F406973

General Info

Members Datasets Scaffolds Average Seq Length
323 217 303 251

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10047437|Ga0307515_100474374
Length 287
Sequence MQANPLHVLSAASRHVPSAAAKVSETLLIAGATGALGNAVVQALVGSPQFSGTTVLAREPIKTGMRGVTACVVPAARAPSTTPESQGDKPGMFEDWPVPTATTGVILFDPPRMYYQRERALWTPTPAQLPALARWMRACGVRTLAVVMPHVQGQLPEALKRGLANLDEQSVAALGFERLLIVRSAEKPGTGGVKRSWPARAAHGVLAAMSYMVPSSEQPVRASKVAELVDVALRNMSPGTHVAAPELVWRAAQGHLPSVVGEWLHKPSAEPLSGAKSKHLLHEAITR

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2643221658 Variovorax sp. Root411 Isolate Unclassified
3 2643221672 Variovorax sp. Root434 Isolate Unclassified
4 2738541277 Variovorax sp. GV051 Isolate Unclassified
5 2738541307 Variovorax sp. GV008 Isolate Unclassified
6 2738543019 Variovorax sp. GV040 Isolate Unclassified
7 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
8 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
9 2842677519 Variovorax sp. R-72495 Isolate Unclassified
10 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
11 2885198086 Variovorax sp. 679 Isolate Unclassified
12 2885211737 Variovorax sp. 553 Isolate Unclassified
13 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
14 2928070936 Variovorax gossypii 1167 Isolate Unclassified
15 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
16 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
17 2929520902 Variovorax beijingensis 502 Isolate Unclassified
18 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
19 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
20 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
21 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
29 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
80 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
113 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
114 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
115 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
116 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
117 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
132 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
133 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
134 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
138 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
142 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
143 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
144 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
145 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
146 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
147 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
148 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
191 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
204 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
205 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
206 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
207 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
208 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
215 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
216 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.88
Metatranscriptomes 0.93
Isolates 6.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 37.46
Nodule 0.31
Rhizoplane 0.31
Rhizosphere 52.01
Stem 0
Stem Tuber 0
Unclassified 9.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1004268 3300002739 Bacteria 2154
2 JGI25152J39213_1011901 3300002773 Bacteria 1897
3 JGI25152J39213_1020322 3300002773 Bacteria 1188
4 JGI25150J39212_1001540 3300002774 Bacteria 6318
5 JGI25159J45721_1003103 3300002987 Bacteria 5997
6 JGI25159J45721_1021986 3300002987 Bacteria 1189
7 JGI25159J45721_1024737 3300002987 Bacteria 1063
8 JGI25151J46595_10001064 3300003187 Bacteria 20476
9 JGI25151J46595_10006226 3300003187 Bacteria 6035
10 JGI25151J46595_10035965 3300003187 Bacteria 1874
11 JGI25153J46596_10029664 3300003215 Bacteria 1874
12 JGI25160J50197_1036543 3300003354 Bacteria 1189
13 JGI25160J50197_1040180 3300003354 Bacteria 1087
14 JGI25161J50226_1004008 3300003374 Bacteria 3189
15 Ga0006562J51391_1059832 3300003578 Bacteria 1200
16 Ga0006562J51391_1059833 3300003578 Bacteria 2380
17 Ga0006562J51391_1074938 3300003578 Bacteria 3290
18 Ga0055526_1025826 3300003771 Bacteria 1874
19 Ga0055537_1010898 3300003773 Bacteria 1883
20 Ga0055524_1025089 3300003775 Bacteria 1874
21 Ga0055524_1025098 3300003775 Bacteria 1874
22 Ga0055536_1006509 3300003781 Bacteria 5429
23 Ga0055536_1008260 3300003781 Bacteria 4508
24 Ga0055534_1010915 3300003784 Bacteria 1874
25 Ga0055528_1023552 3300003790 Bacteria 1874
26 Ga0055530_10001026 3300003791 Bacteria 22224
27 Ga0055540_1002001 3300003792 Bacteria 11376
28 Ga0055540_1025427 3300003792 Bacteria 1451
29 Ga0055540_1028035 3300003792 Bacteria 1337
30 Ga0055531_10004026 3300003794 Bacteria 9117
