F406977
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 323 | 218 | 319 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300031344|Ga0265316_10155940|Ga0265316_101559404 |
| Length | 219 |
| Sequence | MDQALQKRLIEAVASTVIAHADELTSLDSAIGDGDHGLNMKRGFTEVMADVDGLAAKPLPDALRAIGTKLVMKIGGASGPLYGTLFLTLGKEIADPPTASDAARAFGVAVAAVMARGKSEPGQKTMLDVLAPTQAELAAGGDDLLARLKSRAAASAEATVPMRAIRGRASFLGERSVGHMDPGARSSWLMIEAVCDVLAHVPAKWTPVRRQEHAPLKDV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 2 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 3 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 4 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 75 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 76 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 112 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 113 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 115 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 117 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 120 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 122 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 123 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 124 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 125 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 126 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 128 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 129 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 131 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 132 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 138 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 139 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 140 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 141 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 176 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 177 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 178 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 179 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 182 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 183 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 184 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 185 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 186 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 187 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 188 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 189 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 190 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 204 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 209 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 213 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 214 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 215 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 218 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.76 |
| Metatranscriptomes | 0 |
| Isolates | 1.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.86 |
| Nodule | 0.31 |
| Rhizoplane | 6.81 |
| Rhizosphere | 84.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10026210 | 3300003323 | Bacteria | 1546 |
| 2 | JGI25404J52841_10006282 | 3300003659 | Bacteria | 2481 |
| 3 | JGI25404J52841_10008949 | 3300003659 | Bacteria | 2139 |
| 4 | Ga0065715_10005719 | 3300005293 | Bacteria | 4176 |
| 5 | Ga0070658_10084121 | 3300005327 | Bacteria | 2616 |
| 6 | Ga0070676_10095213 | 3300005328 | Bacteria | 1831 |
| 7 | Ga0070683_100032630 | 3300005329 | Bacteria | 4742 |
| 8 | Ga0068869_100298469 | 3300005334 | Bacteria | 1300 |
| 9 | Ga0070680_100032603 | 3300005336 | Bacteria | 4194 |
| 10 | Ga0070680_100845803 | 3300005336 | Bacteria | 789 |
| 11 | Ga0070660_100067269 | 3300005339 | Bacteria | 2791 |
| 12 | Ga0070669_100107524 | 3300005353 | Bacteria | 2113 |
| 13 | Ga0070674_100033843 | 3300005356 | Bacteria | 3406 |
| 14 | Ga0070674_100346730 | 3300005356 | Bacteria | 1198 |
| 15 | Ga0070667_100336818 | 3300005367 | Bacteria | 1364 |
| 16 | Ga0070709_10015330 | 3300005434 | Bacteria | 4359 |
| 17 | Ga0070709_10116521 | 3300005434 | Bacteria | 1804 |
| 18 | Ga0070709_10156774 | 3300005434 | Bacteria | 1579 |
| 19 | Ga0070714_100100930 | 3300005435 | Bacteria | 2542 |
| 20 | Ga0070714_100143638 | 3300005435 | Bacteria | 2144 |
| 21 | Ga0070714_100578725 | 3300005435 | Bacteria | 1077 |
| 22 | Ga0070714_100805612 | 3300005435 | Bacteria | 910 |
| 23 | Ga0070713_100014695 | 3300005436 | Bacteria | 5823 |
| 24 | Ga0070713_100019136 | 3300005436 | Bacteria | 5219 |
| 25 | Ga0070713_100026782 | 3300005436 | Bacteria | 4532 |
| 26 | Ga0070713_100038640 | 3300005436 | Bacteria | 3869 |
| 27 | Ga0070713_100737717 | 3300005436 | Bacteria | 942 |
| 28 | Ga0070710_10003768 | 3300005437 | Bacteria | 7171 |
| 29 | Ga0070710_10282089 | 3300005437 | Bacteria | 1078 |
| 30 | Ga0070701_10130508 | 3300005438 | Bacteria | 1427 |
| 31 | Ga0070711_100021603 | 3300005439 | Bacteria | 4164 |
| 32 | Ga0070711_100033655 | 3300005439 | Bacteria | 3413 |
| 33 | Ga0070711_100164139 | 3300005439 | Bacteria | 1686 |
| 34 | Ga0070694_100202531 | 3300005444 | Bacteria | 1480 |
| 35 | Ga0070708_100349796 | 3300005445 | Bacteria | 1393 |
| 36 | Ga0070663_100163543 | 3300005455 | Bacteria | 1715 |
| 37 | Ga0070678_100251476 | 3300005456 | Bacteria | 1482 |
| 38 | Ga0070662_100256580 | 3300005457 | Bacteria | 1407 |
| 39 | Ga0070681_10281845 | 3300005458 | Bacteria | 1572 |
| 40 | Ga0070706_100061621 | 3300005467 | Bacteria | 3464 |
| 41 | Ga0070706_100438436 | 3300005467 | Bacteria | 1216 |
| 42 | Ga0070706_100457862 | 3300005467 | Bacteria | 1187 |
| 43 | Ga0070707_100030062 | 3300005468 | Bacteria | 5169 |
| 44 | Ga0070707_100120568 | 3300005468 | Bacteria | 2546 |
| 45 | Ga0070707_101034868 | 3300005468 | Bacteria | 787 |
| 46 | Ga0070698_100096790 | 3300005471 | Bacteria | 2928 |
| 47 | Ga0070698_100167105 | 3300005471 | Bacteria | 2142 |
| 48 | Ga0070698_100233199 | 3300005471 | Bacteria | 1774 |
| 49 | Ga0070698_100438702 | 3300005471 | Bacteria | 1241 |
| 50 | Ga0070699_100008521 | 3300005518 | Bacteria | 8888 |
| 51 | Ga0070699_100397753 | 3300005518 | Bacteria | 1245 |
| 52 | Ga0070679_100056648 | 3300005530 | Bacteria | 3905 |
| 53 | Ga0070684_100003618 | 3300005535 | Bacteria | 11636 |
| 54 | Ga0068853_100040370 | 3300005539 | Bacteria | 3981 |
| 55 | Ga0070665_100321500 | 3300005548 | Bacteria | 1552 |
| 56 | Ga0070704_100434164 | 3300005549 | Bacteria | 1127 |
| 57 | Ga0068855_100220273 | 3300005563 | Bacteria | 2128 |
| 58 | Ga0068857_100053523 | 3300005577 | Bacteria | 3580 |
| 59 | Ga0068854_100136535 | 3300005578 | Bacteria | 1878 |
| 60 | Ga0068859_100057158 | 3300005617 | Bacteria | 3930 |
| 61 | Ga0068861_100379318 | 3300005719 | Bacteria | 1249 |
| 62 | Ga0068851_10004499 | 3300005834 | Bacteria | 6291 |
| 63 | Ga0068863_100868889 | 3300005841 | Bacteria | 901 |
| 64 | Ga0068858_100124492 | 3300005842 | Bacteria | 2413 |
| 65 | Ga0068860_100120557 | 3300005843 | Bacteria | 2511 |
| 66 | Ga0081455_10005782 | 3300005937 | Bacteria | 13481 |
| 67 | Ga0081540_1000195 | 3300005983 | Bacteria | 62863 |
| 68 | Ga0081540_1007955 | 3300005983 | Bacteria | 7473 |
| 69 | Ga0070717_10005856 | 3300006028 | Bacteria | 9003 |
| 70 | Ga0070717_10134531 | 3300006028 | Bacteria | 2128 |
| 71 | Ga0070716_100282603 | 3300006173 | Bacteria | 1146 |
| 72 | Ga0070712_100003703 | 3300006175 | Bacteria | 9420 |
| 73 | Ga0070712_100009052 | 3300006175 | Bacteria | 6271 |
| 74 | Ga0070712_100171990 | 3300006175 | Bacteria | 1682 |
| 75 | Ga0075428_100195925 | 3300006844 | Bacteria | 2185 |
| 76 | Ga0075433_10247508 | 3300006852 | Bacteria | 1582 |
| 77 | Ga0075434_100096581 | 3300006871 | Bacteria | 2960 |
| 78 | Ga0068865_100170084 | 3300006881 | Bacteria | 1670 |
| 79 | Ga0075436_100691279 | 3300006914 | Bacteria | 755 |
| 80 | Ga0097620_100057158 | 3300006931 | Bacteria | 3930 |
| 81 | Ga0075435_100234381 | 3300007076 | Bacteria | 1560 |
| 82 | Ga0099794_10002417 | 3300007265 | Bacteria | 6880 |
| 83 | Ga0099794_10131585 | 3300007265 | Bacteria | 1263 |
| 84 | Ga0099794_10212654 | 3300007265 | Bacteria | 992 |
| 85 | Ga0099795_10004316 | 3300007788 | Bacteria | 3652 |
| 86 | Ga0099795_10038028 | 3300007788 | Bacteria | 1697 |
| 87 | Ga0105240_10031202 | 3300009093 | Bacteria | 6914 |
| 88 | Ga0105247_10017850 | 3300009101 | Bacteria | 4256 |
| 89 | Ga0105247_10803216 | 3300009101 | Unclassified | 718 |
| 90 | Ga0105242_10327371 | 3300009176 | Bacteria | 1407 |
| 91 | Ga0105248_10938085 | 3300009177 | Bacteria | 977 |
| 92 | Ga0105237_10017035 | 3300009545 | Bacteria | 7544 |
| 93 | Ga0105237_10186225 | 3300009545 | Bacteria | 2076 |
| 94 | Ga0105238_10018874 | 3300009551 | Bacteria | 7021 |
| 95 | Ga0105238_10595277 | 3300009551 | Bacteria | 1113 |
| 96 | Ga0105249_10182219 | 3300009553 | Bacteria | 2044 |
| 97 | Ga0105249_10549442 | 3300009553 | Bacteria | 1205 |
| 98 | Ga0099796_10063509 | 3300010159 | Bacteria | 1315 |
| 99 | Ga0105239_10391701 | 3300010375 | Bacteria | 1572 |
| 100 | Ga0105239_10495319 | 3300010375 | Bacteria | 1389 |
| 101 | Ga0157373_10620508 | 3300013100 | Bacteria | 788 |
| 102 | Ga0157370_10057819 | 3300013104 | Bacteria | 3686 |
| 103 | Ga0157369_10047093 | 3300013105 | Bacteria | 4684 |
| 104 | Ga0163163_10441736 | 3300014325 | Bacteria | 1361 |
| 105 | Ga0182008_10243659 | 3300014497 | Bacteria | 925 |
| 106 | Ga0213874_10017590 | 3300021377 | Bacteria | 1919 |
| 107 | Ga0213876_10076837 | 3300021384 | Bacteria | 1764 |
| 108 | Ga0213876_10151302 | 3300021384 | Bacteria | 1234 |
| 109 | Ga0207656_10004948 | 3300025321 | Bacteria | 4681 |
| 110 | Ga0207692_10052094 | 3300025898 | Bacteria | 2078 |
| 111 | Ga0207699_10010746 | 3300025906 | Bacteria | 4605 |
| 112 | Ga0207699_10021067 | 3300025906 | Bacteria | 3506 |
| 113 | Ga0207699_10092999 | 3300025906 | Bacteria | 1897 |
| 114 | Ga0207645_10161172 | 3300025907 | Bacteria | 1468 |
| 115 | Ga0207705_10063917 | 3300025909 | Bacteria | 2659 |
| 116 | Ga0207684_10132478 | 3300025910 | Bacteria | 2140 |
| 117 | Ga0207707_10001229 | 3300025912 | Bacteria | 24021 |
| 118 | Ga0207695_10128881 | 3300025913 | Bacteria | 2489 |
| 119 | Ga0207671_10103726 | 3300025914 | Bacteria | 2157 |
| 120 | Ga0207671_10210281 | 3300025914 | Bacteria | 1521 |
| 121 | Ga0207693_10006645 | 3300025915 | Bacteria | 9555 |
| 122 | Ga0207693_10030889 | 3300025915 | Bacteria | 4231 |
| 123 | Ga0207693_10131799 | 3300025915 | Bacteria | 1965 |
| 124 | Ga0207693_10136073 | 3300025915 | Bacteria | 1932 |
| 125 | Ga0207693_10258482 | 3300025915 | Bacteria | 1366 |
| 126 | Ga0207663_10030257 | 3300025916 | Bacteria | 3192 |
| 127 | Ga0207663_10213989 | 3300025916 | Bacteria | 1398 |
| 128 | Ga0207663_10367173 | 3300025916 | Bacteria | 1093 |
| 129 | Ga0207660_10007648 | 3300025917 | Bacteria | 6997 |
| 130 | Ga0207657_10000658 | 3300025919 | Bacteria | 36762 |
| 131 | Ga0207652_10005888 | 3300025921 | Bacteria | 9920 |
| 132 | Ga0207646_10017701 | 3300025922 | Bacteria | 6659 |
| 133 | Ga0207646_10069582 | 3300025922 | Bacteria | 3143 |
| 134 | Ga0207646_10203144 | 3300025922 | Bacteria | 1790 |
| 135 | Ga0207681_10377554 | 3300025923 | Bacteria | 1140 |
| 136 | Ga0207694_10113636 | 3300025924 | Bacteria | 2156 |
| 137 | Ga0207694_10387160 | 3300025924 | Bacteria | 1161 |
| 138 | Ga0207694_10563644 | 3300025924 | Bacteria | 957 |
| 139 | Ga0207700_10053923 | 3300025928 | Bacteria | 3015 |
| 140 | Ga0207700_10133916 | 3300025928 | Bacteria | 2027 |
| 141 | Ga0207700_10155650 | 3300025928 | Bacteria | 1893 |
| 142 | Ga0207700_10160945 | 3300025928 | Bacteria | 1864 |
| 143 | Ga0207664_10017070 | 3300025929 | Bacteria | 5309 |
| 144 | Ga0207664_10317079 | 3300025929 | Bacteria | 1375 |
| 145 | Ga0207664_10440981 | 3300025929 | Bacteria | 1161 |
| 146 | Ga0207706_10284367 | 3300025933 | Bacteria | 1442 |
| 147 | Ga0207706_10650473 | 3300025933 | Bacteria | 903 |
| 148 | Ga0207706_10658763 | 3300025933 | Bacteria | 896 |
| 149 | Ga0207709_10321767 | 3300025935 | Bacteria | 1158 |
| 150 | Ga0207669_10669734 | 3300025937 | Bacteria | 850 |
| 151 | Ga0207669_10703340 | 3300025937 | Bacteria | 831 |
| 152 | Ga0207665_10017888 | 3300025939 | Bacteria | 4659 |
| 153 | Ga0207665_10148109 | 3300025939 | Bacteria | 1679 |
| 154 | Ga0207665_10206755 | 3300025939 | Bacteria | 1432 |
| 155 | Ga0207665_10247941 | 3300025939 | Bacteria | 1315 |
| 156 | Ga0207665_10352235 | 3300025939 | Bacteria | 1112 |
| 157 | Ga0207679_10442117 | 3300025945 | Bacteria | 1152 |
| 158 | Ga0207712_10230194 | 3300025961 | Bacteria | 1487 |
| 159 | Ga0207677_10556571 | 3300026023 | Bacteria | 1000 |
| 160 | Ga0207703_10169742 | 3300026035 | Bacteria | 1918 |
| 161 | Ga0207702_11253845 | 3300026078 | Bacteria | 735 |
| 162 | Ga0207641_10691359 | 3300026088 | Bacteria | 1004 |
| 163 | Ga0207676_10142181 | 3300026095 | Bacteria | 2056 |
| 164 | Ga0207674_10205570 | 3300026116 | Bacteria | 1918 |
| 165 | Ga0209179_1042938 | 3300027512 | Bacteria | 955 |
| 166 | Ga0209588_1002345 | 3300027671 | Bacteria | 5132 |
| 167 | Ga0209588_1071634 | 3300027671 | Bacteria | 1119 |
| 168 | Ga0268264_10400603 | 3300028381 | Bacteria | 1319 |
| 169 | Ga0265318_10023853 | 3300028577 | Bacteria | 2434 |
| 170 | Ga0307515_10134875 | 3300028794 | Bacteria | 2692 |
| 171 | Ga0265327_10003742 | 3300031251 | Bacteria | 14142 |
| 172 | Ga0265316_10090832 | 3300031344 | Bacteria | 2330 |
| 173 | Ga0265316_10155940 | 3300031344 | Bacteria | 1709 |
| 174 | Ga0265313_10157457 | 3300031595 | Bacteria | 967 |
| 175 | Ga0373926_0128895 | 3300035083 | Bacteria | 957 |
| 176 | Ga0373934_0091050 | 3300035086 | Bacteria | 1229 |
| 177 | Ga0373944_0081222 | 3300035089 | Bacteria | 1071 |
| 178 | Ga0373923_0019533 | 3300035111 | Bacteria | 2624 |
| 179 | Ga0373932_0161023 | 3300035112 | Bacteria | 776 |
| 180 | Ga0373953_0023957 | 3300035117 | Bacteria | 2316 |
| 181 | Ga0373953_0076046 | 3300035117 | Bacteria | 1391 |
| 182 | Ga0373954_0269383 | 3300035118 | Bacteria | 839 |
| 183 | Ga0373956_0296823 | 3300035119 | Bacteria | 770 |
| 184 | Ga0373957_0057153 | 3300035120 | Bacteria | 1504 |
| 185 | Ga0373943_0046922 | 3300035170 | Bacteria | 2110 |
| 186 | Ga0373946_0091112 | 3300035171 | Bacteria | 1351 |
| 187 | Ga0373955_0122755 | 3300035172 | Bacteria | 1511 |
| 188 | Ga0373924_0066855 | 3300035410 | Bacteria | 1511 |
| 189 | Ga0373931_0326670 | 3300035691 | Bacteria | 954 |
| 190 | Ga0373935_0052870 | 3300035692 | Bacteria | 2583 |
| 191 | Ga0373935_0382067 | 3300035692 | Bacteria | 1009 |
| 192 | Ga0373927_0005809 | 3300035695 | Bacteria | 8466 |
| 193 | Ga0373927_0090397 | 3300035695 | Bacteria | 1988 |
| 194 | Ga0373927_0156581 | 3300035695 | Bacteria | 1492 |
| 195 | Ga0373933_0000225 | 3300035724 | Bacteria | 37547 |
| 196 | Ga0373933_0077785 | 3300035724 | Bacteria | 2028 |
| 197 | Ga0373947_0011058 | 3300035725 | Bacteria | 5181 |
| 198 | Ga0373947_0047924 | 3300035725 | Bacteria | 2562 |
| 199 | Ga0373947_0140595 | 3300035725 | Bacteria | 1548 |
| 200 | Ga0373937_0142097 | 3300036401 | Bacteria | 2246 |
| 201 | Ga0373925_0010306 | 3300037068 | Bacteria | 6780 |
| 202 | Ga0373925_0066579 | 3300037068 | Bacteria | 2716 |
| 203 | Ga0395905_0395201 | 3300037471 | Bacteria | 1277 |
| 204 | Ga0436364_0318332 | 3300037853 | Bacteria | 1462 |
| 205 | Ga0436365_0395291 | 3300039437 | Bacteria | 1414 |
| 206 | Ga0436365_0822362 | 3300039437 | Bacteria | 2021 |
| 207 | Ga0436365_0946825 | 3300039437 | Bacteria | 726 |
| 208 | Ga0436365_1246958 | 3300039437 | Bacteria | 2563 |
| 209 | Ga0436363_0657874 | 3300039450 | Bacteria | 5703 |
| 210 | Ga0436363_1534966 | 3300039450 | Bacteria | 3243 |
| 211 | Ga0439459_0083429 | 3300042438 | Bacteria | 758 |
| 212 | Ga0466957_0013299 | 3300044842 | Bacteria | 4774 |
| 213 | Ga0466959_0022097 | 3300045049 | Bacteria | 4700 |
| 214 | Ga0466967_0479187 | 3300045976 | Bacteria | 1219 |
| 215 | Ga0495592_0075891 | 3300046454 | Bacteria | 2440 |
| 216 | Ga0495592_0090304 | 3300046454 | Bacteria | 2198 |
| 217 | Ga0495603_0059484 | 3300046455 | Bacteria | 2259 |
| 218 | Ga0495603_0271063 | 3300046455 | Bacteria | 976 |
| 219 | Ga0495603_0292614 | 3300046455 | Bacteria | 935 |
| 220 | Ga0495580_0034398 | 3300046472 | Bacteria | 3648 |
| 221 | Ga0495580_0458008 | 3300046472 | Bacteria | 855 |
| 222 | Ga0495582_0137715 | 3300046473 | Bacteria | 1382 |
| 223 | Ga0495582_0199424 | 3300046473 | Bacteria | 1143 |
| 224 | Ga0495639_0012761 | 3300046475 | Bacteria | 3624 |
| 225 | Ga0495639_0143943 | 3300046475 | Bacteria | 1147 |
| 226 | Ga0495662_0019210 | 3300046476 | Bacteria | 3306 |
| 227 | Ga0495664_0037562 | 3300046477 | Bacteria | 2859 |
| 228 | Ga0495594_0067092 | 3300046499 | Bacteria | 1991 |
| 229 | Ga0495594_0089717 | 3300046499 | Bacteria | 1722 |
| 230 | Ga0495608_0339204 | 3300046511 | Bacteria | 926 |
| 231 | Ga0495618_0083373 | 3300046514 | Bacteria | 2042 |
| 232 | Ga0495618_0099079 | 3300046514 | Bacteria | 1865 |
| 233 | Ga0495630_0350655 | 3300046517 | Bacteria | 1129 |
| 234 | Ga0495643_0163879 | 3300046522 | Bacteria | 1092 |
| 235 | Ga0495652_0037628 | 3300046529 | Bacteria | 4196 |
| 236 | Ga0495652_0406422 | 3300046529 | Bacteria | 963 |
| 237 | Ga0495665_0032226 | 3300046531 | Bacteria | 2803 |
| 238 | Ga0495640_0087931 | 3300046533 | Bacteria | 2054 |
| 239 | Ga0495634_0005118 | 3300046642 | Bacteria | 10123 |
| 240 | Ga0495635_0185202 | 3300046663 | Bacteria | 1414 |
| 241 | Ga0495599_0224931 | 3300046678 | Bacteria | 1147 |
| 242 | Ga0495658_0011638 | 3300046683 | Bacteria | 4432 |
| 243 | Ga0495658_0532031 | 3300046683 | Bacteria | 752 |
| 244 | Ga0495613_0126090 | 3300046689 | Bacteria | 1836 |
| 245 | Ga0495624_0335437 | 3300046690 | Bacteria | 910 |
| 246 | Ga0495589_0190133 | 3300046794 | Bacteria | 972 |
| 247 | Ga0495581_0239179 | 3300047315 | Bacteria | 1062 |
| 248 | Ga0495604_0035914 | 3300047317 | Bacteria | 3911 |
| 249 | Ga0495674_0016093 | 3300047319 | Bacteria | 6980 |
| 250 | Ga0495674_0233620 | 3300047319 | Bacteria | 1517 |
| 251 | Ga0495675_0414265 | 3300047444 | Bacteria | 784 |
| 252 | Ga0495684_0002075 | 3300047471 | Bacteria | 16100 |
| 253 | Ga0495593_0016513 | 3300047673 | Bacteria | 4162 |
| 254 | Ga0495602_0344145 | 3300048088 | Bacteria | 1078 |
| 255 | Ga0496100_0007356 | 3300048903 | Bacteria | 6069 |
| 256 | Ga0496101_0189476 | 3300048904 | Bacteria | 1587 |
| 257 | Ga0496102_0031230 | 3300048905 | Bacteria | 4776 |
| 258 | Ga0496105_0322948 | 3300048908 | Bacteria | 1237 |
| 259 | Ga0496106_0028680 | 3300048909 | Bacteria | 4146 |
| 260 | Ga0496106_0034749 | 3300048909 | Bacteria | 3767 |
| 261 | Ga0496107_0170694 | 3300048910 | Bacteria | 1614 |
| 262 | Ga0496107_0362043 | 3300048910 | Bacteria | 1079 |
| 263 | Ga0496108_0620496 | 3300048911 | Bacteria | 941 |
| 264 | Ga0496109_0118164 | 3300048912 | Bacteria | 2468 |
| 265 | Ga0496109_0388440 | 3300048912 | Bacteria | 1319 |
| 266 | Ga0496109_0422748 | 3300048912 | Bacteria | 1259 |
| 267 | Ga0496110_0017067 | 3300048913 | Bacteria | 6068 |
| 268 | Ga0496110_0031842 | 3300048913 | Bacteria | 4552 |
| 269 | Ga0496111_0010126 | 3300048914 | Bacteria | 6311 |
| 270 | Ga0496111_0195316 | 3300048914 | Bacteria | 1504 |
| 271 | Ga0496112_0026585 | 3300048915 | Bacteria | 5573 |
| 272 | Ga0496112_0074531 | 3300048915 | Bacteria | 3355 |
| 273 | Ga0496112_0116204 | 3300048915 | Bacteria | 2646 |
| 274 | Ga0496113_0134418 | 3300048916 | Bacteria | 1942 |
| 275 | Ga0496113_1009080 | 3300048916 | Bacteria | 655 |
| 276 | Ga0496115_0080729 | 3300048918 | Bacteria | 2648 |
| 277 | Ga0496121_0292374 | 3300048924 | Bacteria | 1109 |
| 278 | Ga0496122_0086474 | 3300048925 | Bacteria | 2157 |
| 279 | Ga0496124_0338781 | 3300048927 | Bacteria | 1069 |
| 280 | Ga0496126_0012615 | 3300048929 | Bacteria | 8648 |
| 281 | Ga0496126_0192338 | 3300048929 | Bacteria | 1727 |
| 282 | Ga0496126_0233836 | 3300048929 | Bacteria | 1539 |
| 283 | Ga0496126_0333502 | 3300048929 | Bacteria | 1244 |
| 284 | Ga0501034_0192558 | 3300049571 | Bacteria | 2001 |
| 285 | Ga0501037_0112906 | 3300049573 | Bacteria | 1957 |
| 286 | Ga0501042_0643226 | 3300049578 | Bacteria | 771 |
| 287 | Ga0501047_0439459 | 3300049581 | Bacteria | 1135 |
| 288 | Ga0501067_0008588 | 3300049583 | Bacteria | 5662 |
| 289 | Ga0501072_0394424 | 3300049588 | Bacteria | 1098 |
| 290 | Ga0501072_0543459 | 3300049588 | Bacteria | 918 |
| 291 | Ga0501073_0007746 | 3300049589 | Bacteria | 7973 |
| 292 | Ga0501073_0009620 | 3300049589 | Bacteria | 7129 |
| 293 | Ga0501073_0021812 | 3300049589 | Bacteria | 4614 |
| 294 | Ga0501074_0065773 | 3300049590 | Bacteria | 2609 |
| 295 | Ga0501074_0299228 | 3300049590 | Bacteria | 1143 |
| 296 | Ga0501076_0056621 | 3300049592 | Bacteria | 3112 |
| 297 | Ga0501077_0113321 | 3300049593 | Bacteria | 1719 |
| 298 | Ga0501080_0518287 | 3300049742 | Bacteria | 1064 |
| 299 | Ga0501083_0006225 | 3300049744 | Bacteria | 8464 |
| 300 | Ga0501044_0461453 | 3300049823 | Bacteria | 1176 |
| 301 | nmdc:mga0yw44_182621_c1 | 3300050492 | Bacteria | 1381 |
| 302 | nmdc:mga0yw44_46726_c1 | 3300050492 | Bacteria | 1666 |
| 303 | nmdc:mga0n895_15949_c1 | 3300050512 | Bacteria | 6876 |
| 304 | nmdc:mga0n895_708063_c1 | 3300050512 | Bacteria | 1002 |
| 305 | nmdc:mga0rr50_384118_c1 | 3300050513 | Bacteria | 1184 |
| 306 | nmdc:mga08x19_21747_c1 | 3300050514 | Bacteria | 761 |
| 307 | nmdc:mga0a205_281532_c1 | 3300050515 | Bacteria | 1538 |
| 308 | nmdc:mga0sz30_14893_c1 | 3300050516 | Bacteria | 3067 |
| 309 | Ga0495601_0202805 | 3300053077 | Bacteria | 1296 |
| 310 | Ga0495612_0245975 | 3300053078 | Bacteria | 795 |
| 311 | Ga0495619_0136571 | 3300053085 | Bacteria | 1687 |
| 312 | Ga0500577_0044881 | 3300053142 | Bacteria | 1631 |
| 313 | Ga0500627_0111134 | 3300053158 | Bacteria | 1234 |
| 314 | Ga0500636_0006447 | 3300053177 | Bacteria | 6737 |
| 315 | Ga0501084_0047195 | 3300054114 | Bacteria | 3607 |
| 316 | Ga0501084_0076233 | 3300054114 | Bacteria | 2810 |
| 317 | Ga0501082_0153811 | 3300060353 | Bacteria | 1998 |
| 318 | Ga0466962_0035044 | 3300061719 | Bacteria | 2403 |
| 319 | Ga0530510_0334843 | 3300061734 | Bacteria | 1136 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10206755 | Ga0207665_102067552 | 139 |
| 2 | 3300046529 | Ga0495652_0037628 | Ga0495652_0037628_12_551 | 156 |
| 3 | 3300009553 | Ga0105249_10182219 | Ga0105249_101822194 | 162 |
| 4 | 3300025961 | Ga0207712_10230194 | Ga0207712_102301942 | 162 |
| 5 | 3300048088 | Ga0495602_0344145 | Ga0495602_0344145_181_795 | 172 |
| 6 | 3300005467 | Ga0070706_100061621 | Ga0070706_1000616213 | 173 |
| 7 | 3300005518 | Ga0070699_100008521 | Ga0070699_10000852110 | 173 |
| 8 | 3300009551 | Ga0105238_10595277 | Ga0105238_105952772 | 173 |
| 9 | 3300025922 | Ga0207646_10017701 | Ga0207646_100177014 | 173 |
| 10 | iso_pu_bacteria | 2818991467 | 2819721859 | 173 |
| 11 | iso_pu_bacteria | 2851182111 | 2851184269 | 173 |
| 12 | iso_pu_bacteria | 2917699015 | 2917700895 | 173 |
| 13 | 3300005334 | Ga0068869_100298469 | Ga0068869_1002984692 | 174 |
| 14 | 3300005435 | Ga0070714_100143638 | Ga0070714_1001436383 | 174 |
| 15 | 3300006028 | Ga0070717_10134531 | Ga0070717_101345313 | 174 |
| 16 | 3300025929 | Ga0207664_10017070 | Ga0207664_100170703 | 174 |
| 17 | 3300049571 | Ga0501034_0192558 | Ga0501034_0192558_1075_1671 | 174 |
| 18 | 3300050492 | nmdc:mga0yw44_46726_c1 | nmdc:mga0yw44_46726_c1_451_1068 | 174 |
| 19 | 3300053158 | Ga0500627_0111134 | Ga0500627_0111134_379_996 | 174 |
| 20 | 3300005328 | Ga0070676_10095213 | Ga0070676_100952132 | 175 |
| 21 | 3300005353 | Ga0070669_100107524 | Ga0070669_1001075243 | 175 |
| 22 | 3300005356 | Ga0070674_100033843 | Ga0070674_1000338432 | 175 |
| 23 | 3300005356 | Ga0070674_100346730 | Ga0070674_1003467302 | 175 |
| 24 | 3300005367 | Ga0070667_100336818 | Ga0070667_1003368183 | 175 |
| 25 | 3300005434 | Ga0070709_10156774 | Ga0070709_101567742 | 175 |
| 26 | 3300005439 | Ga0070711_100033655 | Ga0070711_1000336555 | 175 |
| 27 | 3300005455 | Ga0070663_100163543 | Ga0070663_1001635433 | 175 |
| 28 | 3300005578 | Ga0068854_100136535 | Ga0068854_1001365353 | 175 |
| 29 | 3300005841 | Ga0068863_100868889 | Ga0068863_1008688892 | 175 |
| 30 | 3300005843 | Ga0068860_100120557 | Ga0068860_1001205573 | 175 |
| 31 | 3300006175 | Ga0070712_100009052 | Ga0070712_1000090527 | 175 |
| 32 | 3300006881 | Ga0068865_100170084 | Ga0068865_1001700842 | 175 |
| 33 | 3300009176 | Ga0105242_10327371 | Ga0105242_103273712 | 175 |
| 34 | 3300025907 | Ga0207645_10161172 | Ga0207645_101611721 | 175 |
| 35 | 3300025915 | Ga0207693_10030889 | Ga0207693_100308892 | 175 |
| 36 | 3300025916 | Ga0207663_10030257 | Ga0207663_100302573 | 175 |
| 37 | 3300025923 | Ga0207681_10377554 | Ga0207681_103775542 | 175 |
| 38 | 3300025933 | Ga0207706_10284367 | Ga0207706_102843672 | 175 |
| 39 | 3300025933 | Ga0207706_10650473 | Ga0207706_106504732 | 175 |
| 40 | 3300025935 | Ga0207709_10321767 | Ga0207709_103217672 | 175 |
| 41 | 3300025937 | Ga0207669_10669734 | Ga0207669_106697342 | 175 |
| 42 | 3300025937 | Ga0207669_10703340 | Ga0207669_107033402 | 175 |
| 43 | 3300026023 | Ga0207677_10556571 | Ga0207677_105565712 | 175 |
| 44 | 3300026088 | Ga0207641_10691359 | Ga0207641_106913592 | 175 |
| 45 | 3300028381 | Ga0268264_10400603 | Ga0268264_104006032 | 175 |
| 46 | 3300042438 | Ga0439459_0083429 | Ga0439459_0083429_13_612 | 175 |
| 47 | 3300048903 | Ga0496100_0007356 | Ga0496100_0007356_818_1432 | 175 |
| 48 | 3300048904 | Ga0496101_0189476 | Ga0496101_0189476_212_826 | 175 |
| 49 | 3300048909 | Ga0496106_0034749 | Ga0496106_0034749_177_791 | 175 |
| 50 | 3300048910 | Ga0496107_0170694 | Ga0496107_0170694_313_927 | 175 |
| 51 | 3300048918 | Ga0496115_0080729 | Ga0496115_0080729_624_1238 | 175 |
| 52 | 3300049578 | Ga0501042_0643226 | Ga0501042_0643226_139_756 | 175 |
| 53 | 3300049581 | Ga0501047_0439459 | Ga0501047_0439459_64_684 | 175 |
| 54 | 3300049583 | Ga0501067_0008588 | Ga0501067_0008588_348_971 | 175 |
| 55 | 3300049588 | Ga0501072_0394424 | Ga0501072_0394424_457_1080 | 175 |
| 56 | 3300049588 | Ga0501072_0543459 | Ga0501072_0543459_241_855 | 175 |
| 57 | 3300049589 | Ga0501073_0007746 | Ga0501073_0007746_649_1269 | 175 |
| 58 | 3300049589 | Ga0501073_0009620 | Ga0501073_0009620_5743_6363 | 175 |
| 59 | 3300049589 | Ga0501073_0021812 | Ga0501073_0021812_3225_3848 | 175 |
| 60 | 3300049590 | Ga0501074_0065773 | Ga0501074_0065773_151_774 | 175 |
| 61 | 3300049590 | Ga0501074_0299228 | Ga0501074_0299228_95_715 | 175 |
| 62 | 3300049592 | Ga0501076_0056621 | Ga0501076_0056621_1252_1875 | 175 |
| 63 | 3300049593 | Ga0501077_0113321 | Ga0501077_0113321_877_1491 | 175 |
| 64 | 3300049742 | Ga0501080_0518287 | Ga0501080_0518287_82_702 | 175 |
| 65 | 3300049744 | Ga0501083_0006225 | Ga0501083_0006225_2110_2733 | 175 |
| 66 | 3300049823 | Ga0501044_0461453 | Ga0501044_0461453_307_906 | 175 |
| 67 | 3300054114 | Ga0501084_0047195 | Ga0501084_0047195_1649_2263 | 175 |
| 68 | 3300054114 | Ga0501084_0076233 | Ga0501084_0076233_2088_2711 | 175 |
| 69 | 3300060353 | Ga0501082_0153811 | Ga0501082_0153811_10_624 | 175 |
| 70 | 3300061734 | Ga0530510_0334843 | Ga0530510_0334843_393_1010 | 175 |
| 71 | 3300005293 | Ga0065715_10005719 | Ga0065715_100057194 | 176 |
| 72 | 3300005468 | Ga0070707_100120568 | Ga0070707_1001205683 | 176 |
| 73 | 3300005548 | Ga0070665_100321500 | Ga0070665_1003215002 | 176 |
| 74 | 3300005549 | Ga0070704_100434164 | Ga0070704_1004341641 | 176 |
| 75 | 3300009101 | Ga0105247_10803216 | Ga0105247_108032161 | 176 |
| 76 | 3300025922 | Ga0207646_10203144 | Ga0207646_102031443 | 176 |
| 77 | 3300028577 | Ga0265318_10023853 | Ga0265318_100238531 | 176 |
| 78 | 3300046455 | Ga0495603_0271063 | Ga0495603_0271063_340_942 | 176 |
| 79 | 3300050512 | nmdc:mga0n895_708063_c1 | nmdc:mga0n895_708063_c1_204_806 | 176 |
| 80 | 3300053142 | Ga0500577_0044881 | Ga0500577_0044881_263_865 | 176 |
| 81 | 3300005438 | Ga0070701_10130508 | Ga0070701_101305083 | 177 |
| 82 | 3300005445 | Ga0070708_100349796 | Ga0070708_1003497962 | 177 |
| 83 | 3300005719 | Ga0068861_100379318 | Ga0068861_1003793181 | 177 |
| 84 | 3300006844 | Ga0075428_100195925 | Ga0075428_1001959252 | 177 |
| 85 | 3300009177 | Ga0105248_10938085 | Ga0105248_109380852 | 177 |
| 86 | 3300010375 | Ga0105239_10495319 | Ga0105239_104953192 | 177 |
| 87 | 3300025914 | Ga0207671_10210281 | Ga0207671_102102811 | 177 |
| 88 | 3300028794 | Ga0307515_10134875 | Ga0307515_101348753 | 177 |
| 89 | 3300031251 | Ga0265327_10003742 | Ga0265327_1000374216 | 177 |
| 90 | 3300031344 | Ga0265316_10090832 | Ga0265316_100908322 | 177 |
| 91 | 3300035083 | Ga0373926_0128895 | Ga0373926_0128895_294_908 | 177 |
| 92 | 3300035171 | Ga0373946_0091112 | Ga0373946_0091112_518_1132 | 177 |
| 93 | 3300035695 | Ga0373927_0090397 | Ga0373927_0090397_367_981 | 177 |
| 94 | 3300035725 | Ga0373947_0011058 | Ga0373947_0011058_4088_4702 | 177 |
| 95 | 3300037068 | Ga0373925_0066579 | Ga0373925_0066579_415_1029 | 177 |
| 96 | 3300046455 | Ga0495603_0059484 | Ga0495603_0059484_92_706 | 177 |
| 97 | 3300046472 | Ga0495580_0458008 | Ga0495580_0458008_66_680 | 177 |
| 98 | 3300046475 | Ga0495639_0143943 | Ga0495639_0143943_251_865 | 177 |
| 99 | 3300046522 | Ga0495643_0163879 | Ga0495643_0163879_345_947 | 177 |
| 100 | 3300046683 | Ga0495658_0532031 | Ga0495658_0532031_111_725 | 177 |
| 101 | 3300048908 | Ga0496105_0322948 | Ga0496105_0322948_209_811 | 177 |
| 102 | 3300048913 | Ga0496110_0031842 | Ga0496110_0031842_2298_2900 | 177 |
| 103 | 3300048914 | Ga0496111_0010126 | Ga0496111_0010126_3478_4080 | 177 |
| 104 | 3300048915 | Ga0496112_0116204 | Ga0496112_0116204_1690_2292 | 177 |
| 105 | 3300048924 | Ga0496121_0292374 | Ga0496121_0292374_204_815 | 177 |
| 106 | 3300048925 | Ga0496122_0086474 | Ga0496122_0086474_1470_2072 | 177 |
| 107 | 3300048927 | Ga0496124_0338781 | Ga0496124_0338781_200_802 | 177 |
| 108 | 3300049573 | Ga0501037_0112906 | Ga0501037_0112906_928_1533 | 177 |
| 109 | 3300050492 | nmdc:mga0yw44_182621_c1 | nmdc:mga0yw44_182621_c1_208_810 | 177 |
| 110 | 3300050516 | nmdc:mga0sz30_14893_c1 | nmdc:mga0sz30_14893_c1_1513_2115 | 177 |
| 111 | 3300053177 | Ga0500636_0006447 | Ga0500636_0006447_3654_4256 | 177 |
| 112 | 3300005468 | Ga0070707_100030062 | Ga0070707_1000300625 | 178 |
| 113 | 3300005471 | Ga0070698_100167105 | Ga0070698_1001671053 | 178 |
| 114 | 3300005518 | Ga0070699_100397753 | Ga0070699_1003977532 | 178 |
| 115 | 3300005617 | Ga0068859_100057158 | Ga0068859_1000571583 | 178 |
| 116 | 3300005842 | Ga0068858_100124492 | Ga0068858_1001244924 | 178 |
| 117 | 3300006931 | Ga0097620_100057158 | Ga0097620_1000571584 | 178 |
| 118 | 3300009101 | Ga0105247_10017850 | Ga0105247_100178502 | 178 |
| 119 | 3300009545 | Ga0105237_10186225 | Ga0105237_101862252 | 178 |
| 120 | 3300026035 | Ga0207703_10169742 | Ga0207703_101697422 | 178 |
| 121 | 3300036401 | Ga0373937_0142097 | Ga0373937_0142097_1499_2119 | 178 |
| 122 | 3300037471 | Ga0395905_0395201 | Ga0395905_0395201_35_661 | 178 |
| 123 | 3300039437 | Ga0436365_0946825 | Ga0436365_0946825_35_646 | 178 |
| 124 | 3300046454 | Ga0495592_0090304 | Ga0495592_0090304_736_1356 | 178 |
| 125 | 3300046511 | Ga0495608_0339204 | Ga0495608_0339204_144_764 | 178 |
| 126 | 3300046678 | Ga0495599_0224931 | Ga0495599_0224931_165_785 | 178 |
| 127 | 3300031344 | Ga0265316_10155940 | Ga0265316_101559404 | 179 |
| 128 | 3300003323 | rootH1_10026210 | rootH1_100262102 | 180 |
| 129 | 3300003659 | JGI25404J52841_10006282 | JGI25404J52841_100062822 | 180 |
| 130 | 3300003659 | JGI25404J52841_10008949 | JGI25404J52841_100089494 | 180 |
| 131 | 3300005327 | Ga0070658_10084121 | Ga0070658_100841213 | 180 |
| 132 | 3300005329 | Ga0070683_100032630 | Ga0070683_1000326306 | 180 |
| 133 | 3300005336 | Ga0070680_100032603 | Ga0070680_1000326033 | 180 |
| 134 | 3300005336 | Ga0070680_100845803 | Ga0070680_1008458032 | 180 |
| 135 | 3300005339 | Ga0070660_100067269 | Ga0070660_1000672693 | 180 |
| 136 | 3300005434 | Ga0070709_10015330 | Ga0070709_100153302 | 180 |
| 137 | 3300005434 | Ga0070709_10116521 | Ga0070709_101165212 | 180 |
| 138 | 3300005435 | Ga0070714_100100930 | Ga0070714_1001009303 | 180 |
| 139 | 3300005435 | Ga0070714_100578725 | Ga0070714_1005787252 | 180 |
| 140 | 3300005435 | Ga0070714_100805612 | Ga0070714_1008056122 | 180 |
| 141 | 3300005436 | Ga0070713_100014695 | Ga0070713_1000146953 | 180 |
| 142 | 3300005436 | Ga0070713_100019136 | Ga0070713_1000191364 | 180 |
| 143 | 3300005436 | Ga0070713_100026782 | Ga0070713_1000267825 | 180 |
| 144 | 3300005436 | Ga0070713_100038640 | Ga0070713_1000386402 | 180 |
| 145 | 3300005436 | Ga0070713_100737717 | Ga0070713_1007377171 | 180 |
| 146 | 3300005437 | Ga0070710_10003768 | Ga0070710_100037685 | 180 |
| 147 | 3300005437 | Ga0070710_10282089 | Ga0070710_102820892 | 180 |
| 148 | 3300005439 | Ga0070711_100021603 | Ga0070711_1000216035 | 180 |
| 149 | 3300005439 | Ga0070711_100164139 | Ga0070711_1001641391 | 180 |
| 150 | 3300005444 | Ga0070694_100202531 | Ga0070694_1002025312 | 180 |
| 151 | 3300005456 | Ga0070678_100251476 | Ga0070678_1002514762 | 180 |
| 152 | 3300005457 | Ga0070662_100256580 | Ga0070662_1002565802 | 180 |
| 153 | 3300005458 | Ga0070681_10281845 | Ga0070681_102818452 | 180 |
| 154 | 3300005467 | Ga0070706_100438436 | Ga0070706_1004384363 | 180 |
| 155 | 3300005467 | Ga0070706_100457862 | Ga0070706_1004578622 | 180 |
| 156 | 3300005468 | Ga0070707_101034868 | Ga0070707_1010348681 | 180 |
| 157 | 3300005471 | Ga0070698_100096790 | Ga0070698_1000967902 | 180 |
| 158 | 3300005471 | Ga0070698_100233199 | Ga0070698_1002331992 | 180 |
| 159 | 3300005471 | Ga0070698_100438702 | Ga0070698_1004387022 | 180 |
| 160 | 3300005530 | Ga0070679_100056648 | Ga0070679_1000566484 | 180 |
| 161 | 3300005535 | Ga0070684_100003618 | Ga0070684_1000036186 | 180 |
| 162 | 3300005539 | Ga0068853_100040370 | Ga0068853_1000403705 | 180 |
| 163 | 3300005563 | Ga0068855_100220273 | Ga0068855_1002202733 | 180 |
| 164 | 3300005577 | Ga0068857_100053523 | Ga0068857_1000535233 | 180 |
| 165 | 3300005834 | Ga0068851_10004499 | Ga0068851_100044994 | 180 |
| 166 | 3300005937 | Ga0081455_10005782 | Ga0081455_100057827 | 180 |
| 167 | 3300005983 | Ga0081540_1000195 | Ga0081540_100019522 | 180 |
| 168 | 3300005983 | Ga0081540_1007955 | Ga0081540_10079552 | 180 |
| 169 | 3300006028 | Ga0070717_10005856 | Ga0070717_100058569 | 180 |
| 170 | 3300006173 | Ga0070716_100282603 | Ga0070716_1002826032 | 180 |
| 171 | 3300006175 | Ga0070712_100003703 | Ga0070712_1000037036 | 180 |
| 172 | 3300006175 | Ga0070712_100171990 | Ga0070712_1001719902 | 180 |
| 173 | 3300006852 | Ga0075433_10247508 | Ga0075433_102475083 | 180 |
| 174 | 3300006871 | Ga0075434_100096581 | Ga0075434_1000965813 | 180 |
| 175 | 3300006914 | Ga0075436_100691279 | Ga0075436_1006912792 | 180 |
| 176 | 3300007076 | Ga0075435_100234381 | Ga0075435_1002343813 | 180 |
| 177 | 3300007265 | Ga0099794_10002417 | Ga0099794_100024177 | 180 |
| 178 | 3300007265 | Ga0099794_10131585 | Ga0099794_101315852 | 180 |
| 179 | 3300007265 | Ga0099794_10212654 | Ga0099794_102126542 | 180 |
| 180 | 3300007788 | Ga0099795_10004316 | Ga0099795_100043162 | 180 |
| 181 | 3300007788 | Ga0099795_10038028 | Ga0099795_100380281 | 180 |
| 182 | 3300009093 | Ga0105240_10031202 | Ga0105240_100312026 | 180 |
| 183 | 3300009545 | Ga0105237_10017035 | Ga0105237_100170356 | 180 |
| 184 | 3300009551 | Ga0105238_10018874 | Ga0105238_100188748 | 180 |
| 185 | 3300009553 | Ga0105249_10549442 | Ga0105249_105494422 | 180 |
| 186 | 3300010159 | Ga0099796_10063509 | Ga0099796_100635092 | 180 |
| 187 | 3300010375 | Ga0105239_10391701 | Ga0105239_103917012 | 180 |
| 188 | 3300013100 | Ga0157373_10620508 | Ga0157373_106205082 | 180 |
| 189 | 3300013104 | Ga0157370_10057819 | Ga0157370_100578193 | 180 |
| 190 | 3300013105 | Ga0157369_10047093 | Ga0157369_100470934 | 180 |
| 191 | 3300014325 | Ga0163163_10441736 | Ga0163163_104417363 | 180 |
| 192 | 3300014497 | Ga0182008_10243659 | Ga0182008_102436592 | 180 |
| 193 | 3300021377 | Ga0213874_10017590 | Ga0213874_100175902 | 180 |
| 194 | 3300021384 | Ga0213876_10076837 | Ga0213876_100768372 | 180 |
| 195 | 3300021384 | Ga0213876_10151302 | Ga0213876_101513021 | 180 |
| 196 | 3300025321 | Ga0207656_10004948 | Ga0207656_100049486 | 180 |
| 197 | 3300025898 | Ga0207692_10052094 | Ga0207692_100520941 | 180 |
| 198 | 3300025906 | Ga0207699_10010746 | Ga0207699_100107462 | 180 |
| 199 | 3300025906 | Ga0207699_10021067 | Ga0207699_100210673 | 180 |
| 200 | 3300025906 | Ga0207699_10092999 | Ga0207699_100929994 | 180 |
| 201 | 3300025909 | Ga0207705_10063917 | Ga0207705_100639173 | 180 |
| 202 | 3300025910 | Ga0207684_10132478 | Ga0207684_101324784 | 180 |
| 203 | 3300025912 | Ga0207707_10001229 | Ga0207707_1000122920 | 180 |
| 204 | 3300025913 | Ga0207695_10128881 | Ga0207695_101288813 | 180 |
| 205 | 3300025914 | Ga0207671_10103726 | Ga0207671_101037263 | 180 |
| 206 | 3300025915 | Ga0207693_10006645 | Ga0207693_100066457 | 180 |
| 207 | 3300025915 | Ga0207693_10131799 | Ga0207693_101317992 | 180 |
| 208 | 3300025915 | Ga0207693_10136073 | Ga0207693_101360732 | 180 |
| 209 | 3300025915 | Ga0207693_10258482 | Ga0207693_102584822 | 180 |
| 210 | 3300025916 | Ga0207663_10213989 | Ga0207663_102139892 | 180 |
| 211 | 3300025916 | Ga0207663_10367173 | Ga0207663_103671732 | 180 |
| 212 | 3300025917 | Ga0207660_10007648 | Ga0207660_100076489 | 180 |
| 213 | 3300025919 | Ga0207657_10000658 | Ga0207657_1000065837 | 180 |
| 214 | 3300025921 | Ga0207652_10005888 | Ga0207652_100058883 | 180 |
| 215 | 3300025922 | Ga0207646_10069582 | Ga0207646_100695823 | 180 |
| 216 | 3300025924 | Ga0207694_10113636 | Ga0207694_101136362 | 180 |
| 217 | 3300025924 | Ga0207694_10387160 | Ga0207694_103871602 | 180 |
| 218 | 3300025924 | Ga0207694_10563644 | Ga0207694_105636441 | 180 |
| 219 | 3300025928 | Ga0207700_10053923 | Ga0207700_100539234 | 180 |
| 220 | 3300025928 | Ga0207700_10133916 | Ga0207700_101339162 | 180 |
| 221 | 3300025928 | Ga0207700_10155650 | Ga0207700_101556501 | 180 |
| 222 | 3300025928 | Ga0207700_10160945 | Ga0207700_101609453 | 180 |
| 223 | 3300025929 | Ga0207664_10317079 | Ga0207664_103170792 | 180 |
| 224 | 3300025929 | Ga0207664_10440981 | Ga0207664_104409811 | 180 |
| 225 | 3300025933 | Ga0207706_10658763 | Ga0207706_106587631 | 180 |
| 226 | 3300025939 | Ga0207665_10017888 | Ga0207665_100178884 | 180 |
| 227 | 3300025939 | Ga0207665_10148109 | Ga0207665_101481092 | 180 |
| 228 | 3300025939 | Ga0207665_10247941 | Ga0207665_102479411 | 180 |
| 229 | 3300025939 | Ga0207665_10352235 | Ga0207665_103522352 | 180 |
| 230 | 3300025945 | Ga0207679_10442117 | Ga0207679_104421172 | 180 |
| 231 | 3300026078 | Ga0207702_11253845 | Ga0207702_112538451 | 180 |
| 232 | 3300026095 | Ga0207676_10142181 | Ga0207676_101421814 | 180 |
| 233 | 3300026116 | Ga0207674_10205570 | Ga0207674_102055703 | 180 |
| 234 | 3300027512 | Ga0209179_1042938 | Ga0209179_10429382 | 180 |
| 235 | 3300027671 | Ga0209588_1002345 | Ga0209588_10023456 | 180 |
| 236 | 3300027671 | Ga0209588_1071634 | Ga0209588_10716342 | 180 |
| 237 | 3300031595 | Ga0265313_10157457 | Ga0265313_101574572 | 180 |
| 238 | 3300035086 | Ga0373934_0091050 | Ga0373934_0091050_522_1136 | 180 |
| 239 | 3300035089 | Ga0373944_0081222 | Ga0373944_0081222_22_636 | 180 |
| 240 | 3300035111 | Ga0373923_0019533 | Ga0373923_0019533_1720_2334 | 180 |
| 241 | 3300035112 | Ga0373932_0161023 | Ga0373932_0161023_127_741 | 180 |
| 242 | 3300035117 | Ga0373953_0023957 | Ga0373953_0023957_944_1558 | 180 |
| 243 | 3300035117 | Ga0373953_0076046 | Ga0373953_0076046_607_1263 | 180 |
| 244 | 3300035118 | Ga0373954_0269383 | Ga0373954_0269383_119_733 | 180 |
| 245 | 3300035119 | Ga0373956_0296823 | Ga0373956_0296823_52_708 | 180 |
| 246 | 3300035120 | Ga0373957_0057153 | Ga0373957_0057153_355_1011 | 180 |
| 247 | 3300035170 | Ga0373943_0046922 | Ga0373943_0046922_1161_1772 | 180 |
| 248 | 3300035172 | Ga0373955_0122755 | Ga0373955_0122755_512_1126 | 180 |
| 249 | 3300035410 | Ga0373924_0066855 | Ga0373924_0066855_785_1399 | 180 |
| 250 | 3300035691 | Ga0373931_0326670 | Ga0373931_0326670_21_635 | 180 |
| 251 | 3300035692 | Ga0373935_0052870 | Ga0373935_0052870_1452_2066 | 180 |
| 252 | 3300035692 | Ga0373935_0382067 | Ga0373935_0382067_290_904 | 180 |
| 253 | 3300035695 | Ga0373927_0005809 | Ga0373927_0005809_5591_6205 | 180 |
| 254 | 3300035695 | Ga0373927_0156581 | Ga0373927_0156581_210_824 | 180 |
| 255 | 3300035724 | Ga0373933_0000225 | Ga0373933_0000225_12000_12614 | 180 |
| 256 | 3300035724 | Ga0373933_0077785 | Ga0373933_0077785_285_899 | 180 |
| 257 | 3300035725 | Ga0373947_0047924 | Ga0373947_0047924_340_954 | 180 |
| 258 | 3300035725 | Ga0373947_0140595 | Ga0373947_0140595_285_941 | 180 |
| 259 | 3300037068 | Ga0373925_0010306 | Ga0373925_0010306_119_733 | 180 |
| 260 | 3300037853 | Ga0436364_0318332 | Ga0436364_0318332_189_803 | 180 |
| 261 | 3300039437 | Ga0436365_0395291 | Ga0436365_0395291_55_669 | 180 |
| 262 | 3300039437 | Ga0436365_0822362 | Ga0436365_0822362_873_1487 | 180 |
| 263 | 3300039437 | Ga0436365_1246958 | Ga0436365_1246958_752_1366 | 180 |
| 264 | 3300039450 | Ga0436363_0657874 | Ga0436363_0657874_3068_3682 | 180 |
| 265 | 3300039450 | Ga0436363_1534966 | Ga0436363_1534966_1479_2093 | 180 |
| 266 | 3300044842 | Ga0466957_0013299 | Ga0466957_0013299_1470_2084 | 180 |
| 267 | 3300045049 | Ga0466959_0022097 | Ga0466959_0022097_2757_3371 | 180 |
| 268 | 3300045976 | Ga0466967_0479187 | Ga0466967_0479187_480_1094 | 180 |
| 269 | 3300046454 | Ga0495592_0075891 | Ga0495592_0075891_1411_2025 | 180 |
| 270 | 3300046455 | Ga0495603_0292614 | Ga0495603_0292614_204_818 | 180 |
| 271 | 3300046472 | Ga0495580_0034398 | Ga0495580_0034398_2936_3550 | 180 |
| 272 | 3300046473 | Ga0495582_0137715 | Ga0495582_0137715_298_912 | 180 |
| 273 | 3300046473 | Ga0495582_0199424 | Ga0495582_0199424_136_750 | 180 |
| 274 | 3300046475 | Ga0495639_0012761 | Ga0495639_0012761_2835_3449 | 180 |
| 275 | 3300046476 | Ga0495662_0019210 | Ga0495662_0019210_1549_2163 | 180 |
| 276 | 3300046477 | Ga0495664_0037562 | Ga0495664_0037562_425_1039 | 180 |
| 277 | 3300046499 | Ga0495594_0067092 | Ga0495594_0067092_681_1295 | 180 |
| 278 | 3300046499 | Ga0495594_0089717 | Ga0495594_0089717_1080_1691 | 180 |
| 279 | 3300046514 | Ga0495618_0083373 | Ga0495618_0083373_759_1373 | 180 |
| 280 | 3300046514 | Ga0495618_0099079 | Ga0495618_0099079_309_923 | 180 |
| 281 | 3300046517 | Ga0495630_0350655 | Ga0495630_0350655_136_750 | 180 |
| 282 | 3300046529 | Ga0495652_0406422 | Ga0495652_0406422_296_910 | 180 |
| 283 | 3300046531 | Ga0495665_0032226 | Ga0495665_0032226_2069_2683 | 180 |
| 284 | 3300046533 | Ga0495640_0087931 | Ga0495640_0087931_1099_1713 | 180 |
| 285 | 3300046642 | Ga0495634_0005118 | Ga0495634_0005118_3379_3993 | 180 |
| 286 | 3300046663 | Ga0495635_0185202 | Ga0495635_0185202_616_1230 | 180 |
| 287 | 3300046683 | Ga0495658_0011638 | Ga0495658_0011638_3741_4355 | 180 |
| 288 | 3300046689 | Ga0495613_0126090 | Ga0495613_0126090_1089_1703 | 180 |
| 289 | 3300046690 | Ga0495624_0335437 | Ga0495624_0335437_216_830 | 180 |
| 290 | 3300046794 | Ga0495589_0190133 | Ga0495589_0190133_77_691 | 180 |
| 291 | 3300047315 | Ga0495581_0239179 | Ga0495581_0239179_33_647 | 180 |
| 292 | 3300047317 | Ga0495604_0035914 | Ga0495604_0035914_2901_3515 | 180 |
| 293 | 3300047319 | Ga0495674_0016093 | Ga0495674_0016093_5439_6053 | 180 |
| 294 | 3300047319 | Ga0495674_0233620 | Ga0495674_0233620_429_1043 | 180 |
| 295 | 3300047444 | Ga0495675_0414265 | Ga0495675_0414265_119_733 | 180 |
| 296 | 3300047471 | Ga0495684_0002075 | Ga0495684_0002075_11627_12241 | 180 |
| 297 | 3300047673 | Ga0495593_0016513 | Ga0495593_0016513_2391_3002 | 180 |
| 298 | 3300048905 | Ga0496102_0031230 | Ga0496102_0031230_3359_3973 | 180 |
| 299 | 3300048909 | Ga0496106_0028680 | Ga0496106_0028680_2724_3338 | 180 |
| 300 | 3300048910 | Ga0496107_0362043 | Ga0496107_0362043_199_813 | 180 |
| 301 | 3300048911 | Ga0496108_0620496 | Ga0496108_0620496_101_715 | 180 |
| 302 | 3300048912 | Ga0496109_0118164 | Ga0496109_0118164_875_1489 | 180 |
| 303 | 3300048912 | Ga0496109_0388440 | Ga0496109_0388440_529_1143 | 180 |
| 304 | 3300048912 | Ga0496109_0422748 | Ga0496109_0422748_597_1211 | 180 |
| 305 | 3300048913 | Ga0496110_0017067 | Ga0496110_0017067_250_864 | 180 |
| 306 | 3300048914 | Ga0496111_0195316 | Ga0496111_0195316_831_1445 | 180 |
| 307 | 3300048915 | Ga0496112_0026585 | Ga0496112_0026585_3629_4243 | 180 |
| 308 | 3300048915 | Ga0496112_0074531 | Ga0496112_0074531_2010_2624 | 180 |
| 309 | 3300048916 | Ga0496113_0134418 | Ga0496113_0134418_66_680 | 180 |
| 310 | 3300048916 | Ga0496113_1009080 | Ga0496113_1009080_11_625 | 180 |
| 311 | 3300048929 | Ga0496126_0012615 | Ga0496126_0012615_3372_3986 | 180 |
| 312 | 3300048929 | Ga0496126_0192338 | Ga0496126_0192338_612_1226 | 180 |
| 313 | 3300048929 | Ga0496126_0233836 | Ga0496126_0233836_559_1173 | 180 |
| 314 | 3300048929 | Ga0496126_0333502 | Ga0496126_0333502_603_1217 | 180 |
| 315 | 3300050512 | nmdc:mga0n895_15949_c1 | nmdc:mga0n895_15949_c1_4915_5541 | 180 |
| 316 | 3300050513 | nmdc:mga0rr50_384118_c1 | nmdc:mga0rr50_384118_c1_367_981 | 180 |
| 317 | 3300050514 | nmdc:mga08x19_21747_c1 | nmdc:mga08x19_21747_c1_46_672 | 180 |
| 318 | 3300050515 | nmdc:mga0a205_281532_c1 | nmdc:mga0a205_281532_c1_322_936 | 180 |
| 319 | 3300053077 | Ga0495601_0202805 | Ga0495601_0202805_488_1144 | 180 |
| 320 | 3300053078 | Ga0495612_0245975 | Ga0495612_0245975_76_690 | 180 |
| 321 | 3300053085 | Ga0495619_0136571 | Ga0495619_0136571_547_1161 | 180 |
| 322 | 3300061719 | Ga0466962_0035044 | Ga0466962_0035044_1159_1773 | 180 |
| 323 | iso_pu_bacteria | 2522572158 | 2523102613 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pnl-assembly1.cif.gz_B | crystal structure of e.coli dha kinase dhak-dhal complex | 0.8872 | 2 | 175 |
| 3pnl-assembly1.cif.gz_B | crystal structure of e.coli dha kinase dhak-dhal complex | 0.8559 | 2 | 175 |
| 3cr3-assembly1.cif.gz_A | structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis | 0.8204 | 8 | 175 |
| 1un8-assembly1.cif.gz_B | crystal structure of the dihydroxyacetone kinase of c. freundii (native form) | 0.82 | 5 | 174 |
| 1un9-assembly1.cif.gz_B | crystal structure of the dihydroxyacetone kinase from c. freundii in complex with amp-pnp and mg2+ | 0.8084 | 5 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lrzB00 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain | 0.8897 | 3 | 177 | 1.25.40.340 |
| af_I1L409_384_593_1.25.40.340 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain | 0.8819 | 3 | 177 | 1.25.40.340 |
| af_F1Q8Q6_370_576_1.25.40.340 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain | 0.8795 | 4 | 177 | 1.25.40.340 |
| af_Q6ASW3_381_587_1.25.40.340 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain | 0.8741 | 6 | 177 | 1.25.40.340 |
| af_P43550_380_589_1.25.40.340 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain | 0.8695 | 3 | 175 | 1.25.40.340 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536ZHI2-F1-model_v4 | Dihydroxyacetone kinase subunit L | 0.9599 | 3 | 140 |
GO:0004371
GO:0005829 GO:0019563 |
| AF-A0A833G3C4-F1-model_v4 | Dihydroxyacetone kinase subunit L | 0.9536 | 2 | 121 |
GO:0004371
GO:0005829 GO:0019563 |
| AF-A0A4R3MAW7-F1-model_v4 | Dihydroxyacetone kinase DhaL subunit | 0.9359 | 3 | 176 |
GO:0004371
GO:0005829 GO:0019563 |
| AF-A0A1N6LCV1-F1-model_v4 | deleted | 0.9357 | 1 | 180 |
|
| AF-A0A435Y6I6-F1-model_v4 | Dihydroxyacetone kinase subunit L | 0.9325 | 7 | 111 |
GO:0004371
GO:0005829 GO:0019563 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar