F406973
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 323 | 217 | 303 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10047437|Ga0307515_100474374 |
| Length | 287 |
| Sequence | MQANPLHVLSAASRHVPSAAAKVSETLLIAGATGALGNAVVQALVGSPQFSGTTVLAREPIKTGMRGVTACVVPAARAPSTTPESQGDKPGMFEDWPVPTATTGVILFDPPRMYYQRERALWTPTPAQLPALARWMRACGVRTLAVVMPHVQGQLPEALKRGLANLDEQSVAALGFERLLIVRSAEKPGTGGVKRSWPARAAHGVLAAMSYMVPSSEQPVRASKVAELVDVALRNMSPGTHVAAPELVWRAAQGHLPSVVGEWLHKPSAEPLSGAKSKHLLHEAITR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 3 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 4 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 5 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 6 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 7 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 8 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 9 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 10 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 11 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 12 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 13 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 14 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 15 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 16 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 17 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 18 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 19 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 20 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 21 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 22 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 23 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 24 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 25 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 28 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 29 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 73 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 110 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 112 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 113 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 114 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 115 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 116 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 117 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 118 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 121 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 131 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 132 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 133 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 134 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 135 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 136 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 137 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 138 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 139 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 140 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 141 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 142 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 143 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 144 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 145 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 146 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 147 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 148 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 149 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 150 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 151 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 152 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 153 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 154 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 155 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 156 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 183 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 184 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 185 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 186 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 187 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 188 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 189 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 190 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 191 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 192 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 193 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 194 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 195 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 196 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 197 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 198 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 200 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 201 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 202 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 203 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 204 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 205 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 206 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 207 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 208 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 209 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 210 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 211 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 212 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 213 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 214 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 215 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 216 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 217 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.88 |
| Metatranscriptomes | 0.93 |
| Isolates | 6.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 37.46 |
| Nodule | 0.31 |
| Rhizoplane | 0.31 |
