F406971

General Info

Members Datasets Scaffolds Average Seq Length
323 213 323 105

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_12099556|Ga0268265_120995561
Length 114
Sequence MGKKYVAPTVTKMRIKKGDRVRVIAGKDLGKEGDVMAVLPKANKVIVDGVNVARKHQRATRATMQAGIIDKDMPIHASNVQVVCPSCDKPTRIGYQGEGREKQRVCRKCGKSFS

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
98 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
99 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
100 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
101 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
107 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
108 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
206 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.28
Metatranscriptomes 3.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.91
Nodule 0
Rhizoplane 7.43
Rhizosphere 81.42
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10004901 3300003911 Bacteria 2399
2 JGI25405J52794_10009956 3300003911 Bacteria 1803
3 Ga0058863_11784269 3300004799 Bacteria 948
4 Ga0065712_10764908 3300005290 Bacteria 524
5 Ga0070683_101363343 3300005329 Bacteria 682
6 Ga0070690_100177526 3300005330 Bacteria 1470
7 Ga0070680_100675943 3300005336 Bacteria 888
8 Ga0068868_100241543 3300005338 Bacteria 1518
9 Ga0070668_101732901 3300005347 Bacteria 574
10 Ga0070671_100601171 3300005355 Bacteria 950
11 Ga0070673_100959894 3300005364 Bacteria 794
12 Ga0070711_100620016 3300005439 Bacteria 904
13 Ga0070708_100010259 3300005445 Bacteria 7584
14 Ga0070678_100757486 3300005456 Bacteria 879
15 Ga0070662_101848933 3300005457 Bacteria 522
16 Ga0068867_101479764 3300005459 Bacteria 632
17 Ga0070706_100707092 3300005467 Bacteria 934
18 Ga0070707_100142593 3300005468 Bacteria 2332
19 Ga0070698_100045833 3300005471 Bacteria 4474
20 Ga0070698_100729551 3300005471 Bacteria 933
21 Ga0070699_100264774 3300005518 Bacteria 1538
22 Ga0070699_101337236 3300005518 Bacteria 657
23 Ga0070684_101720978 3300005535 Bacteria 592
24 Ga0070697_100211578 3300005536 Bacteria 1651
25 Ga0068855_100558261 3300005563 Bacteria 1239
26 Ga0068855_102584109 3300005563 Bacteria 504
27 Ga0070664_100768564 3300005564 Bacteria 900
28 Ga0070664_101724650 3300005564 Bacteria 594
29 Ga0068856_102174972 3300005614 Bacteria 564
30 Ga0068859_101419564 3300005617 Bacteria 766
31 Ga0068851_10388596 3300005834 Bacteria 819
32 Ga0068858_100032644 3300005842 Bacteria 4834
33 Ga0068862_101362443 3300005844 Bacteria 712
34 Ga0081455_10001246 3300005937 Bacteria 31840
35 Ga0081455_10182101 3300005937 Bacteria 1589
36 Ga0081538_10012203 3300005981 Bacteria 6904
37 Ga0081538_10015407 3300005981 Bacteria 5919
38 Ga0075365_10131762 3300006038 Bacteria 1730
39 Ga0075365_10150689 3300006038 Bacteria 1618
40 Ga0075365_10308329 3300006038 Bacteria 1114
41 Ga0075365_10330018 3300006038 Bacteria 1074
42 Ga0075365_10682941 3300006038 Bacteria 725
43 Ga0075368_10175088 3300006042 Bacteria 903
44 Ga0075363_100354887 3300006048 Bacteria 857
45 Ga0075363_100616456 3300006048 Bacteria 651
46 Ga0075364_10028583 3300006051 Bacteria 3570
47 Ga0075364_10224695 3300006051 Bacteria 1275
48 Ga0075364_10248948 3300006051 Bacteria 1208
49 Ga0075364_10579684 3300006051 Bacteria 767
50 Ga0070716_101526278 3300006173 Bacteria 547
51 Ga0075367_10018520 3300006178 Bacteria 3844
52 Ga0075367_10073940 3300006178 Bacteria 2055
53 Ga0097621_100281204 3300006237 Bacteria 1465
54 Ga0097621_101371603 3300006237 Bacteria 669
55 Ga0068871_100881406 3300006358 Bacteria 829
56 Ga0075428_100034071 3300006844 Bacteria 5618
57 Ga0075430_100084105 3300006846 Bacteria 2665
58 Ga0075430_100418823 3300006846 Bacteria 1105
59 Ga0075431_100067797 3300006847 Bacteria 3683
60 Ga0075431_100101856 3300006847 Bacteria 2963
61 Ga0075431_100112956 3300006847 Bacteria 2804
62 Ga0075431_100539705 3300006847 Bacteria 1154
63 Ga0075433_10002059 3300006852 Bacteria 15203
64 Ga0075433_11784882 3300006852 Bacteria 529
65 Ga0075434_100004000 3300006871 Bacteria 13201
66 Ga0075434_101944591 3300006871 Bacteria 594
67 Ga0075429_100013232 3300006880 Bacteria 7157
68 Ga0075429_100073670 3300006880 Bacteria 2974
69 Ga0075436_100044915 3300006914 Bacteria 3048
70 Ga0097620_101419339 3300006931 Bacteria 766
71 Ga0075435_100039605 3300007076 Bacteria 3761
72 Ga0111539_10821418 3300009094 Bacteria 1082
73 Ga0105245_10008148 3300009098 Bacteria 9165
74 Ga0105245_10043526 3300009098 Bacteria 4005
75 Ga0105245_12247142 3300009098 Bacteria 599
76 Ga0105245_12579370 3300009098 Bacteria 561
77 Ga0105245_13199175 3300009098 Bacteria 507
78 Ga0114129_10045478 3300009147 Bacteria 6171
79 Ga0114129_10373735 3300009147 Bacteria 1883
80 Ga0114129_10680034 3300009147 Bacteria 1325
81 Ga0114129_11219942 3300009147 Bacteria 936