31 Ga0055531_10010342 3300003794 Bacteria 4647
32 Ga0055531_10021746 3300003794 Bacteria 2475
33 Ga0055543_1003567 3300004625 Bacteria 4509
34 Ga0055543_1011657 3300004625 Bacteria 1791
35 Ga0065165_1009695 3300005262 Bacteria 4271
36 Ga0065165_1028727 3300005262 Bacteria 1791
37 Ga0070670_100051875 3300005331 Bacteria 3522
38 Ga0068868_100313653 3300005338 Bacteria 1335
39 Ga0070659_100238581 3300005366 Bacteria 1504
40 Ga0070667_100679408 3300005367 Bacteria 952
41 Ga0070662_100165322 3300005457 Bacteria 1733
42 Ga0068853_100037536 3300005539 Bacteria 4122
43 Ga0068853_100130890 3300005539 Bacteria 2246
44 Ga0068853_100224279 3300005539 Bacteria 1717
45 Ga0068853_100350525 3300005539 Bacteria 1373
46 Ga0068855_100012581 3300005563 Bacteria 10213
47 Ga0070664_100310719 3300005564 Bacteria 1426
48 Ga0068857_100301704 3300005577 Bacteria 1477
49 Ga0068857_100660842 3300005577 Bacteria 991
50 Ga0068864_100042885 3300005618 Bacteria 3872
51 Ga0068863_100201003 3300005841 Bacteria 1917
52 Ga0068862_100042081 3300005844 Bacteria 3890
53 Ga0075365_10073826 3300006038 Bacteria 2300
54 Ga0075365_10524343 3300006038 Bacteria 838
55 Ga0075363_100012317 3300006048 Bacteria 4119
56 Ga0075362_10005571 3300006177 Bacteria 4622
57 Ga0075367_10118070 3300006178 Bacteria 1633
58 Ga0075367_10128964 3300006178 Bacteria 1562
59 Ga0075367_10211548 3300006178 Bacteria 1213
60 Ga0075369_10091132 3300006186 Bacteria 1360
61 Ga0075366_10032893 3300006195 Bacteria 3054
62 Ga0075366_10063911 3300006195 Bacteria 2188
63 Ga0075370_10008223 3300006353 Bacteria 5355
64 Ga0075370_10012010 3300006353 Bacteria 4565
65 Ga0075370_10116300 3300006353 Bacteria 1555
66 Ga0075370_10125598 3300006353 Bacteria 1495
67 Ga0075370_10153161 3300006353 Bacteria 1351
68 Ga0075370_10314921 3300006353 Bacteria 932
69 Ga0075430_100168151 3300006846 Bacteria 1824
70 Ga0075429_100134955 3300006880 Bacteria 2160
71 Ga0105244_10002760 3300009036 Bacteria 13093
72 Ga0105245_10377537 3300009098 Bacteria 1411
73 Ga0105243_10006107 3300009148 Bacteria 9311
74 Ga0105243_10026715 3300009148 Bacteria 4420
75 Ga0105242_10389680 3300009176 Bacteria 1297
76 Ga0105237_10011415 3300009545 Bacteria 9395
77 Ga0105238_10075212 3300009551 Bacteria 3369
78 Ga0105238_10317760 3300009551 Bacteria 1543
79 Ga0157347_1001293 3300012502 Bacteria 1935
80 Ga0157347_1008244 3300012502 Bacteria 1057
81 Ga0157373_10093222 3300013100 Bacteria 2121
82 Ga0157373_10204540 3300013100 Bacteria 1392
83 Ga0157369_10017800 3300013105 Bacteria 7976
84 Ga0157378_10324955 3300013297 Bacteria 1495
85 Ga0182008_10030931 3300014497 Bacteria 2696
86 Ga0182008_10041440 3300014497 Bacteria 2296
87 Ga0182008_10054680 3300014497 Bacteria 1975
88 Ga0182006_1001315 3300015261 Bacteria 15262
89 Ga0182006_1018209 3300015261 Bacteria 2972
90 Ga0182007_10008900 3300015262 Bacteria 4091
91 Ga0183362_10007 3300015683 Bacteria 240101
92 Ga0163161_10038940 3300017792 Bacteria 3411
93 Ga0209436_104893 3300025208 Bacteria 3209
94 Ga0209436_112376 3300025208 Bacteria 1451
95 Ga0207425_1000231 3300025245 Bacteria 43311
96 Ga0207425_1003175 3300025245 Bacteria 5377
97 Ga0209129_1000177 3300025258 Bacteria 93081
98 Ga0209129_1006422 3300025258 Bacteria 3800
99 Ga0209565_1000241 3300025263 Bacteria 58986
100 Ga0209673_1000377 3300025273 Bacteria 80360
101 Ga0209673_1000507 3300025273 Bacteria 64168
102 Ga0209130_1000218 3300025284 Bacteria 75339
103 Ga0209130_1005494 3300025284 Bacteria 4374
104 Ga0209675_1000893 3300025291 Bacteria 19163
105 Ga0209675_1005373 3300025291 Bacteria 5381
106 Ga0209675_1015471 3300025291 Bacteria 2263
107 Ga0209676_1000202 3300025292 Bacteria 133078
108 Ga0209676_1000375 3300025292 Bacteria 82420
109 Ga0209676_1007524 3300025292 Bacteria 5083
110 Ga0209025_1000285 3300025294 Bacteria 114575
111 Ga0209025_1000322 3300025294 Bacteria 106667
112 Ga0209025_1000359 3300025294 Bacteria 97475
113 Ga0209025_1006288 3300025294 Bacteria 9284
114 Ga0209025_1009794 3300025294 Bacteria 6613
115 Ga0209564_1000223 3300025295 Bacteria 128117
116 Ga0209564_1000226 3300025295 Bacteria 125693
117 Ga0209758_1000142 3300025297 Bacteria 171779
118 Ga0209758_1014767 3300025297 Bacteria 4119
119 Ga0209050_1000224 3300025298 Bacteria 125433
120 Ga0209256_1000114 3300025299 Bacteria 173999
121 Ga0209256_1000174 3300025299 Bacteria 128117
122 Ga0207426_1000162 3300025302 Bacteria 172643
123 Ga0207426_1000232 3300025302 Bacteria 128117
124 Ga0209051_1000112 3300025303 Bacteria 152667
125 Ga0209051_1000313 3300025303 Bacteria 75138
126 Ga0209257_1000163 3300025304 Bacteria 175355
127 Ga0209257_1001238 3300025304 Bacteria 31583
128 Ga0209257_1004089 3300025304 Bacteria 11689
129 Ga0207655_1006481 3300025728 Bacteria 7748
130 Ga0207649_10462814 3300025920 Bacteria 959
131 Ga0207694_10036947 3300025924 Bacteria 3749
132 Ga0207650_10124488 3300025925 Bacteria 2011
133 Ga0207687_10243213 3300025927 Bacteria 1427
134 Ga0207687_10436770 3300025927 Bacteria 1083
135 Ga0207690_10125410 3300025932 Bacteria 1871
136 Ga0207706_10005320 3300025933 Bacteria 12002
137 Ga0207709_10028985 3300025935 Bacteria 3205
138 Ga0207689_10363820 3300025942 Bacteria 1203
139 Ga0207679_10031057 3300025945 Bacteria 3736
140 Ga0207667_10120766 3300025949 Bacteria 2700
141 Ga0207640_10017911 3300025981 Bacteria 4152
142 Ga0207640_10162781 3300025981 Bacteria 1653
143 Ga0207677_10126403 3300026023 Bacteria 1933
144 Ga0207639_10023896 3300026041 Bacteria 4417
145 Ga0207639_10039194 3300026041 Bacteria 3529
146 Ga0207639_10383986 3300026041 Bacteria 1262
147 Ga0207641_10068413 3300026088 Bacteria 3045
148 Ga0207676_10044207 3300026095 Bacteria 3435
149 Ga0207428_10186035 3300027907 Bacteria 1567
150 Ga0268265_10026958 3300028380 Bacteria 4094
151 Ga0307515_10001329 3300028794 Bacteria 56020
152 Ga0307515_10047437 3300028794 Bacteria 6529
153 Ga0316177_1190926 3300030731 Bacteria 1954
154 Ga0314311_1054731 3300030733 Bacteria 1558
155 Ga0316180_1049446 3300030736 Bacteria 2179
156 Ga0316183_1031158 3300030742 Bacteria 2176
157 Ga0316181_1008937 3300030744 Bacteria 1994
158 Ga0316181_1079860 3300030744 Bacteria 1320
159 Ga0316182_1037951 3300030745 Bacteria 2117
160 Ga0316182_1332530 3300030745 Bacteria 6293
161 Ga0307513_10071079 3300031456 Bacteria 3634
162 Ga0307408_100038858 3300031548 Bacteria 3359
163 Ga0307408_100120239 3300031548 Bacteria 2033
164 Ga0307514_10016759 3300031649 Bacteria 6035
165 Ga0307413_10656871 3300031824 Bacteria 866
166 Ga0307412_10002787 3300031911 Bacteria 9711
167 Ga0307412_10042035 3300031911 Bacteria 2966
168 Ga0307412_10068225 3300031911 Bacteria 2417
169 Ga0307416_100134517 3300032002 Bacteria 2233
170 Ga0307416_100274645 3300032002 Bacteria 1657
171 Ga0307416_100427059 3300032002 Bacteria 1371
172 Ga0307414_10204627 3300032004 Bacteria 1608
173 Ga0307414_10237936 3300032004 Bacteria 1505
174 Ga0307414_10248967 3300032004 Bacteria 1476
175 Ga0395899_0007482 3300037312 Bacteria 8437
176 Ga0395900_0608519 3300037418 Bacteria 1032
177 Ga0395898_0027416 3300037466 Bacteria 5719
178 Ga0395898_0050626 3300037466 Bacteria 4065
179 Ga0395905_0001234 3300037471 Bacteria 31751
180 Ga0395905_0026376 3300037471 Bacteria 5479
181 Ga0395905_0120582 3300037471 Bacteria 2465
182 Ga0395905_0637448 3300037471 Bacteria 967
183 Ga0395905_0670481 3300037471 Bacteria 939
184 Ga0395901_0230600 3300038443 Bacteria 1933
185 Ga0395901_0409367 3300038443 Bacteria 1392
186 Ga0395901_0457479 3300038443 Bacteria 1304
187 Ga0439436_0020585 3300041404 Bacteria 1964
188 Ga0439439_0047272 3300041406 Bacteria 1124
189 Ga0439447_029697 3300041407 Bacteria 1382
190 Ga0439453_0029838 3300041408 Bacteria 1028
191 Ga0439466_0007751 3300041411 Bacteria 4055
192 Ga0439466_0009925 3300041411 Bacteria 3543
193 Ga0439465_0004301 3300041413 Bacteria 4621
194 Ga0439431_0010265 3300041997 Bacteria 2123
195 Ga0439433_0000045 3300041999 Bacteria 15562
196 Ga0439445_0036263 3300042004 Bacteria 1297
197 Ga0439432_005774 3300042006 Bacteria 4446
198 Ga0439432_016758 3300042006 Bacteria 2464
199 Ga0439449_0005358 3300042007 Bacteria 4914
200 Ga0439449_0007552 3300042007 Bacteria 4131
201 Ga0439449_0104535 3300042007 Bacteria 1047
202 Ga0439452_005227 3300042010 Bacteria 4213
203 Ga0439452_012496 3300042010 Bacteria 2413
204 Ga0439457_008152 3300042014 Bacteria 2479
205 Ga0439462_0005641 3300042015 Bacteria 3090
206 Ga0439462_0009690 3300042015 Bacteria 2435
207 Ga0439462_0040706 3300042015 Bacteria 1239
208 Ga0450923_017420 3300042125 Bacteria 1364
209 Ga0450898_016783 3300042134 Bacteria 1253
210 Ga0450903_007738 3300042138 Bacteria 1764
211 Ga0439446_0075234 3300042156 Bacteria 1038
212 Ga0450909_005815 3300042185 Bacteria 1777
213 Ga0450909_008969 3300042185 Bacteria 1458
214 Ga0439434_0005028 3300042435 Bacteria 3865
215 Ga0439434_0033331 3300042435 Bacteria 1569
216 Ga0439435_0048944 3300042436 Bacteria 1205
217 Ga0439464_0099792 3300042439 Bacteria 881
218 Ga0450893_0005001 3300042532 Bacteria 2117
219 Ga0466972_0078074 3300044658 Bacteria 1577
220 Ga0453683_0002165 3300044673 Bacteria 15622
221 Ga0466965_0017027 3300044683 Bacteria 3468
222 Ga0466957_0070138 3300044842 Bacteria 2166
223 Ga0466957_0393278 3300044842 Bacteria 947
224 Ga0451576_0004788 3300045051 Bacteria 17348
225 Ga0451576_0172750 3300045051 Bacteria 2256
226 Ga0466967_0170567 3300045976 Bacteria 2047
227 Ga0495638_0005794 3300046460 Bacteria 9091
228 Ga0495651_0041245 3300046462 Bacteria 3586
229 Ga0495610_0063526 3300046512 Bacteria 1748
230 Ga0495616_0006998 3300046513 Bacteria 6789
231 Ga0495620_0012819 3300046515 Bacteria 4312
232 Ga0495631_0000158 3300046518 Bacteria 45721
233 Ga0495637_0053637 3300046520 Bacteria 1677
234 Ga0495642_0029346 3300046528 Bacteria 2195
235 Ga0495587_0287336 3300046536 Bacteria 921
236 Ga0495656_0003746 3300046615 Bacteria 5163
237 Ga0495668_0120694 3300046616 Bacteria 1434
238 Ga0495625_0034974 3300046660 Bacteria 3705
239 Ga0495588_0045824 3300046674 Bacteria 2243
240 Ga0495588_0084220 3300046674 Bacteria 1661
241 Ga0495669_0025140 3300046684 Bacteria 2596
242 Ga0495624_0112204 3300046690 Bacteria 1676
243 Ga0495671_0005694 3300046692 Bacteria 7269
244 Ga0495636_0031830 3300047318 Bacteria 2163
245 Ga0495676_0064752 3300047321 Bacteria 2840
246 Ga0495677_0067960 3300047445 Bacteria 1326
247 Ga0495593_0009779 3300047673 Bacteria 5562
248 Ga0495602_0386518 3300048088 Bacteria 1001
249 Ga0495602_0386786 3300048088 Bacteria 1001
250 Ga0495614_0067041 3300048089 Bacteria 1544
251 Ga0496101_0010997 3300048904 Bacteria 5996
252 Ga0496116_0020450 3300048919 Bacteria 5026
253 Ga0496116_0062455 3300048919 Bacteria 2405
254 Ga0496117_0017144 3300048920 Bacteria 6062
255 Ga0496117_0034963 3300048920 Bacteria 3779
256 Ga0496118_0018823 3300048921 Bacteria 6201
257 Ga0496121_0059192 3300048924 Bacteria 3160
258 Ga0496122_0075191 3300048925 Bacteria 2385
259 Ga0496122_0075296 3300048925 Bacteria 2382
260 Ga0496123_0063244 3300048926 Bacteria 2366
261 Ga0496124_0119267 3300048927 Bacteria 2110
262 Ga0496125_0033926 3300048928 Bacteria 4507
263 Ga0496125_0046119 3300048928 Bacteria 3660
264 Ga0496125_0251747 3300048928 Bacteria 1114
265 Ga0501262_000542 3300049759 Bacteria 4505
266 Ga0501263_001753 3300049760 Bacteria 2106
267 nmdc:mga03683_86206_c1 3300050489 Bacteria 1363
268 nmdc:mga00v17_238348_c1 3300050491 Bacteria 1179
269 nmdc:mga0yw44_85021_c1 3300050492 Bacteria 1990
270 nmdc:mga0k408_213128_c1 3300050493 Bacteria 1153
271 nmdc:mga0k408_42949_c1 3300050493 Bacteria 2604
272 nmdc:mga06z11_209596_c1 3300050494 Bacteria 1135
273 nmdc:mga06z11_57423_c1 3300050494 Bacteria 2016
274 nmdc:mga06z11_90582_c1 3300050494 Bacteria 1659
275 nmdc:mga07m45_14998_c1 3300050496 Bacteria 4137
276 nmdc:mga07m45_252463_c1 3300050496 Bacteria 1026
277 nmdc:mga07m45_56236_c1 3300050496 Bacteria 2224
278 nmdc:mga07m45_8222_c1 3300050496 Bacteria 5352
279 nmdc:mga0qj67_151692_c1 3300050509 Bacteria 1880
280 Ga0500610_0022621 3300053079 Bacteria 3101
281 Ga0500610_0034434 3300053079 Bacteria 2591
282 Ga0500643_011220 3300053087 Bacteria 3282
283 Ga0500651_0001059 3300053093 Bacteria 13571
284 Ga0500555_024519 3300053103 Bacteria 1728
285 Ga0500562_015430 3300053108 Bacteria 1959
286 Ga0500571_000368 3300053110 Bacteria 17744
287 Ga0500572_016901 3300053111 Bacteria 1867
288 Ga0500593_008016 3300053117 Bacteria 4327
289 Ga0500594_0004055 3300053118 Bacteria 3224
290 Ga0500607_000585 3300053121 Bacteria 35102
291 Ga0500607_004969 3300053121 Bacteria 8860
292 Ga0500608_056505 3300053122 Bacteria 1880
293 Ga0500658_0000190 3300053134 Bacteria 29332
294 Ga0500658_0000270 3300053134 Bacteria 23768
295 Ga0500559_0030714 3300053136 Bacteria 2304
296 Ga0500568_0001857 3300053139 Bacteria 13004
297 Ga0500616_0027479 3300053153 Bacteria 3141
298 Ga0500616_0043199 3300053153 Bacteria 2410
299 Ga0500627_0000093 3300053158 Bacteria 29716
300 Ga0500634_0063495 3300053161 Bacteria 1953
301 Ga0500634_0134940 3300053161 Bacteria 1178
302 Ga0500638_004264 3300053162 Bacteria 5473
303 Ga0500636_0007142 3300053177 Bacteria 6450

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053121 Ga0500607_000585 Ga0500607_000585_349_1098 218
2 3300012502 Ga0157347_1008244 Ga0157347_10082441 221
3 3300038443 Ga0395901_0230600 Ga0395901_0230600_598_1266 222
4 3300025927 Ga0207687_10436770 Ga0207687_104367701 223
5 3300048925 Ga0496122_0075296 Ga0496122_0075296_1455_2255 223
6 3300053122 Ga0500608_056505 Ga0500608_056505_79_771 225
7 3300006038 Ga0075365_10073826 Ga0075365_100738263 227
8 3300050492 nmdc:mga0yw44_85021_c1 nmdc:mga0yw44_85021_c1_1014_1760 227
9 3300046512 Ga0495610_0063526 Ga0495610_0063526_156_905 228
10 3300053079 Ga0500610_0034434 Ga0500610_0034434_1759_2508 228
11 3300046515 Ga0495620_0012819 Ga0495620_0012819_3028_3777 231
12 3300046520 Ga0495637_0053637 Ga0495637_0053637_912_1661 231
13 3300049759 Ga0501262_000542 Ga0501262_000542_2411_3178 231
14 3300053079 Ga0500610_0022621 Ga0500610_0022621_84_833 231
15 3300053103 Ga0500555_024519 Ga0500555_024519_780_1529 231
16 3300053117 Ga0500593_008016 Ga0500593_008016_3288_4037 231
17 3300053161 Ga0500634_0063495 Ga0500634_0063495_892_1641 231
18 3300005539 Ga0068853_100350525 Ga0068853_1003505252 232
19 3300014497 Ga0182008_10054680 Ga0182008_100546803 232
20 3300032002 Ga0307416_100274645 Ga0307416_1002746451 232
21 3300037471 Ga0395905_0670481 Ga0395905_0670481_143_841 232
22 3300006038 Ga0075365_10524343 Ga0075365_105243431 233
23 3300006178 Ga0075367_10128964 Ga0075367_101289642 233
24 3300037471 Ga0395905_0001234 Ga0395905_0001234_25498_26199 233
25 3300037471 Ga0395905_0026376 Ga0395905_0026376_2163_2864 233
26 3300030731 Ga0316177_1190926 Ga0316177_11909261 234
27 3300005338 Ga0068868_100313653 Ga0068868_1003136532 235
28 3300013297 Ga0157378_10324955 Ga0157378_103249552 235
29 3300026023 Ga0207677_10126403 Ga0207677_101264032 235
30 3300037312 Ga0395899_0007482 Ga0395899_0007482_2037_2780 235
31 3300037418 Ga0395900_0608519 Ga0395900_0608519_101_844 235
32 3300037466 Ga0395898_0027416 Ga0395898_0027416_352_1095 235
33 3300038443 Ga0395901_0409367 Ga0395901_0409367_75_818 235
34 3300041408 Ga0439453_0029838 Ga0439453_0029838_75_815 235
35 3300042134 Ga0450898_016783 Ga0450898_016783_315_1055 235
36 3300042185 Ga0450909_005815 Ga0450909_005815_62_802 235
37 3300038443 Ga0395901_0457479 Ga0395901_0457479_82_825 237
38 3300044842 Ga0466957_0070138 Ga0466957_0070138_363_1106 237
39 3300044842 Ga0466957_0393278 Ga0466957_0393278_23_739 238
40 3300005618 Ga0068864_100042885 Ga0068864_1000428852 239
41 3300025925 Ga0207650_10124488 Ga0207650_101244883 239
42 3300031548 Ga0307408_100120239 Ga0307408_1001202393 244
43 3300045051 Ga0451576_0172750 Ga0451576_0172750_745_1482 245
44 3300005331 Ga0070670_100051875 Ga0070670_1000518752 246
45 3300005841 Ga0068863_100201003 Ga0068863_1002010033 246
46 3300006846 Ga0075430_100168151 Ga0075430_1001681513 246
47 3300006880 Ga0075429_100134955 Ga0075429_1001349553 246
48 3300026088 Ga0207641_10068413 Ga0207641_100684133 246
49 3300026095 Ga0207676_10044207 Ga0207676_100442074 246
50 3300037471 Ga0395905_0637448 Ga0395905_0637448_103_843 246
51 3300042138 Ga0450903_007738 Ga0450903_007738_652_1392 246
52 3300042439 Ga0439464_0099792 Ga0439464_0099792_31_771 246
53 3300045976 Ga0466967_0170567 Ga0466967_0170567_47_787 246
54 3300049760 Ga0501263_001753 Ga0501263_001753_11_751 246
55 3300050489 nmdc:mga03683_86206_c1 nmdc:mga03683_86206_c1_410_1156 246
56 3300050493 nmdc:mga0k408_213128_c1 nmdc:mga0k408_213128_c1_213_959 246
57 3300050509 nmdc:mga0qj67_151692_c1 nmdc:mga0qj67_151692_c1_215_955 246
58 iso_pu_bacteria 2831265667 2831268165 246
59 iso_pu_bacteria 2945972063 2945974122 246
60 iso_pu_bacteria 2513020051 2513231681 247
61 iso_pu_bacteria 2643221672 2644397375 247
62 iso_pu_bacteria 2885192300 2885197631 247
63 iso_pu_bacteria 2885198086 2885199892 247
64 iso_pu_bacteria 2885211737 2885213587 247
65 3300037466 Ga0395898_0050626 Ga0395898_0050626_2526_3275 248
66 3300037471 Ga0395905_0120582 Ga0395905_0120582_759_1508 248
67 3300042007 Ga0439449_0005358 Ga0439449_0005358_3002_3748 248
68 3300042015 Ga0439462_0009690 Ga0439462_0009690_1056_1802 248
69 3300042436 Ga0439435_0048944 Ga0439435_0048944_36_782 248
70 iso_pu_bacteria 2643221658 2644326004 248
71 iso_pu_bacteria 2738541277 2738723226 248
72 iso_pu_bacteria 2738543019 2739283957 248
73 iso_pu_bacteria 2838054893 2838061015 248
74 iso_pu_bacteria 2842677519 2842680644 248
75 iso_pu_bacteria 2904541872 2904549157 248
76 iso_pu_bacteria 2928070936 2928072789 248
77 iso_pu_bacteria 2928084124 2928085954 248
78 iso_pu_bacteria 2929160207 2929160785 248
79 iso_pu_bacteria 2929520902 2929525945 248
80 iso_pu_bacteria 2954767861 2954769396 248
81 3300005366 Ga0070659_100238581 Ga0070659_1002385812 249
82 3300005577 Ga0068857_100660842 Ga0068857_1006608421 249
83 3300005844 Ga0068862_100042081 Ga0068862_1000420814 249
84 3300006186 Ga0075369_10091132 Ga0075369_100911322 249
85 3300012502 Ga0157347_1001293 Ga0157347_10012932 249
86 3300014497 Ga0182008_10030931 Ga0182008_100309313 249
87 3300015261 Ga0182006_1018209 Ga0182006_10182093 249
88 3300028380 Ga0268265_10026958 Ga0268265_100269584 249
89 3300031649 Ga0307514_10016759 Ga0307514_100167595 249
90 3300044673 Ga0453683_0002165 Ga0453683_0002165_14023_14808 249
91 3300045051 Ga0451576_0004788 Ga0451576_0004788_1450_2235 249
92 3300046528 Ga0495642_0029346 Ga0495642_0029346_1159_1917 249
93 3300046615 Ga0495656_0003746 Ga0495656_0003746_270_1028 249
94 3300046674 Ga0495588_0045824 Ga0495588_0045824_1393_2151 249
95 3300046674 Ga0495588_0084220 Ga0495588_0084220_243_995 249
96 3300046684 Ga0495669_0025140 Ga0495669_0025140_1159_1917 249
97 3300046692 Ga0495671_0005694 Ga0495671_0005694_487_1236 249
98 3300047318 Ga0495636_0031830 Ga0495636_0031830_950_1708 249
99 3300047445 Ga0495677_0067960 Ga0495677_0067960_313_1071 249
100 3300053158 Ga0500627_0000093 Ga0500627_0000093_10463_11212 249
101 3300002987 JGI25159J45721_1003103 JGI25159J45721_10031031 250
102 3300005539 Ga0068853_100130890 Ga0068853_1001308901 250
103 3300005563 Ga0068855_100012581 Ga0068855_1000125816 250
104 3300005577 Ga0068857_100301704 Ga0068857_1003017042 250
105 3300009545 Ga0105237_10011415 Ga0105237_1001141510 250
106 3300009551 Ga0105238_10317760 Ga0105238_103177602 250
107 3300013105 Ga0157369_10017800 Ga0157369_100178002 250
108 3300015683 Ga0183362_10007 Ga0183362_10007178 250
109 3300025932 Ga0207690_10125410 Ga0207690_101254102 250
110 3300025949 Ga0207667_10120766 Ga0207667_101207663 250
111 3300026041 Ga0207639_10383986 Ga0207639_103839862 250
112 3300053108 Ga0500562_015430 Ga0500562_015430_906_1766 250
113 iso_pu_bacteria 2945909444 2945914677 250
114 3300003781 Ga0055536_1006509 Ga0055536_10065092 251
115 3300003792 Ga0055540_1002001 Ga0055540_10020018 251
116 3300003794 Ga0055531_10004026 Ga0055531_100040264 251
117 3300005367 Ga0070667_100679408 Ga0070667_1006794081 251
118 3300005457 Ga0070662_100165322 Ga0070662_1001653222 251
119 3300005539 Ga0068853_100224279 Ga0068853_1002242792 251
120 3300005564 Ga0070664_100310719 Ga0070664_1003107192 251
121 3300006048 Ga0075363_100012317 Ga0075363_1000123175 251
122 3300006177 Ga0075362_10005571 Ga0075362_100055717 251
123 3300006178 Ga0075367_10211548 Ga0075367_102115481 251
124 3300006195 Ga0075366_10063911 Ga0075366_100639113 251
125 3300006353 Ga0075370_10012010 Ga0075370_100120103 251
126 3300006353 Ga0075370_10314921 Ga0075370_103149212 251
127 3300009036 Ga0105244_10002760 Ga0105244_100027605 251
128 3300009098 Ga0105245_10377537 Ga0105245_103775372 251
129 3300009148 Ga0105243_10006107 Ga0105243_100061072 251
130 3300009176 Ga0105242_10389680 Ga0105242_103896801 251
131 3300009551 Ga0105238_10075212 Ga0105238_100752123 251
132 3300014497 Ga0182008_10041440 Ga0182008_100414403 251
133 3300015261 Ga0182006_1001315 Ga0182006_100131513 251
134 3300015262 Ga0182007_10008900 Ga0182007_100089002 251
135 3300025292 Ga0209676_1000375 Ga0209676_100037529 251
136 3300025303 Ga0209051_1000112 Ga0209051_100011223 251
137 3300025304 Ga0209257_1001238 Ga0209257_100123813 251
138 3300025728 Ga0207655_1006481 Ga0207655_10064817 251
139 3300025920 Ga0207649_10462814 Ga0207649_104628141 251
140 3300025924 Ga0207694_10036947 Ga0207694_100369473 251
141 3300025927 Ga0207687_10243213 Ga0207687_102432132 251
142 3300025933 Ga0207706_10005320 Ga0207706_100053204 251
143 3300025935 Ga0207709_10028985 Ga0207709_100289854 251
144 3300025942 Ga0207689_10363820 Ga0207689_103638202 251
145 3300025945 Ga0207679_10031057 Ga0207679_100310574 251
146 3300025981 Ga0207640_10017911 Ga0207640_100179115 251
147 3300026041 Ga0207639_10039194 Ga0207639_100391943 251
148 3300028794 Ga0307515_10001329 Ga0307515_1000132932 251
149 3300028794 Ga0307515_10047437 Ga0307515_100474374 251
150 3300031456 Ga0307513_10071079 Ga0307513_100710793 251
151 3300031548 Ga0307408_100038858 Ga0307408_1000388583 251
152 3300031824 Ga0307413_10656871 Ga0307413_106568711 251
153 3300031911 Ga0307412_10068225 Ga0307412_100682253 251
154 3300032002 Ga0307416_100134517 Ga0307416_1001345172 251
155 3300041404 Ga0439436_0020585 Ga0439436_0020585_383_1141 251
156 3300041406 Ga0439439_0047272 Ga0439439_0047272_339_1097 251
157 3300041407 Ga0439447_029697 Ga0439447_029697_229_987 251
158 3300041411 Ga0439466_0007751 Ga0439466_0007751_1951_2706 251
159 3300041411 Ga0439466_0009925 Ga0439466_0009925_2418_3176 251
160 3300041413 Ga0439465_0004301 Ga0439465_0004301_1602_2357 251
161 3300041997 Ga0439431_0010265 Ga0439431_0010265_839_1594 251
162 3300041999 Ga0439433_0000045 Ga0439433_0000045_12932_13687 251
163 3300042004 Ga0439445_0036263 Ga0439445_0036263_461_1216 251
164 3300042006 Ga0439432_005774 Ga0439432_005774_1611_2366 251
165 3300042006 Ga0439432_016758 Ga0439432_016758_330_1088 251
166 3300042007 Ga0439449_0007552 Ga0439449_0007552_1857_2612 251
167 3300042007 Ga0439449_0104535 Ga0439449_0104535_155_916 251
168 3300042010 Ga0439452_005227 Ga0439452_005227_1857_2612 251
169 3300042010 Ga0439452_012496 Ga0439452_012496_553_1311 251
170 3300042014 Ga0439457_008152 Ga0439457_008152_1446_2201 251
171 3300042015 Ga0439462_0005641 Ga0439462_0005641_177_935 251
172 3300042015 Ga0439462_0040706 Ga0439462_0040706_137_892 251
173 3300042125 Ga0450923_017420 Ga0450923_017420_146_904 251
174 3300042156 Ga0439446_0075234 Ga0439446_0075234_198_956 251
175 3300042185 Ga0450909_008969 Ga0450909_008969_218_973 251
176 3300042435 Ga0439434_0005028 Ga0439434_0005028_2196_2951 251
177 3300042435 Ga0439434_0033331 Ga0439434_0033331_214_972 251
178 3300042532 Ga0450893_0005001 Ga0450893_0005001_659_1462 251
179 3300044658 Ga0466972_0078074 Ga0466972_0078074_303_1061 251
180 3300044683 Ga0466965_0017027 Ga0466965_0017027_1203_1961 251
181 3300048088 Ga0495602_0386786 Ga0495602_0386786_121_882 251
182 3300048919 Ga0496116_0062455 Ga0496116_0062455_1393_2169 251
183 3300048920 Ga0496117_0017144 Ga0496117_0017144_1392_2168 251
184 3300048921 Ga0496118_0018823 Ga0496118_0018823_1344_2120 251
185 3300048928 Ga0496125_0046119 Ga0496125_0046119_414_1190 251
186 3300050494 nmdc:mga06z11_209596_c1 nmdc:mga06z11_209596_c1_310_1086 251
187 3300050496 nmdc:mga07m45_14998_c1 nmdc:mga07m45_14998_c1_2994_3752 251
188 3300050496 nmdc:mga07m45_56236_c1 nmdc:mga07m45_56236_c1_723_1499 251
189 3300053153 Ga0500616_0043199 Ga0500616_0043199_855_1718 251
190 3300002739 JGI25158J39367_1004268 JGI25158J39367_10042683 252
191 3300002773 JGI25152J39213_1011901 JGI25152J39213_10119011 252
192 3300002773 JGI25152J39213_1020322 JGI25152J39213_10203222 252
193 3300002774 JGI25150J39212_1001540 JGI25150J39212_10015404 252
194 3300002987 JGI25159J45721_1021986 JGI25159J45721_10219862 252
195 3300002987 JGI25159J45721_1024737 JGI25159J45721_10247371 252
196 3300003187 JGI25151J46595_10001064 JGI25151J46595_100010647 252
197 3300003187 JGI25151J46595_10006226 JGI25151J46595_100062266 252
198 3300003187 JGI25151J46595_10035965 JGI25151J46595_100359653 252
199 3300003215 JGI25153J46596_10029664 JGI25153J46596_100296643 252
200 3300003354 JGI25160J50197_1036543 JGI25160J50197_10365432 252
201 3300003354 JGI25160J50197_1040180 JGI25160J50197_10401801 252
202 3300003374 JGI25161J50226_1004008 JGI25161J50226_10040084 252
203 3300003578 Ga0006562J51391_1059832 Ga0006562J51391_10598321 252
204 3300003578 Ga0006562J51391_1059833 Ga0006562J51391_10598331 252
205 3300003578 Ga0006562J51391_1074938 Ga0006562J51391_10749381 252
206 3300003771 Ga0055526_1025826 Ga0055526_10258263 252
207 3300003773 Ga0055537_1010898 Ga0055537_10108983 252
208 3300003775 Ga0055524_1025089 Ga0055524_10250893 252
209 3300003775 Ga0055524_1025098 Ga0055524_10250983 252
210 3300003781 Ga0055536_1008260 Ga0055536_10082602 252
211 3300003784 Ga0055534_1010915 Ga0055534_10109152 252
212 3300003790 Ga0055528_1023552 Ga0055528_10235523 252
213 3300003791 Ga0055530_10001026 Ga0055530_1000102615 252
214 3300003792 Ga0055540_1025427 Ga0055540_10254272 252
215 3300003792 Ga0055540_1028035 Ga0055540_10280352 252
216 3300003794 Ga0055531_10010342 Ga0055531_100103422 252
217 3300003794 Ga0055531_10021746 Ga0055531_100217463 252
218 3300004625 Ga0055543_1003567 Ga0055543_10035672 252
219 3300004625 Ga0055543_1011657 Ga0055543_10116572 252
220 3300005262 Ga0065165_1009695 Ga0065165_10096955 252
221 3300005262 Ga0065165_1028727 Ga0065165_10287273 252
222 3300005539 Ga0068853_100037536 Ga0068853_1000375364 252
223 3300006178 Ga0075367_10118070 Ga0075367_101180702 252
224 3300006195 Ga0075366_10032893 Ga0075366_100328934 252
225 3300006353 Ga0075370_10008223 Ga0075370_100082235 252
226 3300006353 Ga0075370_10116300 Ga0075370_101163002 252
227 3300006353 Ga0075370_10125598 Ga0075370_101255982 252
228 3300006353 Ga0075370_10153161 Ga0075370_101531612 252
229 3300009148 Ga0105243_10026715 Ga0105243_100267152 252
230 3300013100 Ga0157373_10093222 Ga0157373_100932223 252
231 3300013100 Ga0157373_10204540 Ga0157373_102045402 252
232 3300017792 Ga0163161_10038940 Ga0163161_100389405 252
233 3300025208 Ga0209436_104893 Ga0209436_1048932 252
234 3300025208 Ga0209436_112376 Ga0209436_1123762 252
235 3300025245 Ga0207425_1000231 Ga0207425_100023119 252
236 3300025245 Ga0207425_1003175 Ga0207425_10031753 252
237 3300025258 Ga0209129_1000177 Ga0209129_100017754 252
238 3300025258 Ga0209129_1006422 Ga0209129_10064223 252
239 3300025263 Ga0209565_1000241 Ga0209565_10002418 252
240 3300025273 Ga0209673_1000377 Ga0209673_100037765 252
241 3300025273 Ga0209673_1000507 Ga0209673_100050748 252
242 3300025284 Ga0209130_1000218 Ga0209130_100021871 252
243 3300025284 Ga0209130_1005494 Ga0209130_10054945 252
244 3300025291 Ga0209675_1000893 Ga0209675_10008938 252
245 3300025291 Ga0209675_1005373 Ga0209675_10053732 252
246 3300025291 Ga0209675_1015471 Ga0209675_10154712 252
247 3300025292 Ga0209676_1000202 Ga0209676_1000202103 252
248 3300025292 Ga0209676_1007524 Ga0209676_10075243 252
249 3300025294 Ga0209025_1000285 Ga0209025_100028518 252
250 3300025294 Ga0209025_1000322 Ga0209025_100032254 252
251 3300025294 Ga0209025_1000359 Ga0209025_100035921 252
252 3300025294 Ga0209025_1006288 Ga0209025_10062885 252
253 3300025294 Ga0209025_1009794 Ga0209025_10097944 252
254 3300025295 Ga0209564_1000223 Ga0209564_100022373 252
255 3300025295 Ga0209564_1000226 Ga0209564_100022673 252
256 3300025297 Ga0209758_1000142 Ga0209758_1000142111 252
257 3300025297 Ga0209758_1014767 Ga0209758_10147674 252
258 3300025298 Ga0209050_1000224 Ga0209050_100022461 252
259 3300025299 Ga0209256_1000114 Ga0209256_1000114111 252
260 3300025299 Ga0209256_1000174 Ga0209256_100017473 252
261 3300025302 Ga0207426_1000162 Ga0207426_1000162110 252
262 3300025302 Ga0207426_1000232 Ga0207426_100023273 252
263 3300025303 Ga0209051_1000313 Ga0209051_100031378 252
264 3300025304 Ga0209257_1000163 Ga0209257_100016371 252
265 3300025304 Ga0209257_1004089 Ga0209257_10040897 252
266 3300025981 Ga0207640_10162781 Ga0207640_101627812 252
267 3300026041 Ga0207639_10023896 Ga0207639_100238964 252
268 3300027907 Ga0207428_10186035 Ga0207428_101860353 252
269 3300030733 Ga0314311_1054731 Ga0314311_10547312 252
270 3300030736 Ga0316180_1049446 Ga0316180_10494463 252
271 3300030742 Ga0316183_1031158 Ga0316183_10311582 252
272 3300030744 Ga0316181_1008937 Ga0316181_10089372 252
273 3300030744 Ga0316181_1079860 Ga0316181_10798602 252
274 3300030745 Ga0316182_1037951 Ga0316182_10379512 252
275 3300030745 Ga0316182_1332530 Ga0316182_13325302 252
276 3300031911 Ga0307412_10002787 Ga0307412_100027875 252
277 3300031911 Ga0307412_10042035 Ga0307412_100420353 252
278 3300032002 Ga0307416_100427059 Ga0307416_1004270592 252
279 3300032004 Ga0307414_10204627 Ga0307414_102046272 252
280 3300032004 Ga0307414_10237936 Ga0307414_102379362 252
281 3300032004 Ga0307414_10248967 Ga0307414_102489672 252
282 3300046460 Ga0495638_0005794 Ga0495638_0005794_7845_8603 252
283 3300046462 Ga0495651_0041245 Ga0495651_0041245_755_1519 252
284 3300046513 Ga0495616_0006998 Ga0495616_0006998_188_946 252
285 3300046518 Ga0495631_0000158 Ga0495631_0000158_18691_19449 252
286 3300046536 Ga0495587_0287336 Ga0495587_0287336_97_858 252
287 3300046616 Ga0495668_0120694 Ga0495668_0120694_585_1343 252
288 3300046660 Ga0495625_0034974 Ga0495625_0034974_1255_2013 252
289 3300046690 Ga0495624_0112204 Ga0495624_0112204_34_807 252
290 3300047321 Ga0495676_0064752 Ga0495676_0064752_1479_2252 252
291 3300047673 Ga0495593_0009779 Ga0495593_0009779_3193_3966 252
292 3300048088 Ga0495602_0386518 Ga0495602_0386518_34_807 252
293 3300048089 Ga0495614_0067041 Ga0495614_0067041_566_1339 252
294 3300048904 Ga0496101_0010997 Ga0496101_0010997_3055_3828 252
295 3300048919 Ga0496116_0020450 Ga0496116_0020450_3701_4477 252
296 3300048920 Ga0496117_0034963 Ga0496117_0034963_948_1706 252
297 3300048924 Ga0496121_0059192 Ga0496121_0059192_1678_2454 252
298 3300048925 Ga0496122_0075191 Ga0496122_0075191_542_1300 252
299 3300048926 Ga0496123_0063244 Ga0496123_0063244_216_974 252
300 3300048927 Ga0496124_0119267 Ga0496124_0119267_233_991 252
301 3300048928 Ga0496125_0033926 Ga0496125_0033926_2120_2878 252
302 3300048928 Ga0496125_0251747 Ga0496125_0251747_213_989 252
303 3300050491 nmdc:mga00v17_238348_c1 nmdc:mga00v17_238348_c1_246_1007 252
304 3300050493 nmdc:mga0k408_42949_c1 nmdc:mga0k408_42949_c1_242_1027 252
305 3300050494 nmdc:mga06z11_57423_c1 nmdc:mga06z11_57423_c1_255_1040 252
306 3300050494 nmdc:mga06z11_90582_c1 nmdc:mga06z11_90582_c1_741_1499 252
307 3300050496 nmdc:mga07m45_252463_c1 nmdc:mga07m45_252463_c1_63_839 252
308 3300050496 nmdc:mga07m45_8222_c1 nmdc:mga07m45_8222_c1_4219_5004 252
309 3300053087 Ga0500643_011220 Ga0500643_011220_2233_3006 252
310 3300053093 Ga0500651_0001059 Ga0500651_0001059_6726_7499 252
311 3300053110 Ga0500571_000368 Ga0500571_000368_10889_11662 252
312 3300053111 Ga0500572_016901 Ga0500572_016901_663_1421 252
313 3300053118 Ga0500594_0004055 Ga0500594_0004055_1462_2220 252
314 3300053121 Ga0500607_004969 Ga0500607_004969_374_1132 252
315 3300053134 Ga0500658_0000190 Ga0500658_0000190_11844_12617 252
316 3300053134 Ga0500658_0000270 Ga0500658_0000270_11449_12207 252
317 3300053136 Ga0500559_0030714 Ga0500559_0030714_293_1054 252
318 3300053139 Ga0500568_0001857 Ga0500568_0001857_1218_1976 252
319 3300053153 Ga0500616_0027479 Ga0500616_0027479_1843_2601 252
320 3300053161 Ga0500634_0134940 Ga0500634_0134940_206_979 252
321 3300053162 Ga0500638_004264 Ga0500638_004264_2663_3436 252
322 3300053177 Ga0500636_0007142 Ga0500636_0007142_5273_6046 252
323 iso_pu_bacteria 2738541307 2738885552 252

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fmu-assembly1.cif.gz_A crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution 0.7173 19 238
1tcv-assembly1.cif.gz_A crystal structure of the purine nucleoside phosphorylase from schistosoma mansoni in complex with non-detergent sulfobetaine 195 and acetate 0.7032 109 133
3tz6-assembly1.cif.gz_A-2 crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv 0.684 26 133
2fmu-assembly1.cif.gz_A crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution 0.6754 19 238
2a35-assembly1.cif.gz_A 1.5 a crystal structure of a protein of unknown function pa4017 from pseudomonas aeruginosa pao1, possible epimerase 0.6625 24 239
ID Description Score Start End Superfamily
2fmuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7173 19 238 3.40.50.720
4xymA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6836 26 164 3.40.50.720
2fmuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6754 19 238 3.40.50.720
2a35B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6604 24 239 3.40.50.720
2a35B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6547 24 239 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7U9A7T6-F1-model_v4 deleted 0.8304 26 251
AF-A0A7U9A7T6-F1-model_v4 deleted 0.8167 26 251
AF-A0A0Q7CW13-F1-model_v4 NAD(P)-binding domain-containing protein 0.7483 14 248
AF-A0A1K2H9S3-F1-model_v4 NAD(P)H-binding 0.7354 21 243
AF-A0A6M5XXB7-F1-model_v4 deleted 0.7347 1 248

Feature Viewer

pLDDT pTM Quality
77.27 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map