062096 Ga0070675_1010620962 136
50 3300005355 Ga0070671_100239199 Ga0070671_1002391992 136
51 3300005356 Ga0070674_100076979 Ga0070674_1000769794 136
52 3300005367 Ga0070667_101847932 Ga0070667_1018479321 136
53 3300005456 Ga0070678_100019306 Ga0070678_1000193064 136
54 3300005456 Ga0070678_101083320 Ga0070678_1010833201 136
55 3300005457 Ga0070662_100199642 Ga0070662_1001996421 136
56 3300005459 Ga0068867_100707744 Ga0068867_1007077441 136
57 3300005535 Ga0070684_100182599 Ga0070684_1001825992 136
58 3300005539 Ga0068853_100007037 Ga0068853_1000070373 136
59 3300005539 Ga0068853_100040505 Ga0068853_1000405053 136
60 3300005543 Ga0070672_100501252 Ga0070672_1005012521 136
61 3300005544 Ga0070686_100321135 Ga0070686_1003211352 136
62 3300005548 Ga0070665_100027588 Ga0070665_1000275886 136
63 3300005563 Ga0068855_100378707 Ga0068855_1003787072 136
64 3300005563 Ga0068855_101811009 Ga0068855_1018110091 136
65 3300005564 Ga0070664_100429184 Ga0070664_1004291843 136
66 3300005577 Ga0068857_102176731 Ga0068857_1021767311 136
67 3300005578 Ga0068854_100881911 Ga0068854_1008819112 136
68 3300005578 Ga0068854_102258581 Ga0068854_1022585811 136
69 3300005616 Ga0068852_100163513 Ga0068852_1001635134 136
70 3300005616 Ga0068852_100206489 Ga0068852_1002064891 136
71 3300005616 Ga0068852_100844918 Ga0068852_1008449182 136
72 3300005617 Ga0068859_100000903 Ga0068859_10000090327 136
73 3300005719 Ga0068861_100186992 Ga0068861_1001869923 136
74 3300005719 Ga0068861_102366950 Ga0068861_1023669501 136
75 3300005834 Ga0068851_10467281 Ga0068851_104672811 136
76 3300005841 Ga0068863_100659086 Ga0068863_1006590862 136
77 3300005843 Ga0068860_100244156 Ga0068860_1002441562 136
78 3300005844 Ga0068862_100587355 Ga0068862_1005873552 136
79 3300006028 Ga0070717_10944570 Ga0070717_109445702 136
80 3300006237 Ga0097621_100032088 Ga0097621_1000320884 136
81 3300006358 Ga0068871_100157490 Ga0068871_1001574902 136
82 3300006358 Ga0068871_101998692 Ga0068871_1019986921 136
83 3300006844 Ga0075428_101269625 Ga0075428_1012696251 136
84 3300006847 Ga0075431_100004472 Ga0075431_1000044728 136
85 3300006931 Ga0097620_100000903 Ga0097620_1000009034 136
86 3300009036 Ga0105244_10039503 Ga0105244_100395032 136
87 3300009093 Ga0105240_10000176 Ga0105240_1000017616 136
88 3300009093 Ga0105240_10192556 Ga0105240_101925563 136
89 3300009093 Ga0105240_10204324 Ga0105240_102043242 136
90 3300009093 Ga0105240_10216420 Ga0105240_102164203 136
91 3300009094 Ga0111539_10022060 Ga0111539_100220607 136
92 3300009094 Ga0111539_10072731 Ga0111539_100727314 136
93 3300009098 Ga0105245_10192592 Ga0105245_101925922 136
94 3300009147 Ga0114129_10188391 Ga0114129_101883914 136
95 3300009174 Ga0105241_10241727 Ga0105241_102417272 136
96 3300009176 Ga0105242_11217207 Ga0105242_112172072 136
97 3300009176 Ga0105242_11987014 Ga0105242_119870142 136
98 3300009545 Ga0105237_10019910 Ga0105237_100199105 136
99 3300009545 Ga0105237_10454428 Ga0105237_104544282 136