82 Ga0114129_12014091 3300009147 Bacteria 698
83 Ga0105243_10263084 3300009148 Bacteria 1545
84 Ga0105243_10920053 3300009148 Bacteria 871
85 Ga0105241_10133236 3300009174 Bacteria 2014
86 Ga0105242_10026961 3300009176 Bacteria 4557
87 Ga0105242_10701420 3300009176 Bacteria 990
88 Ga0105242_12697499 3300009176 Bacteria 547
89 Ga0105238_10416933 3300009551 Bacteria 1337
90 Ga0105239_12591862 3300010375 Bacteria 591
91 Ga0105239_13583035 3300010375 Bacteria 505
92 Ga0105246_12031469 3300011119 Bacteria 555
93 Ga0157371_11102585 3300013102 Bacteria 609
94 Ga0157374_10448227 3300013296 Bacteria 1292
95 Ga0157378_10140500 3300013297 Bacteria 2242
96 Ga0157378_11279877 3300013297 Bacteria 774
97 Ga0157378_11647337 3300013297 Bacteria 688
98 Ga0163162_10649524 3300013306 Bacteria 1179
99 Ga0163162_11976460 3300013306 Bacteria 668
100 Ga0157372_12212262 3300013307 Bacteria 632
101 Ga0157375_10854254 3300013308 Bacteria 1056
102 Ga0163163_10369658 3300014325 Bacteria 1491
103 Ga0157377_11112833 3300014745 Bacteria 606
104 Ga0157379_12059446 3300014968 Bacteria 565
105 Ga0157376_10160358 3300014969 Bacteria 2038
106 Ga0157376_10789320 3300014969 Bacteria 961
107 Ga0163161_10110598 3300017792 Bacteria 2054
108 Ga0163161_11552991 3300017792 Bacteria 582
109 Ga0197907_10739769 3300020069 Bacteria 513
110 Ga0197907_10747416 3300020069 Bacteria 566
111 Ga0197907_11233648 3300020069 Bacteria 3556
112 Ga0206350_10217928 3300020080 Bacteria 661
113 Ga0206350_11501386 3300020080 Bacteria 2227
114 Ga0206354_11629786 3300020081 Bacteria 2517
115 Ga0224712_10321983 3300022467 Bacteria 726
116 Ga0207656_10139118 3300025321 Bacteria 1143
117 Ga0207653_10065626 3300025885 Bacteria 1232
118 Ga0207645_10216605 3300025907 Bacteria 1262
119 Ga0207645_10503861 3300025907 Bacteria 820
120 Ga0207684_10067749 3300025910 Bacteria 3033
121 Ga0207654_10544911 3300025911 Bacteria 823
122 Ga0207660_10986877 3300025917 Bacteria 687
123 Ga0207646_10386337 3300025922 Bacteria 1264
124 Ga0207687_10015908 3300025927 Bacteria 4936
125 Ga0207700_10315437 3300025928 Bacteria 1354
126 Ga0207644_10016437 3300025931 Bacteria 4978
127 Ga0207644_10950622 3300025931 Bacteria 721
128 Ga0207706_10102492 3300025933 Bacteria 2518
129 Ga0207686_10064542 3300025934 Bacteria 2332
130 Ga0207709_10264841 3300025935 Bacteria 1262
131 Ga0207669_10664121 3300025937 Bacteria 854
132 Ga0207669_10730790 3300025937 Bacteria 816
133 Ga0207704_11943867 3300025938 Bacteria 506
134 Ga0207661_10492390 3300025944 Bacteria 1120
135 Ga0207661_11793497 3300025944 Bacteria 559
136 Ga0207651_10725084 3300025960 Bacteria 877
137 Ga0207668_11587594 3300025972 Bacteria 591
138 Ga0207703_10035826 3300026035 Bacteria 3945
139 Ga0207703_10580864 3300026035 Bacteria 1059
140 Ga0207648_11117798 3300026089 Bacteria 739
141 Ga0207676_11170087 3300026095 Bacteria 762
142 Ga0207683_10218660 3300026121 Bacteria 1735
143 Ga0207428_10090269 3300027907 Bacteria 2380
144 Ga0268265_12099556 3300028380 Unclassified 572
145 Ga0268264_10417708 3300028381 Bacteria 1293
146 Ga0316575_10081515 3300031665 Bacteria 1305
147 Ga0316579_10117053 3300031691 Bacteria 1279
148 Ga0316576_10011281 3300031727 Bacteria 5849
149 Ga0316576_10176386 3300031727 Bacteria 1612
150 Ga0316576_10701653 3300031727 Bacteria 733
151 Ga0316578_10012645 3300031728 Bacteria 4455
152 Ga0316578_10418994 3300031728 Bacteria 793
153 Ga0316577_10005664 3300031733 Bacteria 6555
154 Ga0307413_10983797 3300031824 Bacteria 722
155 Ga0307410_10902873 3300031852 Bacteria 757
156 Ga0307410_11323205 3300031852 Bacteria 631
157 Ga0307407_10704883 3300031903 Bacteria 761
158 Ga0307415_102022954 3300032126 Bacteria 561
159 Ga0316585_10196244 3300032137 Bacteria 667
160 Ga0316580_10016910 3300032139 Bacteria 2240
161 Ga0316593_10234252 3300032168 Bacteria 684
162 Ga0373926_0424502 3300035083 Bacteria 526
163 Ga0373944_0035109 3300035089 Bacteria 1527
164 Ga0373960_0043861 3300035121 Bacteria 1304
165 Ga0373943_0048058 3300035170 Bacteria 2089
166 Ga0373962_0165632 3300035242 Bacteria 732
167 Ga0316574_0019582 3300035398 Bacteria 3994
168 Ga0316574_0033496 3300035398 Bacteria 3127
169 Ga0316574_0100364 3300035398 Bacteria 1852
170 Ga0373935_0387882 3300035692 Bacteria 1001
171 Ga0373933_1151735 3300035724 Bacteria 511
172 Ga0373947_0032398 3300035725 Bacteria 3080
173 Ga0316582_0029755 3300036647 Bacteria 3320
174 Ga0316582_0337872 3300036647 Bacteria 1036
175 Ga0316584_0016281 3300036712 Bacteria 5330
176 Ga0316584_0176820 3300036712 Bacteria 1581
177 Ga0395898_0597932 3300037466 Bacteria 1046
178 Ga0395898_0638573 3300037466 Bacteria 1007
179 Ga0316581_0176023 3300037588 Unclassified 659
180 Ga0395901_0532739 3300038443 Bacteria 1192
181 Ga0451787_379499 3300041441 Bacteria 582