| Rhizosphere | 52.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1004268 | 3300002739 | Bacteria | 2154 |
| 2 | JGI25152J39213_1011901 | 3300002773 | Bacteria | 1897 |
| 3 | JGI25152J39213_1020322 | 3300002773 | Bacteria | 1188 |
| 4 | JGI25150J39212_1001540 | 3300002774 | Bacteria | 6318 |
| 5 | JGI25159J45721_1003103 | 3300002987 | Bacteria | 5997 |
| 6 | JGI25159J45721_1021986 | 3300002987 | Bacteria | 1189 |
| 7 | JGI25159J45721_1024737 | 3300002987 | Bacteria | 1063 |
| 8 | JGI25151J46595_10001064 | 3300003187 | Bacteria | 20476 |
| 9 | JGI25151J46595_10006226 | 3300003187 | Bacteria | 6035 |
| 10 | JGI25151J46595_10035965 | 3300003187 | Bacteria | 1874 |
| 11 | JGI25153J46596_10029664 | 3300003215 | Bacteria | 1874 |
| 12 | JGI25160J50197_1036543 | 3300003354 | Bacteria | 1189 |
| 13 | JGI25160J50197_1040180 | 3300003354 | Bacteria | 1087 |
| 14 | JGI25161J50226_1004008 | 3300003374 | Bacteria | 3189 |
| 15 | Ga0006562J51391_1059832 | 3300003578 | Bacteria | 1200 |
| 16 | Ga0006562J51391_1059833 | 3300003578 | Bacteria | 2380 |
| 17 | Ga0006562J51391_1074938 | 3300003578 | Bacteria | 3290 |
| 18 | Ga0055526_1025826 | 3300003771 | Bacteria | 1874 |
| 19 | Ga0055537_1010898 | 3300003773 | Bacteria | 1883 |
| 20 | Ga0055524_1025089 | 3300003775 | Bacteria | 1874 |
| 21 | Ga0055524_1025098 | 3300003775 | Bacteria | 1874 |
| 22 | Ga0055536_1006509 | 3300003781 | Bacteria | 5429 |
| 23 | Ga0055536_1008260 | 3300003781 | Bacteria | 4508 |
| 24 | Ga0055534_1010915 | 3300003784 | Bacteria | 1874 |
| 25 | Ga0055528_1023552 | 3300003790 | Bacteria | 1874 |
| 26 | Ga0055530_10001026 | 3300003791 | Bacteria | 22224 |
| 27 | Ga0055540_1002001 | 3300003792 | Bacteria | 11376 |
| 28 | Ga0055540_1025427 | 3300003792 | Bacteria | 1451 |
| 29 | Ga0055540_1028035 | 3300003792 | Bacteria | 1337 |
| 30 | Ga0055531_10004026 | 3300003794 | Bacteria | 9117 |
| 31 | Ga0055531_10010342 | 3300003794 | Bacteria | 4647 |
| 32 | Ga0055531_10021746 | 3300003794 | Bacteria | 2475 |
| 33 | Ga0055543_1003567 | 3300004625 | Bacteria | 4509 |
| 34 | Ga0055543_1011657 | 3300004625 | Bacteria | 1791 |
| 35 | Ga0065165_1009695 | 3300005262 | Bacteria | 4271 |
| 36 | Ga0065165_1028727 | 3300005262 | Bacteria | 1791 |
| 37 | Ga0070670_100051875 | 3300005331 | Bacteria | 3522 |
| 38 | Ga0068868_100313653 | 3300005338 | Bacteria | 1335 |
| 39 | Ga0070659_100238581 | 3300005366 | Bacteria | 1504 |
| 40 | Ga0070667_100679408 | 3300005367 | Bacteria | 952 |
| 41 | Ga0070662_100165322 | 3300005457 | Bacteria | 1733 |
| 42 | Ga0068853_100037536 | 3300005539 | Bacteria | 4122 |
| 43 | Ga0068853_100130890 | 3300005539 | Bacteria | 2246 |
| 44 | Ga0068853_100224279 | 3300005539 | Bacteria | 1717 |
| 45 | Ga0068853_100350525 | 3300005539 | Bacteria | 1373 |
| 46 | Ga0068855_100012581 | 3300005563 | Bacteria | 10213 |
| 47 | Ga0070664_100310719 | 3300005564 | Bacteria | 1426 |
| 48 | Ga0068857_100301704 | 3300005577 | Bacteria | 1477 |
| 49 | Ga0068857_100660842 | 3300005577 | Bacteria | 991 |
| 50 | Ga0068864_100042885 | 3300005618 | Bacteria | 3872 |
| 51 | Ga0068863_100201003 | 3300005841 | Bacteria | 1917 |
| 52 | Ga0068862_100042081 | 3300005844 | Bacteria | 3890 |
| 53 | Ga0075365_10073826 | 3300006038 | Bacteria | 2300 |
| 54 | Ga0075365_10524343 | 3300006038 | Bacteria | 838 |
| 55 | Ga0075363_100012317 | 3300006048 | Bacteria | 4119 |
| 56 | Ga0075362_10005571 | 3300006177 | Bacteria | 4622 |
| 57 | Ga0075367_10118070 | 3300006178 | Bacteria | 1633 |
| 58 | Ga0075367_10128964 | 3300006178 | Bacteria | 1562 |
| 59 | Ga0075367_10211548 | 3300006178 | Bacteria | 1213 |
| 60 | Ga0075369_10091132 | 3300006186 | Bacteria | 1360 |
| 61 | Ga0075366_10032893 | 3300006195 | Bacteria | 3054 |
| 62 | Ga0075366_10063911 | 3300006195 | Bacteria | 2188 |
| 63 | Ga0075370_10008223 | 3300006353 | Bacteria | 5355 |
| 64 | Ga0075370_10012010 | 3300006353 | Bacteria | 4565 |
| 65 | Ga0075370_10116300 | 3300006353 | Bacteria | 1555 |
| 66 | Ga0075370_10125598 | 3300006353 | Bacteria | 1495 |
| 67 | Ga0075370_10153161 | 3300006353 | Bacteria | 1351 |
| 68 | Ga0075370_10314921 | 3300006353 | Bacteria | 932 |
| 69 | Ga0075430_100168151 | 3300006846 | Bacteria | 1824 |
| 70 | Ga0075429_100134955 | 3300006880 | Bacteria | 2160 |
| 71 | Ga0105244_10002760 | 3300009036 | Bacteria | 13093 |
| 72 | Ga0105245_10377537 | 3300009098 | Bacteria | 1411 |
| 73 | Ga0105243_10006107 | 3300009148 | Bacteria | 9311 |
| 74 | Ga0105243_10026715 | 3300009148 | Bacteria | 4420 |
| 75 | Ga0105242_10389680 | 3300009176 | Bacteria | 1297 |
| 76 | Ga0105237_10011415 | 3300009545 | Bacteria | 9395 |
| 77 | Ga0105238_10075212 | 3300009551 | Bacteria | 3369 |
| 78 | Ga0105238_10317760 | 3300009551 | Bacteria | 1543 |
| 79 | Ga0157347_1001293 | 3300012502 | Bacteria | 1935 |
| 80 | Ga0157347_1008244 | 3300012502 | Bacteria | 1057 |
| 81 | Ga0157373_10093222 | 3300013100 | Bacteria | 2121 |
| 82 | Ga0157373_10204540 | 3300013100 | Bacteria | 1392 |
| 83 | Ga0157369_10017800 | 3300013105 | Bacteria | 7976 |
| 84 | Ga0157378_10324955 | 3300013297 | Bacteria | 1495 |
| 85 | Ga0182008_10030931 | 3300014497 | Bacteria | 2696 |
| 86 | Ga0182008_10041440 | 3300014497 | Bacteria | 2296 |
| 87 | Ga0182008_10054680 | 3300014497 | Bacteria | 1975 |
| 88 | Ga0182006_1001315 | 3300015261 | Bacteria | 15262 |
| 89 | Ga0182006_1018209 | 3300015261 | Bacteria | 2972 |
| 90 | Ga0182007_10008900 | 3300015262 | Bacteria | 4091 |
| 91 | Ga0183362_10007 | 3300015683 | Bacteria | 240101 |
| 92 | Ga0163161_10038940 | 3300017792 | Bacteria | 3411 |
| 93 | Ga0209436_104893 | 3300025208 | Bacteria | 3209 |
| 94 | Ga0209436_112376 | 3300025208 | Bacteria | 1451 |
| 95 | Ga0207425_1000231 | 3300025245 | Bacteria | 43311 |
| 96 | Ga0207425_1003175 | 3300025245 | Bacteria | 5377 |
| 97 | Ga0209129_1000177 | 3300025258 | Bacteria | 93081 |
| 98 | Ga0209129_1006422 | 3300025258 | Bacteria | 3800 |
| 99 | Ga0209565_1000241 | 3300025263 | Bacteria | 58986 |
| 100 | Ga0209673_1000377 | 3300025273 | Bacteria | 80360 |
| 101 | Ga0209673_1000507 | 3300025273 | Bacteria | 64168 |
| 102 | Ga0209130_1000218 | 3300025284 | Bacteria | 75339 |