100 3300009545 Ga0105237_10586050 Ga0105237_105860501 136
101 3300009551 Ga0105238_10285139 Ga0105238_102851392 136
102 3300010375 Ga0105239_10001803 Ga0105239_1000180312 136
103 3300010375 Ga0105239_10070059 Ga0105239_100700593 136
104 3300013100 Ga0157373_10000015 Ga0157373_10000015118 136
105 3300013100 Ga0157373_10000411 Ga0157373_1000041125 136
106 3300013100 Ga0157373_10002959 Ga0157373_100029596 136
107 3300013100 Ga0157373_10010302 Ga0157373_100103024 136
108 3300013102 Ga0157371_10000027 Ga0157371_1000002795 136
109 3300013102 Ga0157371_10009379 Ga0157371_100093792 136
110 3300013102 Ga0157371_10031191 Ga0157371_100311912 136
111 3300013102 Ga0157371_10034841 Ga0157371_100348413 136
112 3300013104 Ga0157370_10015500 Ga0157370_100155007 136
113 3300013104 Ga0157370_10323485 Ga0157370_103234852 136
114 3300013104 Ga0157370_10367107 Ga0157370_103671071 136
115 3300013104 Ga0157370_10368082 Ga0157370_103680821 136
116 3300013104 Ga0157370_11433165 Ga0157370_114331651 136
117 3300013104 Ga0157370_11520373 Ga0157370_115203731 136
118 3300013104 Ga0157370_11911615 Ga0157370_119116151 136
119 3300013105 Ga0157369_10000053 Ga0157369_1000005359 136
120 3300013105 Ga0157369_10402097 Ga0157369_104020973 136
121 3300013105 Ga0157369_11031573 Ga0157369_110315732 136
122 3300013105 Ga0157369_11427477 Ga0157369_114274772 136
123 3300013105 Ga0157369_11495280 Ga0157369_114952801 136
124 3300013296 Ga0157374_10748883 Ga0157374_107488832 136
125 3300013296 Ga0157374_12266014 Ga0157374_122660142 136
126 3300013297 Ga0157378_10022322 Ga0157378_100223224 136
127 3300013297 Ga0157378_10120579 Ga0157378_101205793 136
128 3300013297 Ga0157378_12051458 Ga0157378_120514581 136
129 3300013306 Ga0163162_10000184 Ga0163162_1000018440 136
130 3300013306 Ga0163162_10025494 Ga0163162_100254944 136
131 3300013306 Ga0163162_10160557 Ga0163162_101605573 136
132 3300013306 Ga0163162_11181682 Ga0163162_111816821 136
133 3300013307 Ga0157372_10006025 Ga0157372_100060253 136
134 3300013307 Ga0157372_10073245 Ga0157372_100732453 136
135 3300013307 Ga0157372_10173414 Ga0157372_101734143 136
136 3300013307 Ga0157372_10220013 Ga0157372_102200134 136
137 3300013307 Ga0157372_10236146 Ga0157372_102361462 136
138 3300013307 Ga0157372_10371460 Ga0157372_103714601 136
139 3300013308 Ga0157375_10013302 Ga0157375_100133022 136
140 3300013308 Ga0157375_10114902 Ga0157375_101149022 136
141 3300013308 Ga0157375_10256514 Ga0157375_102565145 136
142 3300013308 Ga0157375_10504834 Ga0157375_105048342 136
143 3300013308 Ga0157375_13269663 Ga0157375_132696631 136
144 3300014325 Ga0163163_10362058 Ga0163163_103620582 136
145 3300014497 Ga0182008_10000001 Ga0182008_10000001383 136
146 3300014497 Ga0182008_10000005 Ga0182008_100000058 136
147 3300014497 Ga0182008_10000221 Ga0182008_1000022138 136
148 3300014969 Ga0157376_10463362 Ga0157376_104633622 136
149 3300015261 Ga0182006_1000126 Ga0182006_100012646 136
150 3300015261 Ga0182006_1000296 Ga0182006_100029613 136
151 3300015261 Ga0182006_1002358 Ga0182006_10023584 136
152 3300015261 Ga0182006_1047249 Ga0182006_10472491 136
153 3300015262 Ga0182007_10000005 Ga0182007_10000005355 136
154 3300015682 Ga0183373_1007 Ga0183373_1007129 136
155 3300017792 Ga0163161_10000182 Ga0163161_1000018213 136
156 3300017792 Ga0163161_10000182 Ga0163161_1000018258 136
157 3300017792 Ga0163161_10000350 Ga0163161_100003507 136
158 3300017792 Ga0163161_10000485 Ga0163161_100004853 136
159 3300017792 Ga0163161_10019485 Ga0163161_100194856 136
160 3300017792 Ga0163161_10062388 Ga0163161_100623882 136
161 3300017792 Ga0163161_10081442 Ga0163161_100814422 136
162 3300017792 Ga0163161_10249972 Ga0163161_102499722 136
163 3300017792 Ga0163161_10367874 Ga0163161_103678741 136
164 3300017792 Ga0163161_10592639 Ga0163161_105926392 136
165 3300025245 Ga0207425_1000008 Ga0207425_1000008311 136
166 3300025258 Ga0209129_1000042 Ga0209129_100004246 136
167 3300025292 Ga0209676_1000039 Ga0209676_100003976 136
168 3300025294 Ga0209025_1000020 Ga0209025_1000020311 136
169 3300025297 Ga0209758_1000022 Ga0209758_1000022311 136
170 3300025298 Ga0209050_1000033 Ga0209050_1000033373 136
171 3300025893 Ga0207682_10042964 Ga0207682_100429643 136
172 3300025899 Ga0207642_10262829 Ga0207642_102628292 136
173 3300025903 Ga0207680_10075935 Ga0207680_100759353 136
174 3300025904 Ga0207647_10059331 Ga0207647_100593312 136
175 3300025911 Ga0207654_10338827 Ga0207654_103388272 136
176 3300025913 Ga0207695_10000102 Ga0207695_10000102128 136
177 3300025913 Ga0207695_10035087 Ga0207695_100350876 136
178 3300025913 Ga0207695_10051229 Ga0207695_100512292 136
179 3300025913 Ga0207695_10324995 Ga0207695_103249952 136
180 3300025914 Ga0207671_10000725 Ga0207671_1000072539 136
181 3300025914 Ga0207671_10223545 Ga0207671_102235452 136
182 3300025914 Ga0207671_11471370 Ga0207671_114713701 136
183 3300025920 Ga0207649_10457707 Ga0207649_104577072 136
184 3300025920 Ga0207649_10694123 Ga0207649_106941232 136
185 3300025923 Ga0207681_10777415 Ga0207681_107774152 136
186 3300025924 Ga0207694_10198146 Ga0207694_101981462 136
187 3300025925 Ga0207650_10105298 Ga0207650_101052982 136
188 3300025926 Ga0207659_11247960 Ga0207659_112479601 136
189 3300025927 Ga0207687_11584674 Ga0207687_115846741 136
190 3300025931 Ga0207644_10274583 Ga0207644_102745832 136
191 3300025933 Ga0207706_10782780 Ga0207706_107827802 136
192 3300025934 Ga0207686_11002317 Ga0207686_110023172 136
193 3300025936 Ga0207670_10276539 Ga0207670_102765392 136
194 3300025937 Ga0207669_10046087 Ga0207669_100460872 136
195 3300025940 Ga0207691_10083841 Ga0207691_100838412 136
196 3300025940 Ga0207691_10096698 Ga0207691_100966984 136
197 3300025940 Ga0207691_10542954 Ga0207691_105429541 136
198 3300025942 Ga0207689_10460783 Ga0207689_104607832 136
199 3300025944 Ga0207661_10040743 Ga0207661_100407432 136