182 Ga0451837_1711376 3300041494 Bacteria 1882
183 Ga0451849_0434757 3300041505 Bacteria 681
184 Ga0451853_1629715 3300041512 Bacteria 539
185 Ga0451853_1948116 3300041512 Bacteria 776
186 Ga0439432_105528 3300042006 Bacteria 841
187 Ga0495641_0318150 3300046461 Bacteria 702
188 Ga0495641_0483999 3300046461 Bacteria 564
189 Ga0495651_0678659 3300046462 Bacteria 644
190 Ga0495582_0723742 3300046473 Bacteria 576
191 Ga0495608_0205455 3300046511 Bacteria 1240
192 Ga0495608_0574230 3300046511 Bacteria 678
193 Ga0495616_0196477 3300046513 Bacteria 889
194 Ga0495630_0131708 3300046517 Bacteria 1899
195 Ga0495630_0207189 3300046517 Bacteria 1497
196 Ga0495630_0217241 3300046517 Bacteria 1459
197 Ga0495586_0020382 3300046535 Bacteria 3532
198 Ga0495621_0022451 3300046539 Bacteria 2091
199 Ga0495656_0037860 3300046615 Bacteria 1995
200 Ga0495656_0676428 3300046615 Bacteria 555
201 Ga0495657_0319053 3300046675 Bacteria 924
202 Ga0495647_0061674 3300046681 Bacteria 1481
203 Ga0495647_0110366 3300046681 Bacteria 1148
204 Ga0495647_0138439 3300046681 Bacteria 1037
205 Ga0495658_0072847 3300046683 Bacteria 1999
206 Ga0495658_0251448 3300046683 Bacteria 1112
207 Ga0495613_0010959 3300046689 Bacteria 6729
208 Ga0495613_0028211 3300046689 Bacteria 4176
209 Ga0495600_0955709 3300046809 Bacteria 503
210 Ga0495581_0868533 3300047315 Bacteria 516
211 Ga0495604_0633707 3300047317 Bacteria 683
212 Ga0495674_0467046 3300047319 Bacteria 1012
213 Ga0495676_0068054 3300047321 Bacteria 2753
214 Ga0495676_0370633 3300047321 Bacteria 954
215 Ga0495676_1094531 3300047321 Bacteria 507
216 Ga0495593_0367537 3300047673 Bacteria 719
217 Ga0496100_0184485 3300048903 Bacteria 1511
218 Ga0496100_1065499 3300048903 Bacteria 637
219 Ga0496101_0063479 3300048904 Bacteria 2689
220 Ga0496101_0703469 3300048904 Bacteria 798
221 Ga0496101_1118519 3300048904 Bacteria 618
222 Ga0496102_0757290 3300048905 Bacteria 894
223 Ga0496104_0182195 3300048907 Bacteria 2011
224 Ga0496105_0013984 3300048908 Bacteria 6384
225 Ga0496105_0234591 3300048908 Bacteria 1490
226 Ga0496105_1059606 3300048908 Bacteria 604
227 Ga0496106_1188543 3300048909 Bacteria 595
228 Ga0496108_0151244 3300048911 Bacteria 2003
229 Ga0496108_0408592 3300048911 Bacteria 1186
230 Ga0496108_0958909 3300048911 Bacteria 732
231 Ga0496108_1500575 3300048911 Bacteria 561
232 Ga0496109_0366132 3300048912 Bacteria 1361
233 Ga0496109_0799312 3300048912 Bacteria 881
234 Ga0496110_0132216 3300048913 Bacteria 2254
235 Ga0496111_0100350 3300048914 Bacteria 2126
236 Ga0496111_0374037 3300048914 Bacteria 1054
237 Ga0496114_0601441 3300048917 Bacteria 970
238 Ga0496114_1114752 3300048917 Bacteria 674
239 Ga0496115_0994848 3300048918 Bacteria 641
240 Ga0501031_0166152 3300049568 Bacteria 1442
241 Ga0501031_0538107 3300049568 Bacteria 753
242 Ga0501032_0603828 3300049569 Bacteria 698
243 Ga0501033_0007082 3300049570 Bacteria 8756
244 Ga0501034_0482437 3300049571 Bacteria 1155
245 Ga0501036_0016080 3300049572 Bacteria 6252
246 Ga0501037_0599049 3300049573 Bacteria 740
247 Ga0501038_0038011 3300049574 Bacteria 4217
248 Ga0501038_0604692 3300049574 Bacteria 829
249 Ga0501039_0122634 3300049575 Bacteria 2037
250 Ga0501039_0672991 3300049575 Bacteria 810
251 Ga0501040_0011866 3300049576 Bacteria 5701
252 Ga0501041_0105967 3300049577 Bacteria 1742
253 Ga0501042_0013371 3300049578 Bacteria 5584
254 Ga0501046_0030593 3300049580 Bacteria 4368
255 Ga0501048_0227771 3300049582 Bacteria 1322
256 Ga0501068_0204780 3300049584 Bacteria 1252
257 Ga0501068_0403585 3300049584 Bacteria 881
258 Ga0501069_0000157 3300049585 Bacteria 30022
259 Ga0501069_0284022 3300049585 Bacteria 969
260 Ga0501070_0000089 3300049586 Bacteria 77368
261 Ga0501070_0142923 3300049586 Bacteria 1976
262 Ga0501070_1208731 3300049586 Bacteria 580
263 Ga0501071_0005915 3300049587 Bacteria 7914
264 Ga0501072_0015662 3300049588 Bacteria 5811
265 Ga0501072_0577718 3300049588 Bacteria 887
266 Ga0501073_0046586 3300049589 Bacteria 3049
267 Ga0501074_0063243 3300049590 Bacteria 2666
268 Ga0501074_0175141 3300049590 Bacteria 1531
269 Ga0501075_0004688 3300049591 Bacteria 9283
270 Ga0501076_0007602 3300049592 Bacteria 7891
271 Ga0501077_0006635 3300049593 Bacteria 7107
272 Ga0501079_0017365 3300049741 Bacteria 5495
273 Ga0501080_0002681 3300049742 Bacteria 15586
274 Ga0501080_0154590 3300049742 Bacteria 2119
275 Ga0501081_0142283 3300049743 Bacteria 1719
276 Ga0501044_0181252 3300049823 Bacteria 2073
277 Ga0501045_0002201 3300049824 Bacteria 13214
278 Ga0501045_1305011 3300049824 Bacteria 528
279 nmdc:mga03683_29923_c1 3300050489 Bacteria 2175
280 nmdc:mga03n38_279146_c1 3300050490 Bacteria 891
281 nmdc:mga03n38_43726_c1 3300050490 Bacteria 1964
282 nmdc:mga00v17_1031012_c1 3300050491 Bacteria 517