| 103 | Ga0209130_1005494 | 3300025284 | Bacteria | 4374 |
| 104 | Ga0209675_1000893 | 3300025291 | Bacteria | 19163 |
| 105 | Ga0209675_1005373 | 3300025291 | Bacteria | 5381 |
| 106 | Ga0209675_1015471 | 3300025291 | Bacteria | 2263 |
| 107 | Ga0209676_1000202 | 3300025292 | Bacteria | 133078 |
| 108 | Ga0209676_1000375 | 3300025292 | Bacteria | 82420 |
| 109 | Ga0209676_1007524 | 3300025292 | Bacteria | 5083 |
| 110 | Ga0209025_1000285 | 3300025294 | Bacteria | 114575 |
| 111 | Ga0209025_1000322 | 3300025294 | Bacteria | 106667 |
| 112 | Ga0209025_1000359 | 3300025294 | Bacteria | 97475 |
| 113 | Ga0209025_1006288 | 3300025294 | Bacteria | 9284 |
| 114 | Ga0209025_1009794 | 3300025294 | Bacteria | 6613 |
| 115 | Ga0209564_1000223 | 3300025295 | Bacteria | 128117 |
| 116 | Ga0209564_1000226 | 3300025295 | Bacteria | 125693 |
| 117 | Ga0209758_1000142 | 3300025297 | Bacteria | 171779 |
| 118 | Ga0209758_1014767 | 3300025297 | Bacteria | 4119 |
| 119 | Ga0209050_1000224 | 3300025298 | Bacteria | 125433 |
| 120 | Ga0209256_1000114 | 3300025299 | Bacteria | 173999 |
| 121 | Ga0209256_1000174 | 3300025299 | Bacteria | 128117 |
| 122 | Ga0207426_1000162 | 3300025302 | Bacteria | 172643 |
| 123 | Ga0207426_1000232 | 3300025302 | Bacteria | 128117 |
| 124 | Ga0209051_1000112 | 3300025303 | Bacteria | 152667 |
| 125 | Ga0209051_1000313 | 3300025303 | Bacteria | 75138 |
| 126 | Ga0209257_1000163 | 3300025304 | Bacteria | 175355 |
| 127 | Ga0209257_1001238 | 3300025304 | Bacteria | 31583 |
| 128 | Ga0209257_1004089 | 3300025304 | Bacteria | 11689 |
| 129 | Ga0207655_1006481 | 3300025728 | Bacteria | 7748 |
| 130 | Ga0207649_10462814 | 3300025920 | Bacteria | 959 |
| 131 | Ga0207694_10036947 | 3300025924 | Bacteria | 3749 |
| 132 | Ga0207650_10124488 | 3300025925 | Bacteria | 2011 |
| 133 | Ga0207687_10243213 | 3300025927 | Bacteria | 1427 |
| 134 | Ga0207687_10436770 | 3300025927 | Bacteria | 1083 |
| 135 | Ga0207690_10125410 | 3300025932 | Bacteria | 1871 |
| 136 | Ga0207706_10005320 | 3300025933 | Bacteria | 12002 |
| 137 | Ga0207709_10028985 | 3300025935 | Bacteria | 3205 |
| 138 | Ga0207689_10363820 | 3300025942 | Bacteria | 1203 |
| 139 | Ga0207679_10031057 | 3300025945 | Bacteria | 3736 |
| 140 | Ga0207667_10120766 | 3300025949 | Bacteria | 2700 |
| 141 | Ga0207640_10017911 | 3300025981 | Bacteria | 4152 |
| 142 | Ga0207640_10162781 | 3300025981 | Bacteria | 1653 |
| 143 | Ga0207677_10126403 | 3300026023 | Bacteria | 1933 |
| 144 | Ga0207639_10023896 | 3300026041 | Bacteria | 4417 |
| 145 | Ga0207639_10039194 | 3300026041 | Bacteria | 3529 |
| 146 | Ga0207639_10383986 | 3300026041 | Bacteria | 1262 |
| 147 | Ga0207641_10068413 | 3300026088 | Bacteria | 3045 |
| 148 | Ga0207676_10044207 | 3300026095 | Bacteria | 3435 |
| 149 | Ga0207428_10186035 | 3300027907 | Bacteria | 1567 |
| 150 | Ga0268265_10026958 | 3300028380 | Bacteria | 4094 |
| 151 | Ga0307515_10001329 | 3300028794 | Bacteria | 56020 |
| 152 | Ga0307515_10047437 | 3300028794 | Bacteria | 6529 |
| 153 | Ga0316177_1190926 | 3300030731 | Bacteria | 1954 |
| 154 | Ga0314311_1054731 | 3300030733 | Bacteria | 1558 |
| 155 | Ga0316180_1049446 | 3300030736 | Bacteria | 2179 |
| 156 | Ga0316183_1031158 | 3300030742 | Bacteria | 2176 |
| 157 | Ga0316181_1008937 | 3300030744 | Bacteria | 1994 |
| 158 | Ga0316181_1079860 | 3300030744 | Bacteria | 1320 |
| 159 | Ga0316182_1037951 | 3300030745 | Bacteria | 2117 |
| 160 | Ga0316182_1332530 | 3300030745 | Bacteria | 6293 |
| 161 | Ga0307513_10071079 | 3300031456 | Bacteria | 3634 |
| 162 | Ga0307408_100038858 | 3300031548 | Bacteria | 3359 |
| 163 | Ga0307408_100120239 | 3300031548 | Bacteria | 2033 |
| 164 | Ga0307514_10016759 | 3300031649 | Bacteria | 6035 |
| 165 | Ga0307413_10656871 | 3300031824 | Bacteria | 866 |
| 166 | Ga0307412_10002787 | 3300031911 | Bacteria | 9711 |
| 167 | Ga0307412_10042035 | 3300031911 | Bacteria | 2966 |
| 168 | Ga0307412_10068225 | 3300031911 | Bacteria | 2417 |
| 169 | Ga0307416_100134517 | 3300032002 | Bacteria | 2233 |
| 170 | Ga0307416_100274645 | 3300032002 | Bacteria | 1657 |
| 171 | Ga0307416_100427059 | 3300032002 | Bacteria | 1371 |
| 172 | Ga0307414_10204627 | 3300032004 | Bacteria | 1608 |
| 173 | Ga0307414_10237936 | 3300032004 | Bacteria | 1505 |
| 174 | Ga0307414_10248967 | 3300032004 | Bacteria | 1476 |
| 175 | Ga0395899_0007482 | 3300037312 | Bacteria | 8437 |
| 176 | Ga0395900_0608519 | 3300037418 | Bacteria | 1032 |
| 177 | Ga0395898_0027416 | 3300037466 | Bacteria | 5719 |
| 178 | Ga0395898_0050626 | 3300037466 | Bacteria | 4065 |
| 179 | Ga0395905_0001234 | 3300037471 | Bacteria | 31751 |
| 180 | Ga0395905_0026376 | 3300037471 | Bacteria | 5479 |
| 181 | Ga0395905_0120582 | 3300037471 | Bacteria | 2465 |
| 182 | Ga0395905_0637448 | 3300037471 | Bacteria | 967 |
| 183 | Ga0395905_0670481 | 3300037471 | Bacteria | 939 |
| 184 | Ga0395901_0230600 | 3300038443 | Bacteria | 1933 |
| 185 | Ga0395901_0409367 | 3300038443 | Bacteria | 1392 |
| 186 | Ga0395901_0457479 | 3300038443 | Bacteria | 1304 |
| 187 | Ga0439436_0020585 | 3300041404 | Bacteria | 1964 |
| 188 | Ga0439439_0047272 | 3300041406 | Bacteria | 1124 |
| 189 | Ga0439447_029697 | 3300041407 | Bacteria | 1382 |
| 190 | Ga0439453_0029838 | 3300041408 | Bacteria | 1028 |
| 191 | Ga0439466_0007751 | 3300041411 | Bacteria | 4055 |
| 192 | Ga0439466_0009925 | 3300041411 | Bacteria | 3543 |
| 193 | Ga0439465_0004301 | 3300041413 | Bacteria | 4621 |
| 194 | Ga0439431_0010265 | 3300041997 | Bacteria | 2123 |
| 195 | Ga0439433_0000045 | 3300041999 | Bacteria | 15562 |
| 196 | Ga0439445_0036263 | 3300042004 | Bacteria | 1297 |
| 197 | Ga0439432_005774 | 3300042006 | Bacteria | 4446 |
| 198 | Ga0439432_016758 | 3300042006 | Bacteria | 2464 |
| 199 | Ga0439449_0005358 | 3300042007 | Bacteria | 4914 |
| 200 | Ga0439449_0007552 | 3300042007 | Bacteria | 4131 |
| 201 | Ga0439449_0104535 | 3300042007 | Bacteria | 1047 |
| 202 | Ga0439452_005227 | 3300042010 | Bacteria | 4213 |
| 203 | Ga0439452_012496 | 3300042010 | Bacteria | 2413 |
| 204 | Ga0439457_008152 | 3300042014 | Bacteria | 2479 |
| 205 | Ga0439462_0005641 | 3300042015 | Bacteria | 3090 |
| 206 | Ga0439462_0009690 | 3300042015 | Bacteria | 2435 |
| 207 | Ga0439462_0040706 | 3300042015 | Bacteria | 1239 |
| 208 | Ga0450923_017420 | 3300042125 | Bacteria | 1364 |
| 209 | Ga0450898_016783 | 3300042134 | Bacteria | 1253 |
| 210 | Ga0450903_007738 | 3300042138 | Bacteria | 1764 |
| 211 | Ga0439446_0075234 | 3300042156 | Bacteria | 1038 |
| 212 | Ga0450909_005815 | 3300042185 | Bacteria | 1777 |
| 213 | Ga0450909_008969 | 3300042185 | Bacteria | 1458 |
| 214 | Ga0439434_0005028 | 3300042435 | Bacteria | 3865 |
| 215 | Ga0439434_0033331 | 3300042435 | Bacteria | 1569 |
| 216 | Ga0439435_0048944 | 3300042436 | Bacteria | 1205 |
| 217 | Ga0439464_0099792 | 3300042439 | Bacteria | 881 |
| 218 | Ga0450893_0005001 | 3300042532 | Bacteria | 2117 |
| 219 | Ga0466972_0078074 | 3300044658 | Bacteria | 1577 |
| 220 | Ga0453683_0002165 | 3300044673 | Bacteria | 15622 |
| 221 | Ga0466965_0017027 | 3300044683 | Bacteria | 3468 |
| 222 | Ga0466957_0070138 | 3300044842 | Bacteria | 2166 |
| 223 | Ga0466957_0393278 | 3300044842 | Bacteria | 947 |
| 224 | Ga0451576_0004788 | 3300045051 | Bacteria | 17348 |
| 225 | Ga0451576_0172750 | 3300045051 | Bacteria | 2256 |
| 226 | Ga0466967_0170567 | 3300045976 | Bacteria | 2047 |
| 227 | Ga0495638_0005794 | 3300046460 | Bacteria | 9091 |
| 228 | Ga0495651_0041245 | 3300046462 | Bacteria | 3586 |
| 229 | Ga0495610_0063526 | 3300046512 | Bacteria | 1748 |
| 230 | Ga0495616_0006998 | 3300046513 | Bacteria | 6789 |
| 231 | Ga0495620_0012819 | 3300046515 | Bacteria | 4312 |
| 232 | Ga0495631_0000158 | 3300046518 | Bacteria | 45721 |
| 233 | Ga0495637_0053637 | 3300046520 | Bacteria | 1677 |
| 234 | Ga0495642_0029346 | 3300046528 | Bacteria | 2195 |
| 235 | Ga0495587_0287336 | 3300046536 | Bacteria | 921 |
| 236 | Ga0495656_0003746 | 3300046615 | Bacteria | 5163 |
| 237 | Ga0495668_0120694 | 3300046616 | Bacteria | 1434 |
| 238 | Ga0495625_0034974 | 3300046660 | Bacteria | 3705 |
| 239 | Ga0495588_0045824 | 3300046674 | Bacteria | 2243 |
| 240 | Ga0495588_0084220 | 3300046674 | Bacteria | 1661 |
| 241 | Ga0495669_0025140 | 3300046684 | Bacteria | 2596 |
| 242 | Ga0495624_0112204 | 3300046690 | Bacteria | 1676 |
| 243 | Ga0495671_0005694 | 3300046692 | Bacteria | 7269 |
| 244 | Ga0495636_0031830 | 3300047318 | Bacteria | 2163 |
| 245 | Ga0495676_0064752 | 3300047321 | Bacteria | 2840 |
| 246 | Ga0495677_0067960 | 3300047445 | Bacteria | 1326 |
| 247 | Ga0495593_0009779 | 3300047673 | Bacteria | 5562 |
| 248 | Ga0495602_0386518 | 3300048088 | Bacteria | 1001 |
| 249 | Ga0495602_0386786 | 3300048088 | Bacteria | 1001 |
| 250 | Ga0495614_0067041 | 3300048089 | Bacteria | 1544 |
| 251 | Ga0496101_0010997 | 3300048904 | Bacteria | 5996 |
| 252 | Ga0496116_0020450 | 3300048919 | Bacteria | 5026 |
| 253 | Ga0496116_0062455 | 3300048919 | Bacteria | 2405 |
| 254 | Ga0496117_0017144 | 3300048920 | Bacteria | 6062 |
| 255 | Ga0496117_0034963 | 3300048920 | Bacteria | 3779 |
| 256 | Ga0496118_0018823 | 3300048921 | Bacteria | 6201 |
| 257 | Ga0496121_0059192 | 3300048924 | Bacteria | 3160 |
| 258 | Ga0496122_0075191 | 3300048925 | Bacteria | 2385 |
| 259 | Ga0496122_0075296 | 3300048925 | Bacteria | 2382 |
| 260 | Ga0496123_0063244 | 3300048926 | Bacteria | 2366 |
| 261 | Ga0496124_0119267 | 3300048927 | Bacteria | 2110 |
| 262 | Ga0496125_0033926 | 3300048928 | Bacteria | 4507 |
| 263 | Ga0496125_0046119 | 3300048928 | Bacteria | 3660 |
| 264 | Ga0496125_0251747 | 3300048928 | Bacteria | 1114 |
| 265 | Ga0501262_000542 | 3300049759 | Bacteria | 4505 |
| 266 | Ga0501263_001753 | 3300049760 | Bacteria | 2106 |
| 267 | nmdc:mga03683_86206_c1 | 3300050489 | Bacteria | 1363 |
| 268 | nmdc:mga00v17_238348_c1 | 3300050491 | Bacteria | 1179 |
| 269 | nmdc:mga0yw44_85021_c1 | 3300050492 | Bacteria | 1990 |
| 270 | nmdc:mga0k408_213128_c1 | 3300050493 | Bacteria | 1153 |
| 271 | nmdc:mga0k408_42949_c1 | 3300050493 | Bacteria | 2604 |
| 272 | nmdc:mga06z11_209596_c1 | 3300050494 | Bacteria | 1135 |
| 273 | nmdc:mga06z11_57423_c1 | 3300050494 | Bacteria | 2016 |
| 274 | nmdc:mga06z11_90582_c1 | 3300050494 | Bacteria | 1659 |
| 275 | nmdc:mga07m45_14998_c1 | 3300050496 | Bacteria | 4137 |
| 276 | nmdc:mga07m45_252463_c1 | 3300050496 | Bacteria | 1026 |
| 277 | nmdc:mga07m45_56236_c1 | 3300050496 | Bacteria | 2224 |
| 278 | nmdc:mga07m45_8222_c1 | 3300050496 | Bacteria | 5352 |
| 279 | nmdc:mga0qj67_151692_c1 | 3300050509 | Bacteria | 1880 |
| 280 | Ga0500610_0022621 | 3300053079 | Bacteria | 3101 |
| 281 | Ga0500610_0034434 | 3300053079 | Bacteria | 2591 |
| 282 | Ga0500643_011220 | 3300053087 | Bacteria | 3282 |
| 283 | Ga0500651_0001059 | 3300053093 | Bacteria | 13571 |
| 284 | Ga0500555_024519 | 3300053103 | Bacteria | 1728 |
| 285 | Ga0500562_015430 | 3300053108 | Bacteria | 1959 |
| 286 | Ga0500571_000368 | 3300053110 | Bacteria | 17744 |
| 287 | Ga0500572_016901 | 3300053111 | Bacteria | 1867 |
| 288 | Ga0500593_008016 | 3300053117 | Bacteria | 4327 |
| 289 | Ga0500594_0004055 | 3300053118 | Bacteria | 3224 |
| 290 | Ga0500607_000585 | 3300053121 | Bacteria | 35102 |
| 291 | Ga0500607_004969 | 3300053121 | Bacteria | 8860 |
| 292 | Ga0500608_056505 | 3300053122 | Bacteria | 1880 |
| 293 | Ga0500658_0000190 | 3300053134 | Bacteria | 29332 |
| 294 | Ga0500658_0000270 | 3300053134 | Bacteria | 23768 |
| 295 | Ga0500559_0030714 | 3300053136 | Bacteria | 2304 |
| 296 | Ga0500568_0001857 | 3300053139 | Bacteria | 13004 |
| 297 | Ga0500616_0027479 | 3300053153 | Bacteria | 3141 |
| 298 | Ga0500616_0043199 | 3300053153 | Bacteria | 2410 |
| 299 | Ga0500627_0000093 | 3300053158 | Bacteria | 29716 |
| 300 | Ga0500634_0063495 | 3300053161 | Bacteria | 1953 |
| 301 | Ga0500634_0134940 | 3300053161 | Bacteria | 1178 |
| 302 | Ga0500638_004264 | 3300053162 | Bacteria | 5473 |
| 303 | Ga0500636_0007142 | 3300053177 | Bacteria | 6450 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053121 | Ga0500607_000585 | Ga0500607_000585_349_1098 | 218 |
| 2 | 3300012502 | Ga0157347_1008244 | Ga0157347_10082441 | 221 |
| 3 | 3300038443 | Ga0395901_0230600 | Ga0395901_0230600_598_1266 | 222 |
| 4 | 3300025927 | Ga0207687_10436770 | Ga0207687_104367701 | 223 |