200 3300025945 Ga0207679_10120444 Ga0207679_101204441 136
201 3300025949 Ga0207667_11497506 Ga0207667_114975061 136
202 3300025960 Ga0207651_11040110 Ga0207651_110401102 136
203 3300025972 Ga0207668_10562245 Ga0207668_105622451 136
204 3300025981 Ga0207640_11451309 Ga0207640_114513092 136
205 3300026041 Ga0207639_10017064 Ga0207639_100170643 136
206 3300026041 Ga0207639_10018418 Ga0207639_100184183 136
207 3300026041 Ga0207639_11681521 Ga0207639_116815211 136
208 3300026067 Ga0207678_10805798 Ga0207678_108057982 136
209 3300026088 Ga0207641_10124012 Ga0207641_101240124 136
210 3300026088 Ga0207641_11163241 Ga0207641_111632411 136
211 3300026089 Ga0207648_10893516 Ga0207648_108935162 136
212 3300026095 Ga0207676_10269886 Ga0207676_102698862 136
213 3300026116 Ga0207674_11718241 Ga0207674_117182411 136
214 3300026118 Ga0207675_100222882 Ga0207675_1002228822 136
215 3300026121 Ga0207683_10030725 Ga0207683_100307254 136
216 3300026121 Ga0207683_10458896 Ga0207683_104588961 136
217 3300026121 Ga0207683_11031788 Ga0207683_110317882 136
218 3300026121 Ga0207683_11255560 Ga0207683_112555601 136
219 3300026142 Ga0207698_10153708 Ga0207698_101537083 136
220 3300026142 Ga0207698_10196149 Ga0207698_101961492 136
221 3300026142 Ga0207698_12370136 Ga0207698_123701361 136
222 3300027876 Ga0209974_10158458 Ga0209974_101584582 136
223 3300027907 Ga0207428_10151152 Ga0207428_101511523 136
224 3300028379 Ga0268266_10018627 Ga0268266_100186276 136
225 3300028381 Ga0268264_10471558 Ga0268264_104715581 136
226 3300028577 Ga0265318_10218800 Ga0265318_102188002 136
227 3300028794 Ga0307515_10000001 Ga0307515_100000013221 136
228 3300029957 Ga0265324_10014351 Ga0265324_100143511 136
229 3300029957 Ga0265324_10016058 Ga0265324_100160583 136
230 3300031239 Ga0265328_10160323 Ga0265328_101603232 136
231 3300031240 Ga0265320_10500868 Ga0265320_105008681 136
232 3300031250 Ga0265331_10146565 Ga0265331_101465652 136
233 3300031250 Ga0265331_10207302 Ga0265331_102073022 136
234 3300031250 Ga0265331_10458727 Ga0265331_104587271 136
235 3300031251 Ga0265327_10000009 Ga0265327_10000009500 136
236 3300031251 Ga0265327_10000212 Ga0265327_1000021249 136
237 3300031251 Ga0265327_10002369 Ga0265327_100023698 136
238 3300031251 Ga0265327_10039518 Ga0265327_100395182 136
239 3300031507 Ga0307509_10665784 Ga0307509_106657841 136
240 3300031548 Ga0307408_100602654 Ga0307408_1006026542 136
241 3300031711 Ga0265314_10011723 Ga0265314_100117237 136
242 3300031711 Ga0265314_10425853 Ga0265314_104258532 136
243 3300031712 Ga0265342_10239490 Ga0265342_102394902 136
244 3300031731 Ga0307405_10000068 Ga0307405_1000006835 136
245 3300031731 Ga0307405_10170887 Ga0307405_101708872 136
246 3300031731 Ga0307405_10815480 Ga0307405_108154802 136
247 3300031852 Ga0307410_10207071 Ga0307410_102070712 136
248 3300031852 Ga0307410_10700006 Ga0307410_107000062 136
249 3300031901 Ga0307406_10795170 Ga0307406_107951702 136
250 3300031903 Ga0307407_10000001 Ga0307407_10000001113 136
251 3300031911 Ga0307412_10000017 Ga0307412_10000017198 136
252 3300031911 Ga0307412_10065611 Ga0307412_100656113 136
253 3300031911 Ga0307412_10175521 Ga0307412_101755211 136
254 3300031995 Ga0307409_100031312 Ga0307409_1000313122 136
255 3300032002 Ga0307416_100000008 Ga0307416_100000008276 136
256 3300032002 Ga0307416_100717931 Ga0307416_1007179311 136
257 3300032002 Ga0307416_100775558 Ga0307416_1007755582 136
258 3300032004 Ga0307414_10006755 Ga0307414_100067552 136
259 3300032004 Ga0307414_10372537 Ga0307414_103725371 136
260 3300032004 Ga0307414_10442509 Ga0307414_104425092 136
261 3300032005 Ga0307411_10864827 Ga0307411_108648271 136
262 3300032126 Ga0307415_101192356 Ga0307415_1011923561 136
263 3300037466 Ga0395898_0400196 Ga0395898_0400196_270_680 136
264 3300037471 Ga0395905_0106078 Ga0395905_0106078_1944_2354 136
265 3300039437 Ga0436365_1585623 Ga0436365_1585623_632_1042 136
266 3300041443 Ga0451789_1297146 Ga0451789_1297146_57_467 136
267 3300041486 Ga0451807_0579978 Ga0451807_0579978_261_680 136
268 3300041496 Ga0451839_1140327 Ga0451839_1140327_251_667 136
269 3300041509 Ga0451843_1407527 Ga0451843_1407527_122_538 136
270 3300044712 Ga0453684_0026988 Ga0453684_0026988_3386_3796 136
271 3300045049 Ga0466959_0362458 Ga0466959_0362458_56_466 136
272 3300045051 Ga0451576_0320150 Ga0451576_0320150_207_617 136
273 3300046471 Ga0495650_0177387 Ga0495650_0177387_151_561 136
274 3300046477 Ga0495664_0552591 Ga0495664_0552591_148_576 136
275 3300046507 Ga0495606_0046429 Ga0495606_0046429_2224_2640 136
276 3300046512 Ga0495610_0000108 Ga0495610_0000108_83328_83744 136
277 3300046512 Ga0495610_0001498 Ga0495610_0001498_18306_18722 136
278 3300046520 Ga0495637_0017756 Ga0495637_0017756_2659_3075 136
279 3300046525 Ga0495663_0000030 Ga0495663_0000030_55380_55799 136
280 3300046537 Ga0495598_0010249 Ga0495598_0010249_420_836 136
281 3300046538 Ga0495609_0196973 Ga0495609_0196973_327_743 136
282 3300046558 Ga0495633_0079088 Ga0495633_0079088_742_1182 136
283 3300046559 Ga0495667_0586743 Ga0495667_0586743_95_523 136
284 3300046663 Ga0495635_0026156 Ga0495635_0026156_144_572 136
285 3300046809 Ga0495600_0395872 Ga0495600_0395872_385_813 136
286 3300047318 Ga0495636_0000044 Ga0495636_0000044_47649_48059 136
287 3300047319 Ga0495674_0524685 Ga0495674_0524685_158_586 136
288 3300047320 Ga0495672_0026923 Ga0495672_0026923_1014_1424 136
289 3300047320 Ga0495672_0102837 Ga0495672_0102837_400_810 136
290 3300047320 Ga0495672_0334203 Ga0495672_0334203_237_653 136
291 3300047472 Ga0495686_0133374 Ga0495686_0133374_577_993 136
292 3300048911 Ga0496108_0663522 Ga0496108_0663522_280_696 136
293 3300048913 Ga0496110_1234019 Ga0496110_1234019_135_551 136
294 3300048917 Ga0496114_0026017 Ga0496114_0026017_1571_1987 136
295 3300048917 Ga0496114_1192485 Ga0496114_1192485_88_504 136
296 3300048918 Ga0496115_0001141 Ga0496115_0001141_10113_10523 136
297 3300048927 Ga0496124_0269058 Ga0496124_0269058_704_1117 136
298 3300049513 Ga0501290_019923 Ga0501290_019923_469_888 136
299 3300049520 Ga0501297_041022 Ga0501297_041022_194_607 136
300 3300049652 Ga0501202_055817 Ga0501202_055817_423_842 136
301 3300049652 Ga0501202_157334 Ga0501202_157334_85_498 136
302 3300049654 Ga0501207_062742 Ga0501207_062742_186_599 136
303 3300049663 Ga0501223_049902 Ga0501223_049902_313_732 136
304 3300049665 Ga0501227_030541 Ga0501227_030541_603_1022 136
305 3300049667 Ga0501230_099009 Ga0501230_099009_103_516 136
306 3300049668 Ga0501233_009369 Ga0501233_009369_438_857 136
307 3300049669 Ga0501235_047110 Ga0501235_047110_460_870 136
308 3300049675 Ga0501243_088765 Ga0501243_088765_108_527 136
309 3300049679 Ga0501249_018888 Ga0501249_018888_77_493 136
310 3300049682 Ga0501252_056140 Ga0501252_056140_82_495 136
311 3300049686 Ga0501257_012152 Ga0501257_012152_690_1103 136
312 3300049742 Ga0501080_0731265 Ga0501080_0731265_384_797 136
313 3300049757 Ga0501232_033856 Ga0501232_033856_98_511 136
314 3300049760 Ga0501263_079225 Ga0501263_079225_25_435 136
315 3300049763 Ga0501266_021876 Ga0501266_021876_339_758 136
316 3300049765 Ga0501268_071611 Ga0501268_071611_35_448 136
317 3300049775 Ga0501279_014273 Ga0501279_014273_61_480 136
318 3300049822 Ga0501035_0072144 Ga0501035_0072144_160_570 136
319 3300049823 Ga0501044_0137831 Ga0501044_0137831_858_1268 136
320 3300049823 Ga0501044_0886995 Ga0501044_0886995_138_548 136
321 3300050507 nmdc:mga05p37_233229_c1 nmdc:mga05p37_233229_c1_1788_2198 136
322 3300050511 nmdc:mga08y16_38517_c1 nmdc:mga08y16_38517_c1_4487_4912 136
323 3300053093 Ga0500651_0002128 Ga0500651_0002128_382_792 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

65

160

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9627 1 136
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9606 1 135
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9559 1 136
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9504 1 135
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9477 1 136
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9492 1 135 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9357 1 135 3.30.300.20
af_Q57993_77_188_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8991 42 135 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8892 43 136 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8828 45 136 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A258Y8I4-F1-model_v4 OsmC family peroxiredoxin 0.9959 51 136 GO:0004601
GO:0006979
AF-A0A2W5FXT9-F1-model_v4 OsmC family peroxiredoxin 0.991 43 136 GO:0004601
GO:0006979
AF-A0A257KYW8-F1-model_v4 OsmC family peroxiredoxin 0.989 42 136 GO:0004601
GO:0006979
AF-A0A2A2KGB6-F1-model_v4 Uncharacterized protein 0.9868 60 136 GO:0004601
GO:0006979
AF-A0A5U9RK24-F1-model_v4 deleted 0.9854 54 136

Feature Viewer

pLDDT pTM Quality
96.36 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map