283 nmdc:mga00v17_114046_c1 3300050491 Bacteria 1716
284 nmdc:mga00v17_442621_c1 3300050491 Bacteria 844
285 nmdc:mga00v17_81415_c1 3300050491 Bacteria 2022
286 nmdc:mga0yw44_10273_c1 3300050492 Bacteria 1632
287 nmdc:mga0yw44_23025_c1 3300050492 Bacteria 3504
288 nmdc:mga0yw44_231241_c1 3300050492 Bacteria 1227
289 nmdc:mga0yw44_506991_c1 3300050492 Bacteria 819
290 nmdc:mga06z11_112031_c1 3300050494 Bacteria 1512
291 nmdc:mga06z11_18074_c1 3300050494 Bacteria 3213
292 nmdc:mga06z11_20149_c1 3300050494 Bacteria 3079
293 nmdc:mga05p37_450163_c1 3300050507 Bacteria 1491
294 nmdc:mga05p37_620531_c1 3300050507 Bacteria 1217
295 nmdc:mga05p37_69389_c1 3300050507 Bacteria 4336
296 nmdc:mga09592_203100_c1 3300050508 Bacteria 1716
297 nmdc:mga09592_23438_c1 3300050508 Bacteria 5099
298 nmdc:mga09592_47724_c1 3300050508 Bacteria 3610
299 nmdc:mga0qj67_30812_c1 3300050509 Bacteria 4177
300 nmdc:mga06r32_126116_c1 3300050510 Bacteria 2529
301 nmdc:mga06r32_229619_c1 3300050510 Bacteria 1844
302 nmdc:mga06r32_69130_c1 3300050510 Bacteria 3413
303 nmdc:mga08y16_134995_c1 3300050511 Bacteria 2564
304 nmdc:mga0n895_158358_c1 3300050512 Bacteria 2296
305 nmdc:mga0rr50_1745_c1 3300050513 Bacteria 11991
306 nmdc:mga08x19_4128_c1 3300050514 Bacteria 8615
307 nmdc:mga0a205_1346709_c1 3300050515 Bacteria 561
308 nmdc:mga0a205_25778_c1 3300050515 Bacteria 5602
309 Ga0495612_0483138 3300053078 Bacteria 567
310 Ga0500635_0001744 3300053080 Bacteria 5297
311 Ga0495595_0178198 3300053084 Bacteria 1053
312 Ga0495619_0069851 3300053085 Bacteria 2348
313 Ga0495619_0901672 3300053085 Bacteria 595
314 Ga0500646_0041842 3300053090 Bacteria 1293
315 Ga0500583_0087319 3300053092 Bacteria 1515
316 Ga0500566_0000391 3300053094 Bacteria 24277
317 Ga0501084_0004976 3300054114 Bacteria 10867
318 Ga0501084_0330786 3300054114 Bacteria 1287
319 Ga0587077_034189 3300059493 Bacteria 986
320 Ga0587125_046723 3300059607 Bacteria 600
321 Ga0587101_011874 3300059623 Bacteria 1122
322 Ga0501082_0018922 3300060353 Bacteria 5933
323 Ga0530510_0010398 3300061734 Bacteria 6523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10854254 Ga0157375_108542541 92
2 3300046683 Ga0495658_0251448 Ga0495658_0251448_19_300 93
3 3300006871 Ga0075434_101944591 Ga0075434_1019445912 100
4 3300026121 Ga0207683_10218660 Ga0207683_102186604 100
5 3300005329 Ga0070683_101363343 Ga0070683_1013633431 101
6 3300005338 Ga0068868_100241543 Ga0068868_1002415435 101
7 3300005535 Ga0070684_101720978 Ga0070684_1017209781 101
8 3300005564 Ga0070664_100768564 Ga0070664_1007685642 101
9 3300005614 Ga0068856_102174972 Ga0068856_1021749721 101
10 3300005834 Ga0068851_10388596 Ga0068851_103885962 101
11 3300005844 Ga0068862_101362443 Ga0068862_1013624432 101
12 3300005937 Ga0081455_10182101 Ga0081455_101821012 101
13 3300006237 Ga0097621_100281204 Ga0097621_1002812041 101
14 3300006358 Ga0068871_100881406 Ga0068871_1008814062 101
15 3300009098 Ga0105245_10043526 Ga0105245_100435269 101
16 3300009098 Ga0105245_12579370 Ga0105245_125793702 101
17 3300009098 Ga0105245_13199175 Ga0105245_131991752 101
18 3300009147 Ga0114129_10680034 Ga0114129_106800344 101
19 3300009148 Ga0105243_10920053 Ga0105243_109200532 101
20 3300009176 Ga0105242_10701420 Ga0105242_107014202 101
21 3300009551 Ga0105238_10416933 Ga0105238_104169332 101
22 3300011119 Ga0105246_12031469 Ga0105246_120314691 101
23 3300013296 Ga0157374_10448227 Ga0157374_104482272 101
24 3300013297 Ga0157378_11647337 Ga0157378_116473371 101
25 3300013306 Ga0163162_10649524 Ga0163162_106495243 101
26 3300014745 Ga0157377_11112833 Ga0157377_111128332 101
27 3300014969 Ga0157376_10789320 Ga0157376_107893202 101
28 3300017792 Ga0163161_11552991 Ga0163161_115529912 101
29 3300020069 Ga0197907_11233648 Ga0197907_112336483 101
30 3300020080 Ga0206350_11501386 Ga0206350_115013863 101
31 3300020081 Ga0206354_11629786 Ga0206354_116297864 101
32 3300025321 Ga0207656_10139118 Ga0207656_101391182 101
33 3300025931 Ga0207644_10950622 Ga0207644_109506222 101
34 3300025935 Ga0207709_10264841 Ga0207709_102648412 101
35 3300025937 Ga0207669_10730790 Ga0207669_107307902 101
36 3300025938 Ga0207704_11943867 Ga0207704_119438672 101
37 3300025944 Ga0207661_10492390 Ga0207661_104923902 101
38 3300025972 Ga0207668_11587594 Ga0207668_115875942 101
39 3300026035 Ga0207703_10580864 Ga0207703_105808643 101
40 3300026095 Ga0207676_11170087 Ga0207676_111700872 101
41 3300028381 Ga0268264_10417708 Ga0268264_104177085 101
42 3300035724 Ga0373933_1151735 Ga0373933_1151735_158_463 101
43 3300041441 Ga0451787_379499 Ga0451787_379499_143_448 101
44 3300041512 Ga0451853_1948116 Ga0451853_1948116_449_754 101
45 3300046461 Ga0495641_0483999 Ga0495641_0483999_83_388 101
46 3300046462 Ga0495651_0678659 Ga0495651_0678659_325_630 101
47 3300046473 Ga0495582_0723742 Ga0495582_0723742_77_382 101
48 3300046511 Ga0495608_0205455 Ga0495608_0205455_186_491 101
49 3300046517 Ga0495630_0207189 Ga0495630_0207189_846_1151 101
50 3300046675 Ga0495657_0319053 Ga0495657_0319053_530_835 101
51 3300046681 Ga0495647_0061674 Ga0495647_0061674_844_1149 101
52 3300047317 Ga0495604_0633707 Ga0495604_0633707_83_388 101
53 3300047319 Ga0495674_0467046 Ga0495674_0467046_440_745 101
54 3300047321 Ga0495676_0370633 Ga0495676_0370633_84_389 101
55 3300048903 Ga0496100_0184485 Ga0496100_0184485_288_593 101
56 3300048904 Ga0496101_0063479 Ga0496101_0063479_2087_2392 101
57 3300048904 Ga0496101_1118519 Ga0496101_1118519_61_366 101
58 3300048905 Ga0496102_0757290 Ga0496102_0757290_300_605 101
59 3300048907 Ga0496104_0182195 Ga0496104_0182195_448_753 101
60 3300048908 Ga0496105_0013984 Ga0496105_0013984_5236_5541 101
61 3300048908 Ga0496105_1059606 Ga0496105_1059606_273_578 101
62 3300048909 Ga0496106_1188543 Ga0496106_1188543_22_327 101
63 3300048911 Ga0496108_0408592 Ga0496108_0408592_643_948 101
64 3300048911 Ga0496108_0958909 Ga0496108_0958909_372_677 101
65 3300048912 Ga0496109_0366132 Ga0496109_0366132_426_731 101
66 3300048914 Ga0496111_0100350 Ga0496111_0100350_232_537 101
67 3300048917 Ga0496114_1114752 Ga0496114_1114752_101_406 101
68 3300050489 nmdc:mga03683_29923_c1 nmdc:mga03683_29923_c1_553_858 101
69 3300050490 nmdc:mga03n38_279146_c1 nmdc:mga03n38_279146_c1_294_599 101
70 3300050491 nmdc:mga00v17_81415_c1 nmdc:mga00v17_81415_c1_1396_1701 101
71 3300050492 nmdc:mga0yw44_23025_c1 nmdc:mga0yw44_23025_c1_2709_3014 101
72 3300053078 Ga0495612_0483138 Ga0495612_0483138_153_458 101
73 3300053084 Ga0495595_0178198 Ga0495595_0178198_323_628 101
74 3300053085 Ga0495619_0069851 Ga0495619_0069851_1069_1374 101
75 3300005459 Ga0068867_101479764 Ga0068867_1014797642 102
76 3300005518 Ga0070699_101337236 Ga0070699_1013372362 102
77 3300005563 Ga0068855_100558261 Ga0068855_1005582613 102
78 3300006852 Ga0075433_11784882 Ga0075433_117848822 102
79 3300025907 Ga0207645_10503861 Ga0207645_105038612 102
80 3300026089 Ga0207648_11117798 Ga0207648_111177982 102
81 3300037466 Ga0395898_0597932 Ga0395898_0597932_556_864 102
82 3300048917 Ga0496114_0601441 Ga0496114_0601441_246_554 102
83 3300049588 Ga0501072_0577718 Ga0501072_0577718_112_420 102
84 3300049824 Ga0501045_1305011 Ga0501045_1305011_70_378 102
85 3300050515 nmdc:mga0a205_1346709_c1 nmdc:mga0a205_1346709_c1_83_391 102
86 3300005347 Ga0070668_101732901 Ga0070668_1017329012 103
87 3300005439 Ga0070711_100620016 Ga0070711_1006200161 103
88 3300005617 Ga0068859_101419564 Ga0068859_1014195642 103
89 3300006038 Ga0075365_10131762 Ga0075365_101317623 103
90 3300006038 Ga0075365_10150689 Ga0075365_101506894 103
91 3300006048 Ga0075363_100354887 Ga0075363_1003548873 103
92 3300006051 Ga0075364_10224695 Ga0075364_102246953 103
93 3300006051 Ga0075364_10248948 Ga0075364_102489483 103
94 3300006178 Ga0075367_10018520 Ga0075367_100185205 103
95 3300006178 Ga0075367_10073940 Ga0075367_100739406 103
96 3300006931 Ga0097620_101419339 Ga0097620_1014193392 103
97 3300009098 Ga0105245_12247142 Ga0105245_122471422 103
98 3300017792 Ga0163161_10110598 Ga0163161_101105985 103
99 3300031665 Ga0316575_10081515 Ga0316575_100815152 103
100 3300031691 Ga0316579_10117053 Ga0316579_101170532 103
101 3300031727 Ga0316576_10011281 Ga0316576_100112815 103
102 3300031727 Ga0316576_10176386 Ga0316576_101763862 103
103 3300031727 Ga0316576_10701653 Ga0316576_107016532 103
104 3300031728 Ga0316578_10012645 Ga0316578_100126455 103
105 3300031728 Ga0316578_10418994 Ga0316578_104189942 103
106 3300031733 Ga0316577_10005664 Ga0316577_100056647 103
107 3300031903 Ga0307407_10704883 Ga0307407_107048832 103
108 3300032137 Ga0316585_10196244 Ga0316585_101962442 103
109 3300032139 Ga0316580_10016910 Ga0316580_100169105 103
110 3300032168 Ga0316593_10234252 Ga0316593_102342522 103
111 3300035398 Ga0316574_0019582 Ga0316574_0019582_1138_1449 103
112 3300035398 Ga0316574_0033496 Ga0316574_0033496_358_669 103
113 3300035398 Ga0316574_0100364 Ga0316574_0100364_78_389 103
114 3300036647 Ga0316582_0029755 Ga0316582_0029755_1228_1539 103
115 3300036647 Ga0316582_0337872 Ga0316582_0337872_454_765 103
116 3300036712 Ga0316584_0016281 Ga0316584_0016281_2665_2976 103
117 3300036712 Ga0316584_0176820 Ga0316584_0176820_1239_1550 103
118 3300037588 Ga0316581_0176023 Ga0316581_0176023_23_334 103
119 3300041512 Ga0451853_1629715 Ga0451853_1629715_49_360 103
120 3300046517 Ga0495630_0217241 Ga0495630_0217241_1038_1349 103
121 3300046681 Ga0495647_0138439 Ga0495647_0138439_375_689 103
122 3300047315 Ga0495581_0868533 Ga0495581_0868533_163_474 103
123 3300047673 Ga0495593_0367537 Ga0495593_0367537_155_466 103