| 5 | 3300048925 | Ga0496122_0075296 | Ga0496122_0075296_1455_2255 | 223 |
| 6 | 3300053122 | Ga0500608_056505 | Ga0500608_056505_79_771 | 225 |
| 7 | 3300006038 | Ga0075365_10073826 | Ga0075365_100738263 | 227 |
| 8 | 3300050492 | nmdc:mga0yw44_85021_c1 | nmdc:mga0yw44_85021_c1_1014_1760 | 227 |
| 9 | 3300046512 | Ga0495610_0063526 | Ga0495610_0063526_156_905 | 228 |
| 10 | 3300053079 | Ga0500610_0034434 | Ga0500610_0034434_1759_2508 | 228 |
| 11 | 3300046515 | Ga0495620_0012819 | Ga0495620_0012819_3028_3777 | 231 |
| 12 | 3300046520 | Ga0495637_0053637 | Ga0495637_0053637_912_1661 | 231 |
| 13 | 3300049759 | Ga0501262_000542 | Ga0501262_000542_2411_3178 | 231 |
| 14 | 3300053079 | Ga0500610_0022621 | Ga0500610_0022621_84_833 | 231 |
| 15 | 3300053103 | Ga0500555_024519 | Ga0500555_024519_780_1529 | 231 |
| 16 | 3300053117 | Ga0500593_008016 | Ga0500593_008016_3288_4037 | 231 |
| 17 | 3300053161 | Ga0500634_0063495 | Ga0500634_0063495_892_1641 | 231 |
| 18 | 3300005539 | Ga0068853_100350525 | Ga0068853_1003505252 | 232 |
| 19 | 3300014497 | Ga0182008_10054680 | Ga0182008_100546803 | 232 |
| 20 | 3300032002 | Ga0307416_100274645 | Ga0307416_1002746451 | 232 |
| 21 | 3300037471 | Ga0395905_0670481 | Ga0395905_0670481_143_841 | 232 |
| 22 | 3300006038 | Ga0075365_10524343 | Ga0075365_105243431 | 233 |
| 23 | 3300006178 | Ga0075367_10128964 | Ga0075367_101289642 | 233 |
| 24 | 3300037471 | Ga0395905_0001234 | Ga0395905_0001234_25498_26199 | 233 |
| 25 | 3300037471 | Ga0395905_0026376 | Ga0395905_0026376_2163_2864 | 233 |
| 26 | 3300030731 | Ga0316177_1190926 | Ga0316177_11909261 | 234 |
| 27 | 3300005338 | Ga0068868_100313653 | Ga0068868_1003136532 | 235 |
| 28 | 3300013297 | Ga0157378_10324955 | Ga0157378_103249552 | 235 |
| 29 | 3300026023 | Ga0207677_10126403 | Ga0207677_101264032 | 235 |
| 30 | 3300037312 | Ga0395899_0007482 | Ga0395899_0007482_2037_2780 | 235 |
| 31 | 3300037418 | Ga0395900_0608519 | Ga0395900_0608519_101_844 | 235 |
| 32 | 3300037466 | Ga0395898_0027416 | Ga0395898_0027416_352_1095 | 235 |
| 33 | 3300038443 | Ga0395901_0409367 | Ga0395901_0409367_75_818 | 235 |
| 34 | 3300041408 | Ga0439453_0029838 | Ga0439453_0029838_75_815 | 235 |
| 35 | 3300042134 | Ga0450898_016783 | Ga0450898_016783_315_1055 | 235 |
| 36 | 3300042185 | Ga0450909_005815 | Ga0450909_005815_62_802 | 235 |
| 37 | 3300038443 | Ga0395901_0457479 | Ga0395901_0457479_82_825 | 237 |
| 38 | 3300044842 | Ga0466957_0070138 | Ga0466957_0070138_363_1106 | 237 |
| 39 | 3300044842 | Ga0466957_0393278 | Ga0466957_0393278_23_739 | 238 |
| 40 | 3300005618 | Ga0068864_100042885 | Ga0068864_1000428852 | 239 |
| 41 | 3300025925 | Ga0207650_10124488 | Ga0207650_101244883 | 239 |
| 42 | 3300031548 | Ga0307408_100120239 | Ga0307408_1001202393 | 244 |
| 43 | 3300045051 | Ga0451576_0172750 | Ga0451576_0172750_745_1482 | 245 |
| 44 | 3300005331 | Ga0070670_100051875 | Ga0070670_1000518752 | 246 |
| 45 | 3300005841 | Ga0068863_100201003 | Ga0068863_1002010033 | 246 |
| 46 | 3300006846 | Ga0075430_100168151 | Ga0075430_1001681513 | 246 |
| 47 | 3300006880 | Ga0075429_100134955 | Ga0075429_1001349553 | 246 |
| 48 | 3300026088 | Ga0207641_10068413 | Ga0207641_100684133 | 246 |
| 49 | 3300026095 | Ga0207676_10044207 | Ga0207676_100442074 | 246 |
| 50 | 3300037471 | Ga0395905_0637448 | Ga0395905_0637448_103_843 | 246 |
| 51 | 3300042138 | Ga0450903_007738 | Ga0450903_007738_652_1392 | 246 |
| 52 | 3300042439 | Ga0439464_0099792 | Ga0439464_0099792_31_771 | 246 |
| 53 | 3300045976 | Ga0466967_0170567 | Ga0466967_0170567_47_787 | 246 |
| 54 | 3300049760 | Ga0501263_001753 | Ga0501263_001753_11_751 | 246 |
| 55 | 3300050489 | nmdc:mga03683_86206_c1 | nmdc:mga03683_86206_c1_410_1156 | 246 |
| 56 | 3300050493 | nmdc:mga0k408_213128_c1 | nmdc:mga0k408_213128_c1_213_959 | 246 |
| 57 | 3300050509 | nmdc:mga0qj67_151692_c1 | nmdc:mga0qj67_151692_c1_215_955 | 246 |
| 58 | iso_pu_bacteria | 2831265667 | 2831268165 | 246 |
| 59 | iso_pu_bacteria | 2945972063 | 2945974122 | 246 |
| 60 | iso_pu_bacteria | 2513020051 | 2513231681 | 247 |
| 61 | iso_pu_bacteria | 2643221672 | 2644397375 | 247 |
| 62 | iso_pu_bacteria | 2885192300 | 2885197631 | 247 |
| 63 | iso_pu_bacteria | 2885198086 | 2885199892 | 247 |
| 64 | iso_pu_bacteria | 2885211737 | 2885213587 | 247 |
| 65 | 3300037466 | Ga0395898_0050626 | Ga0395898_0050626_2526_3275 | 248 |
| 66 | 3300037471 | Ga0395905_0120582 | Ga0395905_0120582_759_1508 | 248 |
| 67 | 3300042007 | Ga0439449_0005358 | Ga0439449_0005358_3002_3748 | 248 |
| 68 | 3300042015 | Ga0439462_0009690 | Ga0439462_0009690_1056_1802 | 248 |
| 69 | 3300042436 | Ga0439435_0048944 | Ga0439435_0048944_36_782 | 248 |
| 70 | iso_pu_bacteria | 2643221658 | 2644326004 | 248 |
| 71 | iso_pu_bacteria | 2738541277 | 2738723226 | 248 |
| 72 | iso_pu_bacteria | 2738543019 | 2739283957 | 248 |
| 73 | iso_pu_bacteria | 2838054893 | 2838061015 | 248 |
| 74 | iso_pu_bacteria | 2842677519 | 2842680644 | 248 |
| 75 | iso_pu_bacteria | 2904541872 | 2904549157 | 248 |
| 76 | iso_pu_bacteria | 2928070936 | 2928072789 | 248 |
| 77 | iso_pu_bacteria | 2928084124 | 2928085954 | 248 |
| 78 | iso_pu_bacteria | 2929160207 | 2929160785 | 248 |
| 79 | iso_pu_bacteria | 2929520902 | 2929525945 | 248 |
| 80 | iso_pu_bacteria | 2954767861 | 2954769396 | 248 |
| 81 | 3300005366 | Ga0070659_100238581 | Ga0070659_1002385812 | 249 |
| 82 | 3300005577 | Ga0068857_100660842 | Ga0068857_1006608421 | 249 |
| 83 | 3300005844 | Ga0068862_100042081 | Ga0068862_1000420814 | 249 |
| 84 | 3300006186 | Ga0075369_10091132 | Ga0075369_100911322 | 249 |
| 85 | 3300012502 | Ga0157347_1001293 | Ga0157347_10012932 | 249 |
| 86 | 3300014497 | Ga0182008_10030931 | Ga0182008_100309313 | 249 |
| 87 | 3300015261 | Ga0182006_1018209 | Ga0182006_10182093 | 249 |
| 88 | 3300028380 | Ga0268265_10026958 | Ga0268265_100269584 | 249 |
| 89 | 3300031649 | Ga0307514_10016759 | Ga0307514_100167595 | 249 |
| 90 | 3300044673 | Ga0453683_0002165 | Ga0453683_0002165_14023_14808 | 249 |
| 91 | 3300045051 | Ga0451576_0004788 | Ga0451576_0004788_1450_2235 | 249 |
| 92 | 3300046528 | Ga0495642_0029346 | Ga0495642_0029346_1159_1917 | 249 |
| 93 | 3300046615 | Ga0495656_0003746 | Ga0495656_0003746_270_1028 | 249 |
| 94 | 3300046674 | Ga0495588_0045824 | Ga0495588_0045824_1393_2151 | 249 |
| 95 | 3300046674 | Ga0495588_0084220 | Ga0495588_0084220_243_995 | 249 |
| 96 | 3300046684 | Ga0495669_0025140 | Ga0495669_0025140_1159_1917 | 249 |
| 97 | 3300046692 | Ga0495671_0005694 | Ga0495671_0005694_487_1236 | 249 |
| 98 | 3300047318 | Ga0495636_0031830 | Ga0495636_0031830_950_1708 | 249 |
| 99 | 3300047445 | Ga0495677_0067960 | Ga0495677_0067960_313_1071 | 249 |
| 100 | 3300053158 | Ga0500627_0000093 | Ga0500627_0000093_10463_11212 | 249 |
| 101 | 3300002987 | JGI25159J45721_1003103 | JGI25159J45721_10031031 | 250 |
| 102 | 3300005539 | Ga0068853_100130890 | Ga0068853_1001308901 | 250 |
| 103 | 3300005563 | Ga0068855_100012581 | Ga0068855_1000125816 | 250 |
| 104 | 3300005577 | Ga0068857_100301704 | Ga0068857_1003017042 | 250 |
| 105 | 3300009545 | Ga0105237_10011415 | Ga0105237_1001141510 | 250 |
| 106 | 3300009551 | Ga0105238_10317760 | Ga0105238_103177602 | 250 |
| 107 | 3300013105 | Ga0157369_10017800 | Ga0157369_100178002 | 250 |
| 108 | 3300015683 | Ga0183362_10007 | Ga0183362_10007178 | 250 |
| 109 | 3300025932 | Ga0207690_10125410 | Ga0207690_101254102 | 250 |
| 110 | 3300025949 | Ga0207667_10120766 | Ga0207667_101207663 | 250 |
| 111 | 3300026041 | Ga0207639_10383986 | Ga0207639_103839862 | 250 |
| 112 | 3300053108 | Ga0500562_015430 | Ga0500562_015430_906_1766 | 250 |
| 113 | iso_pu_bacteria | 2945909444 | 2945914677 | 250 |
| 114 | 3300003781 | Ga0055536_1006509 | Ga0055536_10065092 | 251 |
| 115 | 3300003792 | Ga0055540_1002001 | Ga0055540_10020018 | 251 |
| 116 | 3300003794 | Ga0055531_10004026 | Ga0055531_100040264 | 251 |
| 117 | 3300005367 | Ga0070667_100679408 | Ga0070667_1006794081 | 251 |
| 118 | 3300005457 | Ga0070662_100165322 | Ga0070662_1001653222 | 251 |
| 119 | 3300005539 | Ga0068853_100224279 | Ga0068853_1002242792 | 251 |
| 120 | 3300005564 | Ga0070664_100310719 | Ga0070664_1003107192 | 251 |
| 121 | 3300006048 | Ga0075363_100012317 | Ga0075363_1000123175 | 251 |
| 122 | 3300006177 | Ga0075362_10005571 | Ga0075362_100055717 | 251 |
| 123 | 3300006178 | Ga0075367_10211548 | Ga0075367_102115481 | 251 |
| 124 | 3300006195 | Ga0075366_10063911 | Ga0075366_100639113 | 251 |
| 125 | 3300006353 | Ga0075370_10012010 | Ga0075370_100120103 | 251 |
| 126 | 3300006353 | Ga0075370_10314921 | Ga0075370_103149212 | 251 |
| 127 | 3300009036 | Ga0105244_10002760 | Ga0105244_100027605 | 251 |
| 128 | 3300009098 | Ga0105245_10377537 | Ga0105245_103775372 | 251 |
| 129 | 3300009148 | Ga0105243_10006107 | Ga0105243_100061072 | 251 |
| 130 | 3300009176 | Ga0105242_10389680 | Ga0105242_103896801 | 251 |
| 131 | 3300009551 | Ga0105238_10075212 | Ga0105238_100752123 | 251 |
| 132 | 3300014497 | Ga0182008_10041440 | Ga0182008_100414403 | 251 |
| 133 | 3300015261 | Ga0182006_1001315 | Ga0182006_100131513 | 251 |
| 134 | 3300015262 | Ga0182007_10008900 | Ga0182007_100089002 | 251 |
| 135 | 3300025292 | Ga0209676_1000375 | Ga0209676_100037529 | 251 |
| 136 | 3300025303 | Ga0209051_1000112 | Ga0209051_100011223 | 251 |
| 137 | 3300025304 | Ga0209257_1001238 | Ga0209257_100123813 | 251 |
| 138 | 3300025728 | Ga0207655_1006481 | Ga0207655_10064817 | 251 |
| 139 | 3300025920 | Ga0207649_10462814 | Ga0207649_104628141 | 251 |
| 140 | 3300025924 | Ga0207694_10036947 | Ga0207694_100369473 | 251 |
| 141 | 3300025927 | Ga0207687_10243213 | Ga0207687_102432132 | 251 |
| 142 | 3300025933 | Ga0207706_10005320 | Ga0207706_100053204 | 251 |
| 143 | 3300025935 | Ga0207709_10028985 | Ga0207709_100289854 | 251 |
| 144 | 3300025942 | Ga0207689_10363820 | Ga0207689_103638202 | 251 |
| 145 | 3300025945 | Ga0207679_10031057 | Ga0207679_100310574 | 251 |
| 146 | 3300025981 | Ga0207640_10017911 | Ga0207640_100179115 | 251 |
| 147 | 3300026041 | Ga0207639_10039194 | Ga0207639_100391943 | 251 |
| 148 | 3300028794 | Ga0307515_10001329 | Ga0307515_1000132932 | 251 |
| 149 | 3300028794 | Ga0307515_10047437 | Ga0307515_100474374 | 251 |
| 150 | 3300031456 | Ga0307513_10071079 | Ga0307513_100710793 | 251 |
| 151 | 3300031548 | Ga0307408_100038858 | Ga0307408_1000388583 | 251 |
| 152 | 3300031824 | Ga0307413_10656871 | Ga0307413_106568711 | 251 |
| 153 | 3300031911 | Ga0307412_10068225 | Ga0307412_100682253 | 251 |
| 154 | 3300032002 | Ga0307416_100134517 | Ga0307416_1001345172 | 251 |
| 155 | 3300041404 | Ga0439436_0020585 | Ga0439436_0020585_383_1141 | 251 |
| 156 | 3300041406 | Ga0439439_0047272 | Ga0439439_0047272_339_1097 | 251 |
| 157 | 3300041407 | Ga0439447_029697 | Ga0439447_029697_229_987 | 251 |
| 158 | 3300041411 | Ga0439466_0007751 | Ga0439466_0007751_1951_2706 | 251 |
| 159 | 3300041411 | Ga0439466_0009925 | Ga0439466_0009925_2418_3176 | 251 |
| 160 | 3300041413 | Ga0439465_0004301 | Ga0439465_0004301_1602_2357 | 251 |
| 161 | 3300041997 | Ga0439431_0010265 | Ga0439431_0010265_839_1594 | 251 |
| 162 | 3300041999 | Ga0439433_0000045 | Ga0439433_0000045_12932_13687 | 251 |
| 163 | 3300042004 | Ga0439445_0036263 | Ga0439445_0036263_461_1216 | 251 |
| 164 | 3300042006 | Ga0439432_005774 | Ga0439432_005774_1611_2366 | 251 |
| 165 | 3300042006 | Ga0439432_016758 | Ga0439432_016758_330_1088 | 251 |
| 166 | 3300042007 | Ga0439449_0007552 | Ga0439449_0007552_1857_2612 | 251 |
| 167 | 3300042007 | Ga0439449_0104535 | Ga0439449_0104535_155_916 | 251 |
| 168 | 3300042010 | Ga0439452_005227 | Ga0439452_005227_1857_2612 | 251 |
| 169 | 3300042010 | Ga0439452_012496 | Ga0439452_012496_553_1311 | 251 |
| 170 | 3300042014 | Ga0439457_008152 | Ga0439457_008152_1446_2201 | 251 |
| 171 | 3300042015 | Ga0439462_0005641 | Ga0439462_0005641_177_935 | 251 |
| 172 | 3300042015 | Ga0439462_0040706 | Ga0439462_0040706_137_892 | 251 |
| 173 | 3300042125 | Ga0450923_017420 | Ga0450923_017420_146_904 | 251 |
| 174 | 3300042156 | Ga0439446_0075234 | Ga0439446_0075234_198_956 | 251 |
| 175 | 3300042185 | Ga0450909_008969 | Ga0450909_008969_218_973 | 251 |
| 176 | 3300042435 | Ga0439434_0005028 | Ga0439434_0005028_2196_2951 | 251 |
| 177 | 3300042435 | Ga0439434_0033331 | Ga0439434_0033331_214_972 | 251 |
| 178 | 3300042532 | Ga0450893_0005001 | Ga0450893_0005001_659_1462 | 251 |
| 179 | 3300044658 | Ga0466972_0078074 | Ga0466972_0078074_303_1061 | 251 |
| 180 | 3300044683 | Ga0466965_0017027 | Ga0466965_0017027_1203_1961 | 251 |
| 181 | 3300048088 | Ga0495602_0386786 | Ga0495602_0386786_121_882 | 251 |
| 182 | 3300048919 | Ga0496116_0062455 | Ga0496116_0062455_1393_2169 | 251 |
| 183 | 3300048920 | Ga0496117_0017144 | Ga0496117_0017144_1392_2168 | 251 |
| 184 | 3300048921 | Ga0496118_0018823 | Ga0496118_0018823_1344_2120 | 251 |
| 185 | 3300048928 | Ga0496125_0046119 | Ga0496125_0046119_414_1190 | 251 |
| 186 | 3300050494 | nmdc:mga06z11_209596_c1 | nmdc:mga06z11_209596_c1_310_1086 | 251 |
| 187 | 3300050496 | nmdc:mga07m45_14998_c1 | nmdc:mga07m45_14998_c1_2994_3752 | 251 |
| 188 | 3300050496 | nmdc:mga07m45_56236_c1 | nmdc:mga07m45_56236_c1_723_1499 | 251 |
| 189 | 3300053153 | Ga0500616_0043199 | Ga0500616_0043199_855_1718 | 251 |
| 190 | 3300002739 | JGI25158J39367_1004268 | JGI25158J39367_10042683 | 252 |
| 191 | 3300002773 | JGI25152J39213_1011901 | JGI25152J39213_10119011 | 252 |
| 192 | 3300002773 | JGI25152J39213_1020322 | JGI25152J39213_10203222 | 252 |
| 193 | 3300002774 | JGI25150J39212_1001540 | JGI25150J39212_10015404 | 252 |
| 194 | 3300002987 | JGI25159J45721_1021986 | JGI25159J45721_10219862 | 252 |
| 195 | 3300002987 | JGI25159J45721_1024737 | JGI25159J45721_10247371 | 252 |
| 196 | 3300003187 | JGI25151J46595_10001064 | JGI25151J46595_100010647 | 252 |
| 197 | 3300003187 | JGI25151J46595_10006226 | JGI25151J46595_100062266 | 252 |
| 198 | 3300003187 | JGI25151J46595_10035965 | JGI25151J46595_100359653 | 252 |
| 199 | 3300003215 | JGI25153J46596_10029664 | JGI25153J46596_100296643 | 252 |
| 200 | 3300003354 | JGI25160J50197_1036543 | JGI25160J50197_10365432 | 252 |
| 201 | 3300003354 | JGI25160J50197_1040180 | JGI25160J50197_10401801 | 252 |
| 202 | 3300003374 | JGI25161J50226_1004008 | JGI25161J50226_10040084 | 252 |
| 203 | 3300003578 | Ga0006562J51391_1059832 | Ga0006562J51391_10598321 | 252 |
| 204 | 3300003578 | Ga0006562J51391_1059833 | Ga0006562J51391_10598331 | 252 |
| 205 | 3300003578 | Ga0006562J51391_1074938 | Ga0006562J51391_10749381 | 252 |
| 206 | 3300003771 | Ga0055526_1025826 | Ga0055526_10258263 | 252 |
| 207 | 3300003773 | Ga0055537_1010898 | Ga0055537_10108983 | 252 |
| 208 | 3300003775 | Ga0055524_1025089 | Ga0055524_10250893 | 252 |
| 209 | 3300003775 | Ga0055524_1025098 | Ga0055524_10250983 | 252 |
| 210 | 3300003781 | Ga0055536_1008260 | Ga0055536_10082602 | 252 |
| 211 | 3300003784 | Ga0055534_1010915 | Ga0055534_10109152 | 252 |
| 212 | 3300003790 | Ga0055528_1023552 | Ga0055528_10235523 | 252 |
| 213 | 3300003791 | Ga0055530_10001026 | Ga0055530_1000102615 | 252 |
| 214 | 3300003792 | Ga0055540_1025427 | Ga0055540_10254272 | 252 |
| 215 | 3300003792 | Ga0055540_1028035 | Ga0055540_10280352 | 252 |
| 216 | 3300003794 | Ga0055531_10010342 | Ga0055531_100103422 | 252 |
| 217 | 3300003794 | Ga0055531_10021746 | Ga0055531_100217463 | 252 |
| 218 | 3300004625 | Ga0055543_1003567 | Ga0055543_10035672 | 252 |
| 219 | 3300004625 | Ga0055543_1011657 | Ga0055543_10116572 | 252 |
| 220 | 3300005262 | Ga0065165_1009695 | Ga0065165_10096955 | 252 |
| 221 | 3300005262 | Ga0065165_1028727 | Ga0065165_10287273 | 252 |
| 222 | 3300005539 | Ga0068853_100037536 | Ga0068853_1000375364 | 252 |
| 223 | 3300006178 | Ga0075367_10118070 | Ga0075367_101180702 | 252 |
| 224 | 3300006195 | Ga0075366_10032893 | Ga0075366_100328934 | 252 |
| 225 | 3300006353 | Ga0075370_10008223 | Ga0075370_100082235 | 252 |
| 226 | 3300006353 | Ga0075370_10116300 | Ga0075370_101163002 | 252 |
| 227 | 3300006353 | Ga0075370_10125598 | Ga0075370_101255982 | 252 |
| 228 | 3300006353 | Ga0075370_10153161 | Ga0075370_101531612 | 252 |
| 229 | 3300009148 | Ga0105243_10026715 | Ga0105243_100267152 | 252 |
| 230 | 3300013100 | Ga0157373_10093222 | Ga0157373_100932223 | 252 |
| 231 | 3300013100 | Ga0157373_10204540 | Ga0157373_102045402 | 252 |
| 232 | 3300017792 | Ga0163161_10038940 | Ga0163161_100389405 | 252 |
| 233 | 3300025208 | Ga0209436_104893 | Ga0209436_1048932 | 252 |
| 234 | 3300025208 | Ga0209436_112376 | Ga0209436_1123762 | 252 |
| 235 | 3300025245 | Ga0207425_1000231 | Ga0207425_100023119 | 252 |
| 236 | 3300025245 | Ga0207425_1003175 | Ga0207425_10031753 | 252 |
| 237 | 3300025258 | Ga0209129_1000177 | Ga0209129_100017754 | 252 |
| 238 | 3300025258 | Ga0209129_1006422 | Ga0209129_10064223 | 252 |
| 239 | 3300025263 | Ga0209565_1000241 | Ga0209565_10002418 | 252 |
| 240 | 3300025273 | Ga0209673_1000377 | Ga0209673_100037765 | 252 |
| 241 | 3300025273 | Ga0209673_1000507 | Ga0209673_100050748 | 252 |
| 242 | 3300025284 | Ga0209130_1000218 | Ga0209130_100021871 | 252 |
| 243 | 3300025284 | Ga0209130_1005494 | Ga0209130_10054945 | 252 |
| 244 | 3300025291 | Ga0209675_1000893 | Ga0209675_10008938 | 252 |
| 245 | 3300025291 | Ga0209675_1005373 | Ga0209675_10053732 | 252 |
| 246 | 3300025291 | Ga0209675_1015471 | Ga0209675_10154712 | 252 |
| 247 | 3300025292 | Ga0209676_1000202 | Ga0209676_1000202103 | 252 |
| 248 | 3300025292 | Ga0209676_1007524 | Ga0209676_10075243 | 252 |
| 249 | 3300025294 | Ga0209025_1000285 | Ga0209025_100028518 | 252 |
| 250 | 3300025294 | Ga0209025_1000322 | Ga0209025_100032254 | 252 |
| 251 | 3300025294 | Ga0209025_1000359 | Ga0209025_100035921 | 252 |
| 252 | 3300025294 | Ga0209025_1006288 | Ga0209025_10062885 | 252 |
| 253 | 3300025294 | Ga0209025_1009794 | Ga0209025_10097944 | 252 |
| 254 | 3300025295 | Ga0209564_1000223 | Ga0209564_100022373 | 252 |
| 255 | 3300025295 | Ga0209564_1000226 | Ga0209564_100022673 | 252 |
| 256 | 3300025297 | Ga0209758_1000142 | Ga0209758_1000142111 | 252 |
| 257 | 3300025297 | Ga0209758_1014767 | Ga0209758_10147674 | 252 |
| 258 | 3300025298 | Ga0209050_1000224 | Ga0209050_100022461 | 252 |
| 259 | 3300025299 | Ga0209256_1000114 | Ga0209256_1000114111 | 252 |
| 260 | 3300025299 | Ga0209256_1000174 | Ga0209256_100017473 | 252 |
| 261 | 3300025302 | Ga0207426_1000162 | Ga0207426_1000162110 | 252 |
| 262 | 3300025302 | Ga0207426_1000232 | Ga0207426_100023273 | 252 |
| 263 | 3300025303 | Ga0209051_1000313 | Ga0209051_100031378 | 252 |
| 264 | 3300025304 | Ga0209257_1000163 | Ga0209257_100016371 | 252 |
| 265 | 3300025304 | Ga0209257_1004089 | Ga0209257_10040897 | 252 |
| 266 | 3300025981 | Ga0207640_10162781 | Ga0207640_101627812 | 252 |
| 267 | 3300026041 | Ga0207639_10023896 | Ga0207639_100238964 | 252 |
| 268 | 3300027907 | Ga0207428_10186035 | Ga0207428_101860353 | 252 |
| 269 | 3300030733 | Ga0314311_1054731 | Ga0314311_10547312 | 252 |
| 270 | 3300030736 | Ga0316180_1049446 | Ga0316180_10494463 | 252 |
| 271 | 3300030742 | Ga0316183_1031158 | Ga0316183_10311582 | 252 |
| 272 | 3300030744 | Ga0316181_1008937 | Ga0316181_10089372 | 252 |
| 273 | 3300030744 | Ga0316181_1079860 | Ga0316181_10798602 | 252 |
| 274 | 3300030745 | Ga0316182_1037951 | Ga0316182_10379512 | 252 |
| 275 | 3300030745 | Ga0316182_1332530 | Ga0316182_13325302 | 252 |
| 276 | 3300031911 | Ga0307412_10002787 | Ga0307412_100027875 | 252 |
| 277 | 3300031911 | Ga0307412_10042035 | Ga0307412_100420353 | 252 |
| 278 | 3300032002 | Ga0307416_100427059 | Ga0307416_1004270592 | 252 |
| 279 | 3300032004 | Ga0307414_10204627 | Ga0307414_102046272 | 252 |
| 280 | 3300032004 | Ga0307414_10237936 | Ga0307414_102379362 | 252 |
| 281 | 3300032004 | Ga0307414_10248967 | Ga0307414_102489672 | 252 |
| 282 | 3300046460 | Ga0495638_0005794 | Ga0495638_0005794_7845_8603 | 252 |
| 283 | 3300046462 | Ga0495651_0041245 | Ga0495651_0041245_755_1519 | 252 |
| 284 | 3300046513 | Ga0495616_0006998 | Ga0495616_0006998_188_946 | 252 |
| 285 | 3300046518 | Ga0495631_0000158 | Ga0495631_0000158_18691_19449 | 252 |
| 286 | 3300046536 | Ga0495587_0287336 | Ga0495587_0287336_97_858 | 252 |
| 287 | 3300046616 | Ga0495668_0120694 | Ga0495668_0120694_585_1343 | 252 |
| 288 | 3300046660 | Ga0495625_0034974 | Ga0495625_0034974_1255_2013 | 252 |
| 289 | 3300046690 | Ga0495624_0112204 | Ga0495624_0112204_34_807 | 252 |
| 290 | 3300047321 | Ga0495676_0064752 | Ga0495676_0064752_1479_2252 | 252 |
| 291 | 3300047673 | Ga0495593_0009779 | Ga0495593_0009779_3193_3966 | 252 |
| 292 | 3300048088 | Ga0495602_0386518 | Ga0495602_0386518_34_807 | 252 |
| 293 | 3300048089 | Ga0495614_0067041 | Ga0495614_0067041_566_1339 | 252 |
| 294 | 3300048904 | Ga0496101_0010997 | Ga0496101_0010997_3055_3828 | 252 |
| 295 | 3300048919 | Ga0496116_0020450 | Ga0496116_0020450_3701_4477 | 252 |
| 296 | 3300048920 | Ga0496117_0034963 | Ga0496117_0034963_948_1706 | 252 |
| 297 | 3300048924 | Ga0496121_0059192 | Ga0496121_0059192_1678_2454 | 252 |
| 298 | 3300048925 | Ga0496122_0075191 | Ga0496122_0075191_542_1300 | 252 |
| 299 | 3300048926 | Ga0496123_0063244 | Ga0496123_0063244_216_974 | 252 |
| 300 | 3300048927 | Ga0496124_0119267 | Ga0496124_0119267_233_991 | 252 |
| 301 | 3300048928 | Ga0496125_0033926 | Ga0496125_0033926_2120_2878 | 252 |
| 302 | 3300048928 | Ga0496125_0251747 | Ga0496125_0251747_213_989 | 252 |
| 303 | 3300050491 | nmdc:mga00v17_238348_c1 | nmdc:mga00v17_238348_c1_246_1007 | 252 |
| 304 | 3300050493 | nmdc:mga0k408_42949_c1 | nmdc:mga0k408_42949_c1_242_1027 | 252 |
| 305 | 3300050494 | nmdc:mga06z11_57423_c1 | nmdc:mga06z11_57423_c1_255_1040 | 252 |
| 306 | 3300050494 | nmdc:mga06z11_90582_c1 | nmdc:mga06z11_90582_c1_741_1499 | 252 |
| 307 | 3300050496 | nmdc:mga07m45_252463_c1 | nmdc:mga07m45_252463_c1_63_839 | 252 |
| 308 | 3300050496 | nmdc:mga07m45_8222_c1 | nmdc:mga07m45_8222_c1_4219_5004 | 252 |
| 309 | 3300053087 | Ga0500643_011220 | Ga0500643_011220_2233_3006 | 252 |
| 310 | 3300053093 | Ga0500651_0001059 | Ga0500651_0001059_6726_7499 | 252 |
| 311 | 3300053110 | Ga0500571_000368 | Ga0500571_000368_10889_11662 | 252 |
| 312 | 3300053111 | Ga0500572_016901 | Ga0500572_016901_663_1421 | 252 |
| 313 | 3300053118 | Ga0500594_0004055 | Ga0500594_0004055_1462_2220 | 252 |
| 314 | 3300053121 | Ga0500607_004969 | Ga0500607_004969_374_1132 | 252 |
| 315 | 3300053134 | Ga0500658_0000190 | Ga0500658_0000190_11844_12617 | 252 |
| 316 | 3300053134 | Ga0500658_0000270 | Ga0500658_0000270_11449_12207 | 252 |
| 317 | 3300053136 | Ga0500559_0030714 | Ga0500559_0030714_293_1054 | 252 |
| 318 | 3300053139 | Ga0500568_0001857 | Ga0500568_0001857_1218_1976 | 252 |
| 319 | 3300053153 | Ga0500616_0027479 | Ga0500616_0027479_1843_2601 | 252 |
| 320 | 3300053161 | Ga0500634_0134940 | Ga0500634_0134940_206_979 | 252 |
| 321 | 3300053162 | Ga0500638_004264 | Ga0500638_004264_2663_3436 | 252 |
| 322 | 3300053177 | Ga0500636_0007142 | Ga0500636_0007142_5273_6046 | 252 |
| 323 | iso_pu_bacteria | 2738541307 | 2738885552 | 252 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fmu-assembly1.cif.gz_A | crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution | 0.7173 | 19 | 238 |
| 1tcv-assembly1.cif.gz_A | crystal structure of the purine nucleoside phosphorylase from schistosoma mansoni in complex with non-detergent sulfobetaine 195 and acetate | 0.7032 | 109 | 133 |
| 3tz6-assembly1.cif.gz_A-2 | crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv | 0.684 | 26 | 133 |
| 2fmu-assembly1.cif.gz_A | crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution | 0.6754 | 19 | 238 |
| 2a35-assembly1.cif.gz_A | 1.5 a crystal structure of a protein of unknown function pa4017 from pseudomonas aeruginosa pao1, possible epimerase | 0.6625 | 24 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fmuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.7173 | 19 | 238 | 3.40.50.720 |
| 4xymA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.6836 | 26 | 164 | 3.40.50.720 |
| 2fmuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.6754 | 19 | 238 | 3.40.50.720 |
| 2a35B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.6604 | 24 | 239 | 3.40.50.720 |
| 2a35B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.6547 | 24 | 239 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U9A7T6-F1-model_v4 | deleted | 0.8304 | 26 | 251 |
|
| AF-A0A7U9A7T6-F1-model_v4 | deleted | 0.8167 | 26 | 251 |
|
| AF-A0A0Q7CW13-F1-model_v4 | NAD(P)-binding domain-containing protein | 0.7483 | 14 | 248 |
|
| AF-A0A1K2H9S3-F1-model_v4 | NAD(P)H-binding | 0.7354 | 21 | 243 |
|
| AF-A0A6M5XXB7-F1-model_v4 | deleted | 0.7347 | 1 | 248 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar