F406977

General Info

Members Datasets Scaffolds Average Seq Length
323 218 319 201

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10155940|Ga0265316_101559404
Length 219
Sequence MDQALQKRLIEAVASTVIAHADELTSLDSAIGDGDHGLNMKRGFTEVMADVDGLAAKPLPDALRAIGTKLVMKIGGASGPLYGTLFLTLGKEIADPPTASDAARAFGVAVAAVMARGKSEPGQKTMLDVLAPTQAELAAGGDDLLARLKSRAAASAEATVPMRAIRGRASFLGERSVGHMDPGARSSWLMIEAVCDVLAHVPAKWTPVRRQEHAPLKDV

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2818991467 Bosea vestrisii 3192 Isolate Unclassified
3 2851182111 Bosea sp. Tri-44 Isolate Nodule
4 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.86
Nodule 0.31
Rhizoplane 6.81
Rhizosphere 84.52
Stem 0
Stem Tuber 0
Unclassified 6.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10026210 3300003323 Bacteria 1546
2 JGI25404J52841_10006282 3300003659 Bacteria 2481
3 JGI25404J52841_10008949 3300003659 Bacteria 2139
4 Ga0065715_10005719 3300005293 Bacteria 4176
5 Ga0070658_10084121 3300005327 Bacteria 2616
6 Ga0070676_10095213 3300005328 Bacteria 1831
7 Ga0070683_100032630 3300005329 Bacteria 4742
8 Ga0068869_100298469 3300005334 Bacteria 1300
9 Ga0070680_100032603 3300005336 Bacteria 4194
10 Ga0070680_100845803 3300005336 Bacteria 789
11 Ga0070660_100067269 3300005339 Bacteria 2791
12 Ga0070669_100107524 3300005353 Bacteria 2113
13 Ga0070674_100033843 3300005356 Bacteria 3406
14 Ga0070674_100346730 3300005356 Bacteria 1198
15 Ga0070667_100336818 3300005367 Bacteria 1364
16 Ga0070709_10015330 3300005434 Bacteria 4359
17 Ga0070709_10116521 3300005434 Bacteria 1804
18 Ga0070709_10156774 3300005434 Bacteria 1579
19 Ga0070714_100100930 3300005435 Bacteria 2542
20 Ga0070714_100143638 3300005435 Bacteria 2144
21 Ga0070714_100578725 3300005435 Bacteria 1077
22 Ga0070714_100805612 3300005435 Bacteria 910
23 Ga0070713_100014695 3300005436 Bacteria 5823
24 Ga0070713_100019136 3300005436 Bacteria 5219
25 Ga0070713_100026782 3300005436 Bacteria 4532
26 Ga0070713_100038640 3300005436 Bacteria 3869
27 Ga0070713_100737717 3300005436 Bacteria 942
28 Ga0070710_10003768 3300005437 Bacteria 7171
29 Ga0070710_10282089 3300005437 Bacteria 1078
30 Ga0070701_10130508 3300005438 Bacteria 1427
31 Ga0070711_100021603 3300005439 Bacteria 4164
32 Ga0070711_100033655 3300005439 Bacteria 3413
33 Ga0070711_100164139 3300005439 Bacteria 1686
34 Ga0070694_100202531 3300005444 Bacteria 1480
35 Ga0070708_100349796 3300005445 Bacteria 1393
36 Ga0070663_100163543 3300005455 Bacteria 1715
37 Ga0070678_100251476 3300005456 Bacteria 1482
38 Ga0070662_100256580 3300005457 Bacteria 1407
39 Ga0070681_10281845 3300005458 Bacteria 1572
40 Ga0070706_100061621 3300005467 Bacteria 3464
41 Ga0070706_100438436 3300005467 Bacteria 1216
42 Ga0070706_100457862 3300005467 Bacteria 1187
43 Ga0070707_100030062 3300005468 Bacteria 5169
44 Ga0070707_100120568 3300005468 Bacteria 2546
45 Ga0070707_101034868 3300005468 Bacteria 787
46 Ga0070698_100096790 3300005471 Bacteria 2928
47 Ga0070698_100167105 3300005471 Bacteria 2142
48 Ga0070698_100233199 3300005471 Bacteria 1774
49 Ga0070698_100438702 3300005471 Bacteria 1241
50 Ga0070699_100008521 3300005518 Bacteria 8888
51 Ga0070699_100397753 3300005518 Bacteria 1245
52 Ga0070679_100056648 3300005530 Bacteria 3905
53 Ga0070684_100003618 3300005535 Bacteria 11636
54 Ga0068853_100040370 3300005539 Bacteria 3981
55 Ga0070665_100321500 3300005548 Bacteria 1552
56 Ga0070704_100434164 3300005549 Bacteria 1127
57 Ga0068855_100220273 3300005563 Bacteria 2128
58 Ga0068857_100053523 3300005577 Bacteria 3580
59 Ga0068854_100136535 3300005578 Bacteria 1878
60 Ga0068859_100057158 3300005617 Bacteria 3930
61 Ga0068861_100379318 3300005719 Bacteria 1249
62 Ga0068851_10004499 3300005834 Bacteria 6291
63 Ga0068863_100868889 3300005841 Bacteria 901
64 Ga0068858_100124492 3300005842 Bacteria 2413
65 Ga0068860_100120557 3300005843 Bacteria 2511
66 Ga0081455_10005782 3300005937 Bacteria 13481
67 Ga0081540_1000195 3300005983 Bacteria 62863
68 Ga0081540_1007955 3300005983 Bacteria 7473
69 Ga0070717_10005856 3300006028 Bacteria 9003
70 Ga0070717_10134531 3300006028 Bacteria 2128
71 Ga0070716_100282603 3300006173 Bacteria 1146
72 Ga0070712_100003703 3300006175 Bacteria 9420
73 Ga0070712_100009052 3300006175 Bacteria 6271
74 Ga0070712_100171990 3300006175 Bacteria 1682
75 Ga0075428_100195925 3300006844 Bacteria 2185
76 Ga0075433_10247508 3300006852 Bacteria 1582
77 Ga0075434_100096581 3300006871 Bacteria 2960
78 Ga0068865_100170084 3300006881 Bacteria 1670
79 Ga0075436_100691279 3300006914 Bacteria 755
80 Ga0097620_100057158 3300006931 Bacteria 3930
81 Ga0075435_100234381 3300007076 Bacteria 1560
82 Ga0099794_10002417 3300007265 Bacteria 6880
83 Ga0099794_10131585 3300007265 Bacteria 1263
84 Ga0099794_10212654 3300007265 Bacteria 992
85 Ga0099795_10004316 3300007788 Bacteria 3652
86 Ga0099795_10038028 3300007788 Bacteria 1697
87 Ga0105240_10031202 3300009093 Bacteria 6914
88 Ga0105247_10017850 3300009101 Bacteria 4256
89 Ga0105247_10803216 3300009101 Unclassified 718
90 Ga0105242_10327371 3300009176 Bacteria 1407
91 Ga0105248_10938085 3300009177 Bacteria 977
92 Ga0105237_10017035 3300009545 Bacteria 7544
93 Ga0105237_10186225 3300009545 Bacteria 2076
94 Ga0105238_10018874 3300009551 Bacteria 7021
95 Ga0105238_10595277 3300009551 Bacteria 1113
96 Ga0105249_10182219 3300009553 Bacteria 2044
97 Ga0105249_10549442 3300009553 Bacteria 1205
98 Ga0099796_10063509 3300010159 Bacteria 1315
99 Ga0105239_10391701 3300010375 Bacteria 1572
100 Ga0105239_10495319 3300010375 Bacteria 1389
101 Ga0157373_10620508 3300013100 Bacteria 788
102 Ga0157370_10057819 3300013104 Bacteria 3686
103 Ga0157369_10047093 3300013105 Bacteria 4684
104 Ga0163163_10441736 3300014325 Bacteria 1361
105 Ga0182008_10243659 3300014497 Bacteria 925
106 Ga0213874_10017590 3300021377 Bacteria 1919
107 Ga0213876_10076837 3300021384 Bacteria 1764
108 Ga0213876_10151302 3300021384 Bacteria 1234
109 Ga0207656_10004948 3300025321 Bacteria 4681
110 Ga0207692_10052094 3300025898 Bacteria 2078
111 Ga0207699_10010746 3300025906 Bacteria 4605
112 Ga0207699_10021067 3300025906 Bacteria 3506
113 Ga0207699_10092999 3300025906 Bacteria 1897
114 Ga0207645_10161172 3300025907 Bacteria 1468
115 Ga0207705_10063917 3300025909 Bacteria 2659
116 Ga0207684_10132478 3300025910 Bacteria 2140
117 Ga0207707_10001229 3300025912 Bacteria 24021
118 Ga0207695_10128881 3300025913 Bacteria 2489
119 Ga0207671_10103726 3300025914 Bacteria 2157
120 Ga0207671_10210281 3300025914 Bacteria 1521
121 Ga0207693_10006645 3300025915 Bacteria 9555
122 Ga0207693_10030889 3300025915 Bacteria 4231
123 Ga0207693_10131799 3300025915 Bacteria 1965
124 Ga0207693_10136073 3300025915 Bacteria 1932
125 Ga0207693_10258482 3300025915 Bacteria 1366
126 Ga0207663_10030257 3300025916 Bacteria 3192
127 Ga0207663_10213989 3300025916 Bacteria 1398
128 Ga0207663_10367173 3300025916 Bacteria 1093
129 Ga0207660_10007648 3300025917 Bacteria 6997
130 Ga0207657_10000658 3300025919 Bacteria 36762
131 Ga0207652_10005888 3300025921 Bacteria 9920
132 Ga0207646_10017701 3300025922 Bacteria 6659
133 Ga0207646_10069582 3300025922 Bacteria 3143
134 Ga0207646_10203144 3300025922 Bacteria 1790
135 Ga0207681_10377554 3300025923 Bacteria 1140
136 Ga0207694_10113636 3300025924 Bacteria 2156
137 Ga0207694_10387160 3300025924 Bacteria 1161
138 Ga0207694_10563644 3300025924 Bacteria 957
139 Ga0207700_10053923 3300025928 Bacteria 3015
140 Ga0207700_10133916 3300025928 Bacteria 2027
141 Ga0207700_10155650 3300025928 Bacteria 1893
142 Ga0207700_10160945 3300025928 Bacteria 1864
143 Ga0207664_10017070 3300025929 Bacteria 5309
144 Ga0207664_10317079 3300025929 Bacteria 1375
145 Ga0207664_10440981 3300025929 Bacteria 1161
146 Ga0207706_10284367 3300025933 Bacteria 1442
147 Ga0207706_10650473 3300025933 Bacteria 903
148 Ga0207706_10658763 3300025933 Bacteria 896
149 Ga0207709_10321767 3300025935 Bacteria 1158
150 Ga0207669_10669734 3300025937 Bacteria 850
151 Ga0207669_10703340 3300025937 Bacteria 831
152 Ga0207665_10017888 3300025939 Bacteria 4659
153 Ga0207665_10148109 3300025939 Bacteria 1679
154 Ga0207665_10206755 3300025939 Bacteria 1432
155 Ga0207665_10247941 3300025939 Bacteria 1315
156 Ga0207665_10352235 3300025939 Bacteria 1112
157 Ga0207679_10442117 3300025945 Bacteria 1152
158 Ga0207712_10230194 3300025961 Bacteria 1487
159 Ga0207677_10556571 3300026023 Bacteria 1000
160 Ga0207703_10169742 3300026035 Bacteria 1918
161 Ga0207702_11253845 3300026078 Bacteria 735
162 Ga0207641_10691359 3300026088 Bacteria 1004
163 Ga0207676_10142181 3300026095 Bacteria 2056
164 Ga0207674_10205570 3300026116 Bacteria 1918
165 Ga0209179_1042938 3300027512 Bacteria 955
166 Ga0209588_1002345 3300027671 Bacteria 5132
167 Ga0209588_1071634 3300027671 Bacteria 1119
168 Ga0268264_10400603 3300028381 Bacteria 1319
169 Ga0265318_10023853 3300028577 Bacteria 2434
170 Ga0307515_10134875 3300028794 Bacteria 2692
171 Ga0265327_10003742 3300031251 Bacteria 14142
172 Ga0265316_10090832 3300031344 Bacteria 2330
173 Ga0265316_10155940 3300031344 Bacteria 1709
174 Ga0265313_10157457 3300031595 Bacteria 967
175 Ga0373926_0128895 3300035083 Bacteria 957
176 Ga0373934_0091050 3300035086 Bacteria 1229
177 Ga0373944_0081222 3300035089 Bacteria 1071
178 Ga0373923_0019533 3300035111 Bacteria 2624
179 Ga0373932_0161023 3300035112 Bacteria 776
180 Ga0373953_0023957 3300035117 Bacteria 2316
181 Ga0373953_0076046 3300035117 Bacteria 1391
182 Ga0373954_0269383 3300035118 Bacteria 839
183 Ga0373956_0296823 3300035119 Bacteria 770
184 Ga0373957_0057153 3300035120 Bacteria 1504
185 Ga0373943_0046922 3300035170 Bacteria 2110
186 Ga0373946_0091112 3300035171 Bacteria 1351
187 Ga0373955_0122755 3300035172 Bacteria 1511
188 Ga0373924_0066855 3300035410 Bacteria 1511
189 Ga0373931_0326670 3300035691 Bacteria 954
190 Ga0373935_0052870 3300035692 Bacteria 2583
191 Ga0373935_0382067 3300035692 Bacteria 1009
192 Ga0373927_0005809 3300035695 Bacteria 8466
193 Ga0373927_0090397 3300035695 Bacteria 1988
194 Ga0373927_0156581 3300035695 Bacteria 1492
195 Ga0373933_0000225 3300035724 Bacteria 37547
196 Ga0373933_0077785 3300035724 Bacteria 2028
197 Ga0373947_0011058 3300035725 Bacteria 5181
198 Ga0373947_0047924 3300035725 Bacteria 2562
199 Ga0373947_0140595 3300035725 Bacteria 1548
200 Ga0373937_0142097 3300036401 Bacteria 2246
201 Ga0373925_0010306 3300037068 Bacteria 6780
202 Ga0373925_0066579 3300037068 Bacteria 2716
203 Ga0395905_0395201 3300037471 Bacteria 1277
204 Ga0436364_0318332 3300037853 Bacteria 1462
205 Ga0436365_0395291 3300039437 Bacteria 1414
206 Ga0436365_0822362 3300039437 Bacteria 2021
207 Ga0436365_0946825 3300039437 Bacteria 726
208 Ga0436365_1246958 3300039437 Bacteria 2563
209 Ga0436363_0657874 3300039450 Bacteria 5703
210 Ga0436363_1534966 3300039450 Bacteria 3243
211 Ga0439459_0083429 3300042438 Bacteria 758
212 Ga0466957_0013299 3300044842 Bacteria 4774
213 Ga0466959_0022097 3300045049 Bacteria 4700
214 Ga0466967_0479187 3300045976 Bacteria 1219
215 Ga0495592_0075891 3300046454 Bacteria 2440
216 Ga0495592_0090304 3300046454 Bacteria 2198
217 Ga0495603_0059484 3300046455 Bacteria 2259
218 Ga0495603_0271063 3300046455 Bacteria 976
219 Ga0495603_0292614 3300046455 Bacteria 935
220 Ga0495580_0034398 3300046472 Bacteria 3648
221 Ga0495580_0458008 3300046472 Bacteria 855
222 Ga0495582_0137715 3300046473 Bacteria 1382
223 Ga0495582_0199424 3300046473 Bacteria 1143
224 Ga0495639_0012761 3300046475 Bacteria 3624
225 Ga0495639_0143943 3300046475 Bacteria 1147
226 Ga0495662_0019210 3300046476 Bacteria 3306
227 Ga0495664_0037562 3300046477 Bacteria 2859
228 Ga0495594_0067092 3300046499 Bacteria 1991
229 Ga0495594_0089717 3300046499 Bacteria 1722
230 Ga0495608_0339204 3300046511 Bacteria 926
231 Ga0495618_0083373 3300046514 Bacteria 2042
232 Ga0495618_0099079 3300046514 Bacteria 1865
233 Ga0495630_0350655 3300046517 Bacteria 1129
234 Ga0495643_0163879 3300046522 Bacteria 1092
235 Ga0495652_0037628 3300046529 Bacteria 4196
236 Ga0495652_0406422 3300046529 Bacteria 963
237 Ga0495665_0032226 3300046531 Bacteria 2803
238 Ga0495640_0087931 3300046533 Bacteria 2054
239 Ga0495634_0005118 3300046642 Bacteria 10123
240 Ga0495635_0185202 3300046663 Bacteria 1414
241 Ga0495599_0224931 3300046678 Bacteria 1147
242 Ga0495658_0011638 3300046683 Bacteria 4432
243 Ga0495658_0532031 3300046683 Bacteria 752
244 Ga0495613_0126090 3300046689 Bacteria 1836
245 Ga0495624_0335437 3300046690 Bacteria 910
246 Ga0495589_0190133 3300046794 Bacteria 972
247 Ga0495581_0239179 3300047315 Bacteria 1062
248 Ga0495604_0035914 3300047317 Bacteria 3911
249 Ga0495674_0016093 3300047319 Bacteria 6980
250 Ga0495674_0233620 3300047319 Bacteria 1517
251 Ga0495675_0414265 3300047444 Bacteria 784
252 Ga0495684_0002075 3300047471 Bacteria 16100
253 Ga0495593_0016513 3300047673 Bacteria 4162
254 Ga0495602_0344145 3300048088 Bacteria 1078
255 Ga0496100_0007356 3300048903 Bacteria 6069
256 Ga0496101_0189476 3300048904 Bacteria 1587
257 Ga0496102_0031230 3300048905 Bacteria 4776
258 Ga0496105_0322948 3300048908 Bacteria 1237
259 Ga0496106_0028680 3300048909 Bacteria 4146
260 Ga0496106_0034749 3300048909 Bacteria 3767
261 Ga0496107_0170694 3300048910 Bacteria 1614
262 Ga0496107_0362043 3300048910 Bacteria 1079
263 Ga0496108_0620496 3300048911 Bacteria 941
264 Ga0496109_0118164 3300048912 Bacteria 2468
265 Ga0496109_0388440 3300048912 Bacteria 1319
266 Ga0496109_0422748 3300048912 Bacteria 1259
267 Ga0496110_0017067 3300048913 Bacteria 6068
268 Ga0496110_0031842 3300048913 Bacteria 4552
269 Ga0496111_0010126 3300048914 Bacteria 6311
270 Ga0496111_0195316 3300048914 Bacteria 1504
271 Ga0496112_0026585 3300048915 Bacteria 5573
272 Ga0496112_0074531 3300048915 Bacteria 3355
273 Ga0496112_0116204 3300048915 Bacteria 2646
274 Ga0496113_0134418 3300048916 Bacteria 1942
275 Ga0496113_1009080 3300048916 Bacteria 655
276 Ga0496115_0080729 3300048918 Bacteria 2648
277 Ga0496121_0292374 3300048924 Bacteria 1109
278 Ga0496122_0086474 3300048925 Bacteria 2157
279 Ga0496124_0338781 3300048927 Bacteria 1069
280 Ga0496126_0012615 3300048929 Bacteria 8648
281 Ga0496126_0192338 3300048929 Bacteria 1727
282 Ga0496126_0233836 3300048929 Bacteria 1539
283 Ga0496126_0333502 3300048929 Bacteria 1244
284 Ga0501034_0192558 3300049571 Bacteria 2001
285 Ga0501037_0112906 3300049573 Bacteria 1957
286 Ga0501042_0643226 3300049578 Bacteria 771
287 Ga0501047_0439459 3300049581 Bacteria 1135
288 Ga0501067_0008588 3300049583 Bacteria 5662
289 Ga0501072_0394424 3300049588 Bacteria 1098
290 Ga0501072_0543459 3300049588 Bacteria 918
291 Ga0501073_0007746 3300049589 Bacteria 7973
292 Ga0501073_0009620 3300049589 Bacteria 7129
293 Ga0501073_0021812 3300049589 Bacteria 4614
294 Ga0501074_0065773 3300049590 Bacteria 2609
295 Ga0501074_0299228 3300049590 Bacteria 1143
296 Ga0501076_0056621 3300049592 Bacteria 3112
297 Ga0501077_0113321 3300049593 Bacteria 1719
298 Ga0501080_0518287 3300049742 Bacteria 1064
299 Ga0501083_0006225 3300049744 Bacteria 8464
300 Ga0501044_0461453 3300049823 Bacteria 1176
301 nmdc:mga0yw44_182621_c1 3300050492 Bacteria 1381
302 nmdc:mga0yw44_46726_c1 3300050492 Bacteria 1666
303 nmdc:mga0n895_15949_c1 3300050512 Bacteria 6876
304 nmdc:mga0n895_708063_c1 3300050512 Bacteria 1002
305 nmdc:mga0rr50_384118_c1 3300050513 Bacteria 1184
306 nmdc:mga08x19_21747_c1 3300050514 Bacteria 761
307 nmdc:mga0a205_281532_c1 3300050515 Bacteria 1538
308 nmdc:mga0sz30_14893_c1 3300050516 Bacteria 3067
309 Ga0495601_0202805 3300053077 Bacteria 1296
310 Ga0495612_0245975 3300053078 Bacteria 795
311 Ga0495619_0136571 3300053085 Bacteria 1687
312 Ga0500577_0044881 3300053142 Bacteria 1631
313 Ga0500627_0111134 3300053158 Bacteria 1234
314 Ga0500636_0006447 3300053177 Bacteria 6737
315 Ga0501084_0047195 3300054114 Bacteria 3607
316 Ga0501084_0076233 3300054114 Bacteria 2810
317 Ga0501082_0153811 3300060353 Bacteria 1998
318 Ga0466962_0035044 3300061719 Bacteria 2403
319 Ga0530510_0334843 3300061734 Bacteria 1136

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10206755 Ga0207665_102067552 139
2 3300046529 Ga0495652_0037628 Ga0495652_0037628_12_551 156
3 3300009553 Ga0105249_10182219 Ga0105249_101822194 162
4 3300025961 Ga0207712_10230194 Ga0207712_102301942 162
5 3300048088 Ga0495602_0344145 Ga0495602_0344145_181_795 172
6 3300005467 Ga0070706_100061621 Ga0070706_1000616213 173
7 3300005518 Ga0070699_100008521 Ga0070699_10000852110 173
8 3300009551 Ga0105238_10595277 Ga0105238_105952772 173
9 3300025922 Ga0207646_10017701 Ga0207646_100177014 173
10 iso_pu_bacteria 2818991467 2819721859 173
11 iso_pu_bacteria 2851182111 2851184269 173
12 iso_pu_bacteria 2917699015 2917700895 173
13 3300005334 Ga0068869_100298469 Ga0068869_1002984692 174
14 3300005435 Ga0070714_100143638 Ga0070714_1001436383 174
15 3300006028 Ga0070717_10134531 Ga0070717_101345313 174
16 3300025929 Ga0207664_10017070 Ga0207664_100170703 174
17 3300049571 Ga0501034_0192558 Ga0501034_0192558_1075_1671 174
18 3300050492 nmdc:mga0yw44_46726_c1 nmdc:mga0yw44_46726_c1_451_1068 174
19 3300053158 Ga0500627_0111134 Ga0500627_0111134_379_996 174
20 3300005328 Ga0070676_10095213 Ga0070676_100952132 175
21 3300005353 Ga0070669_100107524 Ga0070669_1001075243 175
22 3300005356 Ga0070674_100033843 Ga0070674_1000338432 175
23 3300005356 Ga0070674_100346730 Ga0070674_1003467302 175
24 3300005367 Ga0070667_100336818 Ga0070667_1003368183 175
25 3300005434 Ga0070709_10156774 Ga0070709_101567742 175
26 3300005439 Ga0070711_100033655 Ga0070711_1000336555 175
27 3300005455 Ga0070663_100163543 Ga0070663_1001635433 175
28 3300005578 Ga0068854_100136535 Ga0068854_1001365353 175
29 3300005841 Ga0068863_100868889 Ga0068863_1008688892 175
30 3300005843 Ga0068860_100120557 Ga0068860_1001205573 175
31 3300006175 Ga0070712_100009052 Ga0070712_1000090527 175
32 3300006881 Ga0068865_100170084 Ga0068865_1001700842 175
33 3300009176 Ga0105242_10327371 Ga0105242_103273712 175
34 3300025907 Ga0207645_10161172 Ga0207645_101611721 175
35 3300025915 Ga0207693_10030889 Ga0207693_100308892 175
36 3300025916 Ga0207663_10030257 Ga0207663_100302573 175
37 3300025923 Ga0207681_10377554 Ga0207681_103775542 175
38 3300025933 Ga0207706_10284367 Ga0207706_102843672 175
39 3300025933 Ga0207706_10650473 Ga0207706_106504732 175
40 3300025935 Ga0207709_10321767 Ga0207709_103217672 175
41 3300025937 Ga0207669_10669734 Ga0207669_106697342 175
42 3300025937 Ga0207669_10703340 Ga0207669_107033402 175
43 3300026023 Ga0207677_10556571 Ga0207677_105565712 175
44 3300026088 Ga0207641_10691359 Ga0207641_106913592 175
45 3300028381 Ga0268264_10400603 Ga0268264_104006032 175
46 3300042438 Ga0439459_0083429 Ga0439459_0083429_13_612 175
47 3300048903 Ga0496100_0007356 Ga0496100_0007356_818_1432 175
48 3300048904 Ga0496101_0189476 Ga0496101_0189476_212_826 175
49 3300048909 Ga0496106_0034749 Ga0496106_0034749_177_791 175
50 3300048910 Ga0496107_0170694 Ga0496107_0170694_313_927 175
51 3300048918 Ga0496115_0080729 Ga0496115_0080729_624_1238 175
52 3300049578 Ga0501042_0643226 Ga0501042_0643226_139_756 175
53 3300049581 Ga0501047_0439459 Ga0501047_0439459_64_684 175
54 3300049583 Ga0501067_0008588 Ga0501067_0008588_348_971 175
55 3300049588 Ga0501072_0394424 Ga0501072_0394424_457_1080 175
56 3300049588 Ga0501072_0543459 Ga0501072_0543459_241_855 175
57 3300049589 Ga0501073_0007746 Ga0501073_0007746_649_1269 175
58 3300049589 Ga0501073_0009620 Ga0501073_0009620_5743_6363 175
59 3300049589 Ga0501073_0021812 Ga0501073_0021812_3225_3848 175
60 3300049590 Ga0501074_0065773 Ga0501074_0065773_151_774 175
61 3300049590 Ga0501074_0299228 Ga0501074_0299228_95_715 175
62 3300049592 Ga0501076_0056621 Ga0501076_0056621_1252_1875 175
63 3300049593 Ga0501077_0113321 Ga0501077_0113321_877_1491 175
64 3300049742 Ga0501080_0518287 Ga0501080_0518287_82_702 175
65 3300049744 Ga0501083_0006225 Ga0501083_0006225_2110_2733 175
66 3300049823 Ga0501044_0461453 Ga0501044_0461453_307_906 175
67 3300054114 Ga0501084_0047195 Ga0501084_0047195_1649_2263 175
68 3300054114 Ga0501084_0076233 Ga0501084_0076233_2088_2711 175
69 3300060353 Ga0501082_0153811 Ga0501082_0153811_10_624 175
70 3300061734 Ga0530510_0334843 Ga0530510_0334843_393_1010 175
71 3300005293 Ga0065715_10005719 Ga0065715_100057194 176
72 3300005468 Ga0070707_100120568 Ga0070707_1001205683 176
73 3300005548 Ga0070665_100321500 Ga0070665_1003215002 176
74 3300005549 Ga0070704_100434164 Ga0070704_1004341641 176
75 3300009101 Ga0105247_10803216 Ga0105247_108032161 176
76 3300025922 Ga0207646_10203144 Ga0207646_102031443 176
77 3300028577 Ga0265318_10023853 Ga0265318_100238531 176
78 3300046455 Ga0495603_0271063 Ga0495603_0271063_340_942 176
79 3300050512 nmdc:mga0n895_708063_c1 nmdc:mga0n895_708063_c1_204_806 176
80 3300053142 Ga0500577_0044881 Ga0500577_0044881_263_865 176
81 3300005438 Ga0070701_10130508 Ga0070701_101305083 177
82 3300005445 Ga0070708_100349796 Ga0070708_1003497962 177
83 3300005719 Ga0068861_100379318 Ga0068861_1003793181 177
84 3300006844 Ga0075428_100195925 Ga0075428_1001959252 177
85 3300009177 Ga0105248_10938085 Ga0105248_109380852 177
86 3300010375 Ga0105239_10495319 Ga0105239_104953192 177
87 3300025914 Ga0207671_10210281 Ga0207671_102102811 177
88 3300028794 Ga0307515_10134875 Ga0307515_101348753 177
89 3300031251 Ga0265327_10003742 Ga0265327_1000374216 177
90 3300031344 Ga0265316_10090832 Ga0265316_100908322 177
91 3300035083 Ga0373926_0128895 Ga0373926_0128895_294_908 177
92 3300035171 Ga0373946_0091112 Ga0373946_0091112_518_1132 177
93 3300035695 Ga0373927_0090397 Ga0373927_0090397_367_981 177
94 3300035725 Ga0373947_0011058 Ga0373947_0011058_4088_4702 177
95 3300037068 Ga0373925_0066579 Ga0373925_0066579_415_1029 177
96 3300046455 Ga0495603_0059484 Ga0495603_0059484_92_706 177
97 3300046472 Ga0495580_0458008 Ga0495580_0458008_66_680 177
98 3300046475 Ga0495639_0143943 Ga0495639_0143943_251_865 177
99 3300046522 Ga0495643_0163879 Ga0495643_0163879_345_947 177
100 3300046683 Ga0495658_0532031 Ga0495658_0532031_111_725 177
101 3300048908 Ga0496105_0322948 Ga0496105_0322948_209_811 177
102 3300048913 Ga0496110_0031842 Ga0496110_0031842_2298_2900 177
103 3300048914 Ga0496111_0010126 Ga0496111_0010126_3478_4080 177
104 3300048915 Ga0496112_0116204 Ga0496112_0116204_1690_2292 177
105 3300048924 Ga0496121_0292374 Ga0496121_0292374_204_815 177
106 3300048925 Ga0496122_0086474 Ga0496122_0086474_1470_2072 177
107 3300048927 Ga0496124_0338781 Ga0496124_0338781_200_802 177
108 3300049573 Ga0501037_0112906 Ga0501037_0112906_928_1533 177
109 3300050492 nmdc:mga0yw44_182621_c1 nmdc:mga0yw44_182621_c1_208_810 177
110 3300050516 nmdc:mga0sz30_14893_c1 nmdc:mga0sz30_14893_c1_1513_2115 177
111 3300053177 Ga0500636_0006447 Ga0500636_0006447_3654_4256 177
112 3300005468 Ga0070707_100030062 Ga0070707_1000300625 178
113 3300005471 Ga0070698_100167105 Ga0070698_1001671053 178
114 3300005518 Ga0070699_100397753 Ga0070699_1003977532 178
115 3300005617 Ga0068859_100057158 Ga0068859_1000571583 178
116 3300005842 Ga0068858_100124492 Ga0068858_1001244924 178
117 3300006931 Ga0097620_100057158 Ga0097620_1000571584 178
118 3300009101 Ga0105247_10017850 Ga0105247_100178502 178
119 3300009545 Ga0105237_10186225 Ga0105237_101862252 178
120 3300026035 Ga0207703_10169742 Ga0207703_101697422 178
121 3300036401 Ga0373937_0142097 Ga0373937_0142097_1499_2119 178
122 3300037471 Ga0395905_0395201 Ga0395905_0395201_35_661 178
123 3300039437 Ga0436365_0946825 Ga0436365_0946825_35_646 178
124 3300046454 Ga0495592_0090304 Ga0495592_0090304_736_1356 178
125 3300046511 Ga0495608_0339204 Ga0495608_0339204_144_764 178
126 3300046678 Ga0495599_0224931 Ga0495599_0224931_165_785 178
127 3300031344 Ga0265316_10155940 Ga0265316_101559404 179
128 3300003323 rootH1_10026210 rootH1_100262102 180
129 3300003659 JGI25404J52841_10006282 JGI25404J52841_100062822 180
130 3300003659 JGI25404J52841_10008949 JGI25404J52841_100089494 180
131 3300005327 Ga0070658_10084121 Ga0070658_100841213 180
132 3300005329 Ga0070683_100032630 Ga0070683_1000326306 180
133 3300005336 Ga0070680_100032603 Ga0070680_1000326033 180
134 3300005336 Ga0070680_100845803 Ga0070680_1008458032 180
135 3300005339 Ga0070660_100067269 Ga0070660_1000672693 180
136 3300005434 Ga0070709_10015330 Ga0070709_100153302 180
137 3300005434 Ga0070709_10116521 Ga0070709_101165212 180
138 3300005435 Ga0070714_100100930 Ga0070714_1001009303 180
139 3300005435 Ga0070714_100578725 Ga0070714_1005787252 180
140 3300005435 Ga0070714_100805612 Ga0070714_1008056122 180
141 3300005436 Ga0070713_100014695 Ga0070713_1000146953 180
142 3300005436 Ga0070713_100019136 Ga0070713_1000191364 180
143 3300005436 Ga0070713_100026782 Ga0070713_1000267825 180
144 3300005436 Ga0070713_100038640 Ga0070713_1000386402 180
145 3300005436 Ga0070713_100737717 Ga0070713_1007377171 180
146 3300005437 Ga0070710_10003768 Ga0070710_100037685 180
147 3300005437 Ga0070710_10282089 Ga0070710_102820892 180
148 3300005439 Ga0070711_100021603 Ga0070711_1000216035 180
149 3300005439 Ga0070711_100164139 Ga0070711_1001641391 180
150 3300005444 Ga0070694_100202531 Ga0070694_1002025312 180
151 3300005456 Ga0070678_100251476 Ga0070678_1002514762 180
152 3300005457 Ga0070662_100256580 Ga0070662_1002565802 180
153 3300005458 Ga0070681_10281845 Ga0070681_102818452 180
154 3300005467 Ga0070706_100438436 Ga0070706_1004384363 180
155 3300005467 Ga0070706_100457862 Ga0070706_1004578622 180
156 3300005468 Ga0070707_101034868 Ga0070707_1010348681 180
157 3300005471 Ga0070698_100096790 Ga0070698_1000967902 180
158 3300005471 Ga0070698_100233199 Ga0070698_1002331992 180
159 3300005471 Ga0070698_100438702 Ga0070698_1004387022 180
160 3300005530 Ga0070679_100056648 Ga0070679_1000566484 180
161 3300005535 Ga0070684_100003618 Ga0070684_1000036186 180
162 3300005539 Ga0068853_100040370 Ga0068853_1000403705 180
163 3300005563 Ga0068855_100220273 Ga0068855_1002202733 180
164 3300005577 Ga0068857_100053523 Ga0068857_1000535233 180
165 3300005834 Ga0068851_10004499 Ga0068851_100044994 180
166 3300005937 Ga0081455_10005782 Ga0081455_100057827 180
167 3300005983 Ga0081540_1000195 Ga0081540_100019522 180
168 3300005983 Ga0081540_1007955 Ga0081540_10079552 180
169 3300006028 Ga0070717_10005856 Ga0070717_100058569 180
170 3300006173 Ga0070716_100282603 Ga0070716_1002826032 180
171 3300006175 Ga0070712_100003703 Ga0070712_1000037036 180
172 3300006175 Ga0070712_100171990 Ga0070712_1001719902 180
173 3300006852 Ga0075433_10247508 Ga0075433_102475083 180
174 3300006871 Ga0075434_100096581 Ga0075434_1000965813 180
175 3300006914 Ga0075436_100691279 Ga0075436_1006912792 180
176 3300007076 Ga0075435_100234381 Ga0075435_1002343813 180
177 3300007265 Ga0099794_10002417 Ga0099794_100024177 180
178 3300007265 Ga0099794_10131585 Ga0099794_101315852 180
179 3300007265 Ga0099794_10212654 Ga0099794_102126542 180
180 3300007788 Ga0099795_10004316 Ga0099795_100043162 180
181 3300007788 Ga0099795_10038028 Ga0099795_100380281 180
182 3300009093 Ga0105240_10031202 Ga0105240_100312026 180
183 3300009545 Ga0105237_10017035 Ga0105237_100170356 180
184 3300009551 Ga0105238_10018874 Ga0105238_100188748 180
185 3300009553 Ga0105249_10549442 Ga0105249_105494422 180
186 3300010159 Ga0099796_10063509 Ga0099796_100635092 180
187 3300010375 Ga0105239_10391701 Ga0105239_103917012 180
188 3300013100 Ga0157373_10620508 Ga0157373_106205082 180
189 3300013104 Ga0157370_10057819 Ga0157370_100578193 180
190 3300013105 Ga0157369_10047093 Ga0157369_100470934 180
191 3300014325 Ga0163163_10441736 Ga0163163_104417363 180
192 3300014497 Ga0182008_10243659 Ga0182008_102436592 180
193 3300021377 Ga0213874_10017590 Ga0213874_100175902 180
194 3300021384 Ga0213876_10076837 Ga0213876_100768372 180
195 3300021384 Ga0213876_10151302 Ga0213876_101513021 180
196 3300025321 Ga0207656_10004948 Ga0207656_100049486 180
197 3300025898 Ga0207692_10052094 Ga0207692_100520941 180
198 3300025906 Ga0207699_10010746 Ga0207699_100107462 180
199 3300025906 Ga0207699_10021067 Ga0207699_100210673 180
200 3300025906 Ga0207699_10092999 Ga0207699_100929994 180
201 3300025909 Ga0207705_10063917 Ga0207705_100639173 180
202 3300025910 Ga0207684_10132478 Ga0207684_101324784 180
203 3300025912 Ga0207707_10001229 Ga0207707_1000122920 180
204 3300025913 Ga0207695_10128881 Ga0207695_101288813 180
205 3300025914 Ga0207671_10103726 Ga0207671_101037263 180
206 3300025915 Ga0207693_10006645 Ga0207693_100066457 180
207 3300025915 Ga0207693_10131799 Ga0207693_101317992 180
208 3300025915 Ga0207693_10136073 Ga0207693_101360732 180
209 3300025915 Ga0207693_10258482 Ga0207693_102584822 180
210 3300025916 Ga0207663_10213989 Ga0207663_102139892 180
211 3300025916 Ga0207663_10367173 Ga0207663_103671732 180
212 3300025917 Ga0207660_10007648 Ga0207660_100076489 180
213 3300025919 Ga0207657_10000658 Ga0207657_1000065837 180
214 3300025921 Ga0207652_10005888 Ga0207652_100058883 180
215 3300025922 Ga0207646_10069582 Ga0207646_100695823 180
216 3300025924 Ga0207694_10113636 Ga0207694_101136362 180
217 3300025924 Ga0207694_10387160 Ga0207694_103871602 180
218 3300025924 Ga0207694_10563644 Ga0207694_105636441 180
219 3300025928 Ga0207700_10053923 Ga0207700_100539234 180
220 3300025928 Ga0207700_10133916 Ga0207700_101339162 180
221 3300025928 Ga0207700_10155650 Ga0207700_101556501 180
222 3300025928 Ga0207700_10160945 Ga0207700_101609453 180
223 3300025929 Ga0207664_10317079 Ga0207664_103170792 180
224 3300025929 Ga0207664_10440981 Ga0207664_104409811 180
225 3300025933 Ga0207706_10658763 Ga0207706_106587631 180
226 3300025939 Ga0207665_10017888 Ga0207665_100178884 180
227 3300025939 Ga0207665_10148109 Ga0207665_101481092 180
228 3300025939 Ga0207665_10247941 Ga0207665_102479411 180
229 3300025939 Ga0207665_10352235 Ga0207665_103522352 180
230 3300025945 Ga0207679_10442117 Ga0207679_104421172 180
231 3300026078 Ga0207702_11253845 Ga0207702_112538451 180
232 3300026095 Ga0207676_10142181 Ga0207676_101421814 180
233 3300026116 Ga0207674_10205570 Ga0207674_102055703 180
234 3300027512 Ga0209179_1042938 Ga0209179_10429382 180
235 3300027671 Ga0209588_1002345 Ga0209588_10023456 180
236 3300027671 Ga0209588_1071634 Ga0209588_10716342 180
237 3300031595 Ga0265313_10157457 Ga0265313_101574572 180
238 3300035086 Ga0373934_0091050 Ga0373934_0091050_522_1136 180
239 3300035089 Ga0373944_0081222 Ga0373944_0081222_22_636 180
240 3300035111 Ga0373923_0019533 Ga0373923_0019533_1720_2334 180
241 3300035112 Ga0373932_0161023 Ga0373932_0161023_127_741 180
242 3300035117 Ga0373953_0023957 Ga0373953_0023957_944_1558 180
243 3300035117 Ga0373953_0076046 Ga0373953_0076046_607_1263 180
244 3300035118 Ga0373954_0269383 Ga0373954_0269383_119_733 180
245 3300035119 Ga0373956_0296823 Ga0373956_0296823_52_708 180
246 3300035120 Ga0373957_0057153 Ga0373957_0057153_355_1011 180
247 3300035170 Ga0373943_0046922 Ga0373943_0046922_1161_1772 180
248 3300035172 Ga0373955_0122755 Ga0373955_0122755_512_1126 180
249 3300035410 Ga0373924_0066855 Ga0373924_0066855_785_1399 180
250 3300035691 Ga0373931_0326670 Ga0373931_0326670_21_635 180
251 3300035692 Ga0373935_0052870 Ga0373935_0052870_1452_2066 180
252 3300035692 Ga0373935_0382067 Ga0373935_0382067_290_904 180
253 3300035695 Ga0373927_0005809 Ga0373927_0005809_5591_6205 180
254 3300035695 Ga0373927_0156581 Ga0373927_0156581_210_824 180
255 3300035724 Ga0373933_0000225 Ga0373933_0000225_12000_12614 180
256 3300035724 Ga0373933_0077785 Ga0373933_0077785_285_899 180
257 3300035725 Ga0373947_0047924 Ga0373947_0047924_340_954 180
258 3300035725 Ga0373947_0140595 Ga0373947_0140595_285_941 180
259 3300037068 Ga0373925_0010306 Ga0373925_0010306_119_733 180
260 3300037853 Ga0436364_0318332 Ga0436364_0318332_189_803 180
261 3300039437 Ga0436365_0395291 Ga0436365_0395291_55_669 180
262 3300039437 Ga0436365_0822362 Ga0436365_0822362_873_1487 180
263 3300039437 Ga0436365_1246958 Ga0436365_1246958_752_1366 180
264 3300039450 Ga0436363_0657874 Ga0436363_0657874_3068_3682 180
265 3300039450 Ga0436363_1534966 Ga0436363_1534966_1479_2093 180
266 3300044842 Ga0466957_0013299 Ga0466957_0013299_1470_2084 180
267 3300045049 Ga0466959_0022097 Ga0466959_0022097_2757_3371 180
268 3300045976 Ga0466967_0479187 Ga0466967_0479187_480_1094 180
269 3300046454 Ga0495592_0075891 Ga0495592_0075891_1411_2025 180
270 3300046455 Ga0495603_0292614 Ga0495603_0292614_204_818 180
271 3300046472 Ga0495580_0034398 Ga0495580_0034398_2936_3550 180
272 3300046473 Ga0495582_0137715 Ga0495582_0137715_298_912 180
273 3300046473 Ga0495582_0199424 Ga0495582_0199424_136_750 180
274 3300046475 Ga0495639_0012761 Ga0495639_0012761_2835_3449 180
275 3300046476 Ga0495662_0019210 Ga0495662_0019210_1549_2163 180
276 3300046477 Ga0495664_0037562 Ga0495664_0037562_425_1039 180
277 3300046499 Ga0495594_0067092 Ga0495594_0067092_681_1295 180
278 3300046499 Ga0495594_0089717 Ga0495594_0089717_1080_1691 180
279 3300046514 Ga0495618_0083373 Ga0495618_0083373_759_1373 180
280 3300046514 Ga0495618_0099079 Ga0495618_0099079_309_923 180
281 3300046517 Ga0495630_0350655 Ga0495630_0350655_136_750 180
282 3300046529 Ga0495652_0406422 Ga0495652_0406422_296_910 180
283 3300046531 Ga0495665_0032226 Ga0495665_0032226_2069_2683 180
284 3300046533 Ga0495640_0087931 Ga0495640_0087931_1099_1713 180
285 3300046642 Ga0495634_0005118 Ga0495634_0005118_3379_3993 180
286 3300046663 Ga0495635_0185202 Ga0495635_0185202_616_1230 180
287 3300046683 Ga0495658_0011638 Ga0495658_0011638_3741_4355 180
288 3300046689 Ga0495613_0126090 Ga0495613_0126090_1089_1703 180
289 3300046690 Ga0495624_0335437 Ga0495624_0335437_216_830 180
290 3300046794 Ga0495589_0190133 Ga0495589_0190133_77_691 180
291 3300047315 Ga0495581_0239179 Ga0495581_0239179_33_647 180
292 3300047317 Ga0495604_0035914 Ga0495604_0035914_2901_3515 180
293 3300047319 Ga0495674_0016093 Ga0495674_0016093_5439_6053 180
294 3300047319 Ga0495674_0233620 Ga0495674_0233620_429_1043 180
295 3300047444 Ga0495675_0414265 Ga0495675_0414265_119_733 180
296 3300047471 Ga0495684_0002075 Ga0495684_0002075_11627_12241 180
297 3300047673 Ga0495593_0016513 Ga0495593_0016513_2391_3002 180
298 3300048905 Ga0496102_0031230 Ga0496102_0031230_3359_3973 180
299 3300048909 Ga0496106_0028680 Ga0496106_0028680_2724_3338 180
300 3300048910 Ga0496107_0362043 Ga0496107_0362043_199_813 180
301 3300048911 Ga0496108_0620496 Ga0496108_0620496_101_715 180
302 3300048912 Ga0496109_0118164 Ga0496109_0118164_875_1489 180
303 3300048912 Ga0496109_0388440 Ga0496109_0388440_529_1143 180
304 3300048912 Ga0496109_0422748 Ga0496109_0422748_597_1211 180
305 3300048913 Ga0496110_0017067 Ga0496110_0017067_250_864 180
306 3300048914 Ga0496111_0195316 Ga0496111_0195316_831_1445 180
307 3300048915 Ga0496112_0026585 Ga0496112_0026585_3629_4243 180
308 3300048915 Ga0496112_0074531 Ga0496112_0074531_2010_2624 180
309 3300048916 Ga0496113_0134418 Ga0496113_0134418_66_680 180
310 3300048916 Ga0496113_1009080 Ga0496113_1009080_11_625 180
311 3300048929 Ga0496126_0012615 Ga0496126_0012615_3372_3986 180
312 3300048929 Ga0496126_0192338 Ga0496126_0192338_612_1226 180
313 3300048929 Ga0496126_0233836 Ga0496126_0233836_559_1173 180
314 3300048929 Ga0496126_0333502 Ga0496126_0333502_603_1217 180
315 3300050512 nmdc:mga0n895_15949_c1 nmdc:mga0n895_15949_c1_4915_5541 180
316 3300050513 nmdc:mga0rr50_384118_c1 nmdc:mga0rr50_384118_c1_367_981 180
317 3300050514 nmdc:mga08x19_21747_c1 nmdc:mga08x19_21747_c1_46_672 180
318 3300050515 nmdc:mga0a205_281532_c1 nmdc:mga0a205_281532_c1_322_936 180
319 3300053077 Ga0495601_0202805 Ga0495601_0202805_488_1144 180
320 3300053078 Ga0495612_0245975 Ga0495612_0245975_76_690 180
321 3300053085 Ga0495619_0136571 Ga0495619_0136571_547_1161 180
322 3300061719 Ga0466962_0035044 Ga0466962_0035044_1159_1773 180
323 iso_pu_bacteria 2522572158 2523102613 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02734

Dak2

DAK2 domain

30

196

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pnl-assembly1.cif.gz_B crystal structure of e.coli dha kinase dhak-dhal complex 0.8872 2 175
3pnl-assembly1.cif.gz_B crystal structure of e.coli dha kinase dhak-dhal complex 0.8559 2 175
3cr3-assembly1.cif.gz_A structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis 0.8204 8 175
1un8-assembly1.cif.gz_B crystal structure of the dihydroxyacetone kinase of c. freundii (native form) 0.82 5 174
1un9-assembly1.cif.gz_B crystal structure of the dihydroxyacetone kinase from c. freundii in complex with amp-pnp and mg2+ 0.8084 5 174
ID Description Score Start End Superfamily
4lrzB00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.8897 3 177 1.25.40.340
af_I1L409_384_593_1.25.40.340 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.8819 3 177 1.25.40.340
af_F1Q8Q6_370_576_1.25.40.340 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.8795 4 177 1.25.40.340
af_Q6ASW3_381_587_1.25.40.340 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.8741 6 177 1.25.40.340
af_P43550_380_589_1.25.40.340 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.8695 3 175 1.25.40.340
ID Description Score Start End GO Terms
AF-A0A536ZHI2-F1-model_v4 Dihydroxyacetone kinase subunit L 0.9599 3 140 GO:0004371
GO:0005829
GO:0019563
AF-A0A833G3C4-F1-model_v4 Dihydroxyacetone kinase subunit L 0.9536 2 121 GO:0004371
GO:0005829
GO:0019563
AF-A0A4R3MAW7-F1-model_v4 Dihydroxyacetone kinase DhaL subunit 0.9359 3 176 GO:0004371
GO:0005829
GO:0019563
AF-A0A1N6LCV1-F1-model_v4 deleted 0.9357 1 180
AF-A0A435Y6I6-F1-model_v4 Dihydroxyacetone kinase subunit L 0.9325 7 111 GO:0004371
GO:0005829
GO:0019563

Feature Viewer

pLDDT pTM Quality
91.64 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map