124 3300048903 Ga0496100_1065499 Ga0496100_1065499_238_549 103
125 3300048904 Ga0496101_0703469 Ga0496101_0703469_64_375 103
126 3300048908 Ga0496105_0234591 Ga0496105_0234591_1107_1418 103
127 3300048911 Ga0496108_0151244 Ga0496108_0151244_593_904 103
128 3300048912 Ga0496109_0799312 Ga0496109_0799312_171_482 103
129 3300048913 Ga0496110_0132216 Ga0496110_0132216_738_1049 103
130 3300049568 Ga0501031_0538107 Ga0501031_0538107_94_420 103
131 3300049571 Ga0501034_0482437 Ga0501034_0482437_268_579 103
132 3300049574 Ga0501038_0604692 Ga0501038_0604692_382_708 103
133 3300049575 Ga0501039_0672991 Ga0501039_0672991_180_506 103
134 3300050490 nmdc:mga03n38_43726_c1 nmdc:mga03n38_43726_c1_59_370 103
135 3300050491 nmdc:mga00v17_1031012_c1 nmdc:mga00v17_1031012_c1_51_362 103
136 3300050491 nmdc:mga00v17_114046_c1 nmdc:mga00v17_114046_c1_444_755 103
137 3300050491 nmdc:mga00v17_442621_c1 nmdc:mga00v17_442621_c1_216_527 103
138 3300050492 nmdc:mga0yw44_10273_c1 nmdc:mga0yw44_10273_c1_209_520 103
139 3300050492 nmdc:mga0yw44_231241_c1 nmdc:mga0yw44_231241_c1_89_400 103
140 3300050494 nmdc:mga06z11_112031_c1 nmdc:mga06z11_112031_c1_174_503 103
141 3300050494 nmdc:mga06z11_18074_c1 nmdc:mga06z11_18074_c1_2509_2820 103
142 3300050494 nmdc:mga06z11_20149_c1 nmdc:mga06z11_20149_c1_1428_1739 103
143 3300053080 Ga0500635_0001744 Ga0500635_0001744_1339_1650 103
144 3300053085 Ga0495619_0901672 Ga0495619_0901672_13_324 103
145 3300053090 Ga0500646_0041842 Ga0500646_0041842_766_1077 103
146 3300053092 Ga0500583_0087319 Ga0500583_0087319_110_421 103
147 3300059493 Ga0587077_034189 Ga0587077_034189_203_514 103
148 3300059607 Ga0587125_046723 Ga0587125_046723_144_455 103
149 3300059623 Ga0587101_011874 Ga0587101_011874_203_514 103
150 3300005330 Ga0070690_100177526 Ga0070690_1001775263 104
151 3300005355 Ga0070671_100601171 Ga0070671_1006011712 104
152 3300005445 Ga0070708_100010259 Ga0070708_1000102592 104
153 3300005467 Ga0070706_100707092 Ga0070706_1007070922 104
154 3300005468 Ga0070707_100142593 Ga0070707_1001425932 104
155 3300005471 Ga0070698_100045833 Ga0070698_1000458336 104
156 3300005471 Ga0070698_100729551 Ga0070698_1007295512 104
157 3300005518 Ga0070699_100264774 Ga0070699_1002647742 104
158 3300005536 Ga0070697_100211578 Ga0070697_1002115782 104
159 3300005564 Ga0070664_101724650 Ga0070664_1017246502 104
160 3300005842 Ga0068858_100032644 Ga0068858_1000326449 104
161 3300006038 Ga0075365_10308329 Ga0075365_103083292 104
162 3300006048 Ga0075363_100616456 Ga0075363_1006164561 104
163 3300006051 Ga0075364_10028583 Ga0075364_100285832 104
164 3300006844 Ga0075428_100034071 Ga0075428_1000340719 104
165 3300006846 Ga0075430_100084105 Ga0075430_1000841054 104
166 3300006846 Ga0075430_100418823 Ga0075430_1004188233 104
167 3300006847 Ga0075431_100067797 Ga0075431_1000677977 104
168 3300006847 Ga0075431_100112956 Ga0075431_1001129566 104
169 3300006847 Ga0075431_100539705 Ga0075431_1005397052 104
170 3300006852 Ga0075433_10002059 Ga0075433_1000205922 104
171 3300006871 Ga0075434_100004000 Ga0075434_10000400015 104
172 3300006880 Ga0075429_100013232 Ga0075429_10001323213 104
173 3300006914 Ga0075436_100044915 Ga0075436_1000449154 104
174 3300007076 Ga0075435_100039605 Ga0075435_1000396054 104
175 3300009094 Ga0111539_10821418 Ga0111539_108214183 104
176 3300009147 Ga0114129_10045478 Ga0114129_1004547810 104
177 3300009147 Ga0114129_11219942 Ga0114129_112199422 104
178 3300009147 Ga0114129_12014091 Ga0114129_120140912 104
179 3300009148 Ga0105243_10263084 Ga0105243_102630842 104
180 3300010375 Ga0105239_12591862 Ga0105239_125918621 104
181 3300014968 Ga0157379_12059446 Ga0157379_120594461 104
182 3300020069 Ga0197907_10747416 Ga0197907_107474162 104
183 3300025885 Ga0207653_10065626 Ga0207653_100656263 104
184 3300025907 Ga0207645_10216605 Ga0207645_102166053 104
185 3300025910 Ga0207684_10067749 Ga0207684_100677497 104
186 3300025922 Ga0207646_10386337 Ga0207646_103863373 104
187 3300025928 Ga0207700_10315437 Ga0207700_103154372 104
188 3300025931 Ga0207644_10016437 Ga0207644_100164375 104
189 3300026035 Ga0207703_10035826 Ga0207703_100358267 104
190 3300027907 Ga0207428_10090269 Ga0207428_100902696 104
191 3300035083 Ga0373926_0424502 Ga0373926_0424502_131_463 104
192 3300035089 Ga0373944_0035109 Ga0373944_0035109_381_713 104
193 3300035170 Ga0373943_0048058 Ga0373943_0048058_688_1020 104
194 3300035242 Ga0373962_0165632 Ga0373962_0165632_81_395 104
195 3300035692 Ga0373935_0387882 Ga0373935_0387882_46_378 104
196 3300035725 Ga0373947_0032398 Ga0373947_0032398_116_448 104
197 3300037466 Ga0395898_0638573 Ga0395898_0638573_231_563 104
198 3300038443 Ga0395901_0532739 Ga0395901_0532739_430_762 104
199 3300041505 Ga0451849_0434757 Ga0451849_0434757_174_506 104
200 3300042006 Ga0439432_105528 Ga0439432_105528_135_449 104
201 3300046461 Ga0495641_0318150 Ga0495641_0318150_197_529 104
202 3300046513 Ga0495616_0196477 Ga0495616_0196477_43_375 104
203 3300046517 Ga0495630_0131708 Ga0495630_0131708_282_614 104
204 3300046615 Ga0495656_0037860 Ga0495656_0037860_1197_1511 104
205 3300046615 Ga0495656_0676428 Ga0495656_0676428_92_424 104
206 3300046681 Ga0495647_0110366 Ga0495647_0110366_680_1012 104
207 3300046683 Ga0495658_0072847 Ga0495658_0072847_1066_1398 104
208 3300046689 Ga0495613_0028211 Ga0495613_0028211_907_1239 104
209 3300047321 Ga0495676_0068054 Ga0495676_0068054_2350_2682 104
210 3300047321 Ga0495676_1094531 Ga0495676_1094531_94_408 104
211 3300048914 Ga0496111_0374037 Ga0496111_0374037_653_985 104
212 3300048918 Ga0496115_0994848 Ga0496115_0994848_228_542 104
213 3300049586 Ga0501070_1208731 Ga0501070_1208731_247_561 104
214 3300050507 nmdc:mga05p37_450163_c1 nmdc:mga05p37_450163_c1_1012_1344 104
215 3300050507 nmdc:mga05p37_620531_c1 nmdc:mga05p37_620531_c1_49_381 104
216 3300050507 nmdc:mga05p37_69389_c1 nmdc:mga05p37_69389_c1_3988_4320 104
217 3300050508 nmdc:mga09592_203100_c1 nmdc:mga09592_203100_c1_481_813 104
218 3300050508 nmdc:mga09592_23438_c1 nmdc:mga09592_23438_c1_1591_1923 104
219 3300050509 nmdc:mga0qj67_30812_c1 nmdc:mga0qj67_30812_c1_1948_2280 104
220 3300050510 nmdc:mga06r32_229619_c1 nmdc:mga06r32_229619_c1_1037_1369 104
221 3300050510 nmdc:mga06r32_69130_c1 nmdc:mga06r32_69130_c1_2587_2919 104
222 3300050511 nmdc:mga08y16_134995_c1 nmdc:mga08y16_134995_c1_1816_2148 104
223 3300050512 nmdc:mga0n895_158358_c1 nmdc:mga0n895_158358_c1_601_933 104
224 3300050513 nmdc:mga0rr50_1745_c1 nmdc:mga0rr50_1745_c1_7673_8005 104
225 3300050514 nmdc:mga08x19_4128_c1 nmdc:mga08x19_4128_c1_1842_2174 104
226 3300050515 nmdc:mga0a205_25778_c1 nmdc:mga0a205_25778_c1_1590_1922 104
227 3300004799 Ga0058863_11784269 Ga0058863_117842691 105
228 3300005290 Ga0065712_10764908 Ga0065712_107649082 105
229 3300005336 Ga0070680_100675943 Ga0070680_1006759432 105
230 3300005364 Ga0070673_100959894 Ga0070673_1009598942 105
231 3300005456 Ga0070678_100757486 Ga0070678_1007574861 105
232 3300005457 Ga0070662_101848933 Ga0070662_1018489331 105
233 3300005563 Ga0068855_102584109 Ga0068855_1025841092 105
234 3300006038 Ga0075365_10330018 Ga0075365_103300181 105
235 3300006042 Ga0075368_10175088 Ga0075368_101750883 105
236 3300006051 Ga0075364_10579684 Ga0075364_105796842 105
237 3300006173 Ga0070716_101526278 Ga0070716_1015262781 105
238 3300006237 Ga0097621_101371603 Ga0097621_1013716032 105
239 3300009098 Ga0105245_10008148 Ga0105245_100081487 105
240 3300009174 Ga0105241_10133236 Ga0105241_101332366 105
241 3300009176 Ga0105242_10026961 Ga0105242_100269619 105
242 3300009176 Ga0105242_12697499 Ga0105242_126974992 105
243 3300010375 Ga0105239_13583035 Ga0105239_135830352 105
244 3300013102 Ga0157371_11102585 Ga0157371_111025852 105
245 3300013297 Ga0157378_10140500 Ga0157378_101405002 105
246 3300013297 Ga0157378_11279877 Ga0157378_112798772 105
247 3300013306 Ga0163162_11976460 Ga0163162_119764602 105
248 3300013307 Ga0157372_12212262 Ga0157372_122122622 105
249 3300014325 Ga0163163_10369658 Ga0163163_103696584 105
250 3300014969 Ga0157376_10160358 Ga0157376_101603582 105
251 3300020069 Ga0197907_10739769 Ga0197907_107397692 105
252 3300020080 Ga0206350_10217928 Ga0206350_102179282 105
253 3300022467 Ga0224712_10321983 Ga0224712_103219832 105
254 3300025911 Ga0207654_10544911 Ga0207654_105449112 105
255 3300025917 Ga0207660_10986877 Ga0207660_109868771 105
256 3300025927 Ga0207687_10015908 Ga0207687_100159083 105
257 3300025933 Ga0207706_10102492 Ga0207706_101024923 105
258 3300025934 Ga0207686_10064542 Ga0207686_100645425 105
259 3300025937 Ga0207669_10664121 Ga0207669_106641212 105
260 3300025944 Ga0207661_11793497 Ga0207661_117934972 105
261 3300025960 Ga0207651_10725084 Ga0207651_107250842 105
262 3300028380 Ga0268265_12099556 Ga0268265_120995561 105
263 3300031824 Ga0307413_10983797 Ga0307413_109837972 105
264 3300031852 Ga0307410_11323205 Ga0307410_113232052 105
265 3300041494 Ga0451837_1711376 Ga0451837_1711376_1115_1438 105
266 3300046511 Ga0495608_0574230 Ga0495608_0574230_44_361 105
267 3300046535 Ga0495586_0020382 Ga0495586_0020382_1582_1899 105
268 3300046539 Ga0495621_0022451 Ga0495621_0022451_1448_1765 105
269 3300046689 Ga0495613_0010959 Ga0495613_0010959_360_677 105
270 3300046809 Ga0495600_0955709 Ga0495600_0955709_122_439 105
271 3300048911 Ga0496108_1500575 Ga0496108_1500575_181_498 105
272 3300049584 Ga0501068_0204780 Ga0501068_0204780_89_406 105
273 3300049585 Ga0501069_0000157 Ga0501069_0000157_7859_8176 105
274 3300049586 Ga0501070_0000089 Ga0501070_0000089_69079_69396 105
275 3300049590 Ga0501074_0175141 Ga0501074_0175141_344_661 105
276 3300049742 Ga0501080_0002681 Ga0501080_0002681_7431_7748 105
277 3300050492 nmdc:mga0yw44_506991_c1 nmdc:mga0yw44_506991_c1_62_385 105
278 3300003911 JGI25405J52794_10004901 JGI25405J52794_100049014 106
279 3300003911 JGI25405J52794_10009956 JGI25405J52794_100099562 106
280 3300005937 Ga0081455_10001246 Ga0081455_100012467 106
281 3300005981 Ga0081538_10012203 Ga0081538_1001220310 106
282 3300005981 Ga0081538_10015407 Ga0081538_1001540711 106
283 3300006038 Ga0075365_10682941 Ga0075365_106829412 106
284 3300006847 Ga0075431_100101856 Ga0075431_1001018563 106
285 3300006880 Ga0075429_100073670 Ga0075429_1000736703 106
286 3300009147 Ga0114129_10373735 Ga0114129_103737352 106
287 3300031852 Ga0307410_10902873 Ga0307410_109028732 106
288 3300032126 Ga0307415_102022954 Ga0307415_1020229542 106
289 3300035121 Ga0373960_0043861 Ga0373960_0043861_264_584 106
290 3300049568 Ga0501031_0166152 Ga0501031_0166152_816_1136 106
291 3300049569 Ga0501032_0603828 Ga0501032_0603828_229_549 106
292 3300049570 Ga0501033_0007082 Ga0501033_0007082_1205_1525 106
293 3300049572 Ga0501036_0016080 Ga0501036_0016080_2337_2657 106
294 3300049573 Ga0501037_0599049 Ga0501037_0599049_284_604 106
295 3300049574 Ga0501038_0038011 Ga0501038_0038011_63_383 106
296 3300049575 Ga0501039_0122634 Ga0501039_0122634_597_917 106
297 3300049576 Ga0501040_0011866 Ga0501040_0011866_3786_4106 106
298 3300049577 Ga0501041_0105967 Ga0501041_0105967_121_441 106
299 3300049578 Ga0501042_0013371 Ga0501042_0013371_4201_4521 106
300 3300049580 Ga0501046_0030593 Ga0501046_0030593_3207_3527 106
301 3300049582 Ga0501048_0227771 Ga0501048_0227771_878_1198 106
302 3300049584 Ga0501068_0403585 Ga0501068_0403585_138_458 106
303 3300049585 Ga0501069_0284022 Ga0501069_0284022_159_479 106
304 3300049586 Ga0501070_0142923 Ga0501070_0142923_1328_1648 106
305 3300049587 Ga0501071_0005915 Ga0501071_0005915_558_878 106
306 3300049588 Ga0501072_0015662 Ga0501072_0015662_2274_2594 106
307 3300049589 Ga0501073_0046586 Ga0501073_0046586_1864_2184 106
308 3300049590 Ga0501074_0063243 Ga0501074_0063243_1036_1356 106
309 3300049591 Ga0501075_0004688 Ga0501075_0004688_8644_8964 106
310 3300049592 Ga0501076_0007602 Ga0501076_0007602_2120_2440 106
311 3300049593 Ga0501077_0006635 Ga0501077_0006635_2758_3078 106
312 3300049741 Ga0501079_0017365 Ga0501079_0017365_403_723 106
313 3300049742 Ga0501080_0154590 Ga0501080_0154590_618_938 106
314 3300049743 Ga0501081_0142283 Ga0501081_0142283_518_838 106
315 3300049823 Ga0501044_0181252 Ga0501044_0181252_1281_1601 106
316 3300049824 Ga0501045_0002201 Ga0501045_0002201_10665_10985 106
317 3300050508 nmdc:mga09592_47724_c1 nmdc:mga09592_47724_c1_2832_3152 106
318 3300050510 nmdc:mga06r32_126116_c1 nmdc:mga06r32_126116_c1_2169_2489 106
319 3300053094 Ga0500566_0000391 Ga0500566_0000391_10480_10815 106
320 3300054114 Ga0501084_0004976 Ga0501084_0004976_1272_1592 106
321 3300054114 Ga0501084_0330786 Ga0501084_0330786_414_734 106
322 3300060353 Ga0501082_0018922 Ga0501082_0018922_4487_4807 106
323 3300061734 Ga0530510_0010398 Ga0530510_0010398_1398_1718 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

17

48

0.98

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

50

113

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9354 4 105
5o61-assembly1.cif.gz_V the complete structure of the mycobacterium smegmatis 70s ribosome 0.9267 4 105
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.9199 6 105
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9186 4 74
5o61-assembly1.cif.gz_V the complete structure of the mycobacterium smegmatis 70s ribosome 0.9177 4 105
ID Description Score Start End Superfamily
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9088 6 102 2.30.30.30
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8998 1 103 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8874 4 102 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8862 1 103 2.30.30.30
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8845 4 103 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A0G1V3V8-F1-model_v4 Large ribosomal subunit protein uL24 0.9499 4 106 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2M7RDH9-F1-model_v4 Large ribosomal subunit protein uL24 0.941 4 105 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G2P436-F1-model_v4 Large ribosomal subunit protein uL24 0.9403 4 106 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2H0W7W0-F1-model_v4 Large ribosomal subunit protein uL24 0.9393 4 106 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A142GUA8-F1-model_v4 Large ribosomal subunit protein uL24 0.9373 1 105 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.06 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map