F407001
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 323 | 233 | 320 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0107199|Ga0395900_0107199_247_1221 |
| Length | 324 |
| Sequence | MKRGIAVLASVCLLTAAVYVAIVKWGIVHEPLKFYDASRQRPIAVELSVRRDYQLKADEGFWKLPVAIISNGNTVKNTEYSFLANAFAARGYLVASIQQDNPSDPPLMTIPGQPYVGRIGVYKKGEANILFVLNQLKKRQPDADYDHLTLVGHSNGGDTSMYFAKMHPELVSKVVTLDNLRVPFVENAKMKILSFRSDDPNFKTDPGVLPTAAQAIKNSIDIIRTKFQHTEMSDRGPSSVKEQIQADLDKFLNSTSSSSELGPAGTDNPLIARTPPSSHAAPKQQPAANQSASDSDAQRAATPNVPSPEAESNPNMPKAGARGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 2 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 43 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 64 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 65 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 66 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 107 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 110 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 111 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 115 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 118 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 119 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 123 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 126 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 127 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 128 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 129 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 130 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 131 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 132 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 133 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 139 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 140 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 141 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 142 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 143 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 178 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 179 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 180 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 189 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 190 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 220 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 223 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 224 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 225 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 226 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 227 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 228 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 229 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 232 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.14 |
| Metatranscriptomes | 0.93 |
| Isolates | 0.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.88 |
| Nodule | 0.93 |
| Rhizoplane | 7.74 |
| Rhizosphere | 77.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10029538 | 3300001989 | Bacteria | 1905 |
| 2 | JGI24737J22298_10044505 | 3300001990 | Bacteria | 1357 |
| 3 | JGI24735J21928_10008379 | 3300002067 | Bacteria | 3345 |
| 4 | rootH2_10073498 | 3300003320 | Bacteria | 2290 |
| 5 | rootH1_10093152 | 3300003323 | Bacteria | 1324 |
| 6 | rootH1_10354076 | 3300003323 | Bacteria | 1415 |
| 7 | Ga0055539_1007277 | 3300003752 | Bacteria | 1404 |
| 8 | Ga0070683_100011858 | 3300005329 | Bacteria | 7553 |
| 9 | Ga0070680_100288479 | 3300005336 | Bacteria | 1391 |
| 10 | Ga0068868_100142676 | 3300005338 | Bacteria | 1967 |
| 11 | Ga0070660_100050407 | 3300005339 | Bacteria | 3203 |
| 12 | Ga0070661_100067689 | 3300005344 | Bacteria | 2624 |
| 13 | Ga0070671_100040018 | 3300005355 | Bacteria | 3892 |
| 14 | Ga0070659_100395531 | 3300005366 | Bacteria | 1166 |
| 15 | Ga0070667_100104714 | 3300005367 | Bacteria | 2448 |
| 16 | Ga0070709_10009482 | 3300005434 | Bacteria | 5372 |
| 17 | Ga0070714_100084387 | 3300005435 | Bacteria | 2771 |
| 18 | Ga0070713_100021640 | 3300005436 | Bacteria | 4951 |
| 19 | Ga0070710_10000885 | 3300005437 | Bacteria | 14319 |
| 20 | Ga0070711_100030988 | 3300005439 | Bacteria | 3546 |
| 21 | Ga0070663_100265522 | 3300005455 | Bacteria | 1363 |
| 22 | Ga0070678_100034501 | 3300005456 | Bacteria | 3525 |
| 23 | Ga0070707_100070822 | 3300005468 | Bacteria | 3359 |
| 24 | Ga0070679_100017216 | 3300005530 | Bacteria | 6990 |
| 25 | Ga0070684_100024534 | 3300005535 | Bacteria | 5060 |
| 26 | Ga0070684_100354921 | 3300005535 | Bacteria | 1349 |
| 27 | Ga0068853_100008031 | 3300005539 | Bacteria | 8464 |
| 28 | Ga0068853_100047269 | 3300005539 | Bacteria | 3692 |
| 29 | Ga0068853_100484783 | 3300005539 | Bacteria | 1166 |
| 30 | Ga0068853_100501317 | 3300005539 | Bacteria | 1146 |
| 31 | Ga0068853_100527789 | 3300005539 | Bacteria | 1116 |
| 32 | Ga0070672_100169884 | 3300005543 | Bacteria | 1813 |
| 33 | Ga0068855_100039656 | 3300005563 | Bacteria | 5591 |
| 34 | Ga0068855_100045924 | 3300005563 | Bacteria | 5164 |
| 35 | Ga0070664_100329361 | 3300005564 | Bacteria | 1385 |
| 36 | Ga0068857_100127839 | 3300005577 | Bacteria | 2290 |
| 37 | Ga0068856_100000197 | 3300005614 | Bacteria | 63857 |
| 38 | Ga0068856_100272160 | 3300005614 | Bacteria | 1710 |
| 39 | Ga0068852_100008061 | 3300005616 | Bacteria | 7728 |
| 40 | Ga0068852_100176126 | 3300005616 | Bacteria | 2008 |
| 41 | Ga0068852_100215826 | 3300005616 | Bacteria | 1822 |
| 42 | Ga0068852_100327691 | 3300005616 | Bacteria | 1489 |
| 43 | Ga0068864_100023167 | 3300005618 | Bacteria | 5213 |
| 44 | Ga0068851_10009720 | 3300005834 | Bacteria | 4479 |
| 45 | Ga0068858_100439828 | 3300005842 | Bacteria | 1256 |
| 46 | Ga0070717_10225148 | 3300006028 | Bacteria | 1650 |
| 47 | Ga0070716_100036116 | 3300006173 | Bacteria | 2722 |
| 48 | Ga0070712_100021196 | 3300006175 | Bacteria | 4263 |
| 49 | Ga0070712_100184246 | 3300006175 | Bacteria | 1629 |
| 50 | Ga0097621_100030055 | 3300006237 | Bacteria | 4298 |
| 51 | Ga0068871_100376828 | 3300006358 | Bacteria | 1260 |
| 52 | Ga0099794_10097822 | 3300007265 | Bacteria | 1462 |
| 53 | Ga0099795_10135754 | 3300007788 | Bacteria | 996 |
| 54 | Ga0105240_10062122 | 3300009093 | Bacteria | 4652 |
| 55 | Ga0105240_10099560 | 3300009093 | Bacteria | 3538 |
| 56 | Ga0105240_10217323 | 3300009093 | Bacteria | 2229 |
| 57 | Ga0105240_10355699 | 3300009093 | Bacteria | 1660 |
| 58 | Ga0105240_10467080 | 3300009093 | Bacteria | 1409 |
| 59 | Ga0105245_10052877 | 3300009098 | Bacteria | 3644 |
| 60 | Ga0105243_10157654 | 3300009148 | Bacteria | 1954 |
| 61 | Ga0105242_10080404 | 3300009176 | Bacteria | 2724 |
| 62 | Ga0105248_10326640 | 3300009177 | Bacteria | 1728 |
| 63 | Ga0105237_10010244 | 3300009545 | Bacteria | 9985 |
| 64 | Ga0105237_10011950 | 3300009545 | Bacteria | 9177 |
| 65 | Ga0105237_10131264 | 3300009545 | Bacteria | 2500 |
| 66 | Ga0105237_10173707 | 3300009545 | Bacteria | 2155 |
| 67 | Ga0105237_10275111 | 3300009545 | Bacteria | 1686 |
| 68 | Ga0105238_10026483 | 3300009551 | Bacteria | 5913 |
| 69 | Ga0105238_10038322 | 3300009551 | Bacteria | 4868 |
| 70 | Ga0105238_10040481 | 3300009551 | Bacteria | 4722 |
| 71 | Ga0105238_10048125 | 3300009551 | Bacteria | 4298 |
| 72 | Ga0105238_10273631 | 3300009551 | Bacteria | 1669 |
| 73 | Ga0105239_10020271 | 3300010375 | Bacteria | 7336 |
| 74 | Ga0105239_10116652 | 3300010375 | Bacteria | 2963 |
| 75 | Ga0105239_10127203 | 3300010375 | Bacteria | 2833 |
| 76 | Ga0105246_10093192 | 3300011119 | Bacteria | 2175 |
| 77 | Ga0105246_10138730 | 3300011119 | Bacteria | 1825 |
| 78 | Ga0157370_10043014 | 3300013104 | Bacteria | 4350 |
| 79 | Ga0157370_10180484 | 3300013104 | Bacteria | 1962 |
| 80 | Ga0157369_10249440 | 3300013105 | Bacteria | 1853 |
| 81 | Ga0157374_10019257 | 3300013296 | Bacteria | 6038 |
| 82 | Ga0157374_10031413 | 3300013296 | Bacteria | 4827 |
| 83 | Ga0157378_10020276 | 3300013297 | Bacteria | 5846 |
| 84 | Ga0163162_10020844 | 3300013306 | Bacteria | 6444 |
| 85 | Ga0157372_10299500 | 3300013307 | Bacteria | 1870 |
| 86 | Ga0157372_10495048 | 3300013307 | Bacteria | 1425 |
| 87 | Ga0163163_10210320 | 3300014325 | Bacteria | 1994 |
| 88 | Ga0157379_10167447 | 3300014968 | Bacteria | 1984 |
| 89 | Ga0157376_10010309 | 3300014969 | Bacteria | 6827 |
| 90 | Ga0197907_10254023 | 3300020069 | Bacteria | 1130 |
| 91 | Ga0213873_10004790 | 3300021358 | Bacteria | 2552 |
| 92 | Ga0213874_10006356 | 3300021377 | Bacteria | 2798 |
| 93 | Ga0213876_10001294 | 3300021384 | Bacteria | 15771 |
| 94 | Ga0213876_10036196 | 3300021384 | Bacteria | 2604 |
| 95 | Ga0224712_10029800 | 3300022467 | Bacteria | 1964 |
| 96 | Ga0224712_10030859 | 3300022467 | Bacteria | 1939 |
| 97 | Ga0209677_100141 | 3300025253 | Bacteria | 66656 |
| 98 | Ga0209677_101481 | 3300025253 | Bacteria | 10100 |
| 99 | Ga0209233_1011133 | 3300025261 | Bacteria | 2660 |
| 100 | Ga0209455_1001124 | 3300025272 | Bacteria | 12995 |
| 101 | Ga0209455_1006334 | 3300025272 | Bacteria | 3507 |
| 102 | Ga0209758_1043338 | 3300025297 | Bacteria | 1658 |
| 103 | Ga0207692_10237904 | 3300025898 | Bacteria | 1086 |
| 104 | Ga0207642_10037931 | 3300025899 | Bacteria | 2081 |
| 105 | Ga0207647_10000685 | 3300025904 | Bacteria | 26588 |
| 106 | Ga0207699_10009447 | 3300025906 | Bacteria | 4856 |
| 107 | Ga0207699_10162054 | 3300025906 | Bacteria | 1489 |
| 108 | Ga0207654_10000909 | 3300025911 | Bacteria | 16367 |
| 109 | Ga0207707_10005313 | 3300025912 | Bacteria | 11255 |
| 110 | Ga0207695_10008184 | 3300025913 | Bacteria | 13135 |
| 111 | Ga0207695_10246015 | 3300025913 | Bacteria | 1688 |
| 112 | Ga0207671_10020448 | 3300025914 | Bacteria | 5038 |
| 113 | Ga0207671_10064207 | 3300025914 | Bacteria | 2729 |
| 114 | Ga0207671_10196675 | 3300025914 | Bacteria | 1573 |
| 115 | Ga0207693_10020092 | 3300025915 | Bacteria | 5313 |
| 116 | Ga0207663_10003525 | 3300025916 | Bacteria | 7674 |
| 117 | Ga0207663_10086375 | 3300025916 | Bacteria | 2069 |
| 118 | Ga0207663_10123952 | 3300025916 | Bacteria | 1774 |
| 119 | Ga0207660_10020237 | 3300025917 | Bacteria | 4463 |
| 120 | Ga0207657_10013264 | 3300025919 | Bacteria | 8085 |
| 121 | Ga0207652_10027459 | 3300025921 | Bacteria | 4743 |
| 122 | Ga0207652_10330016 | 3300025921 | Bacteria | 1377 |
| 123 | Ga0207694_10008135 | 3300025924 | Bacteria | 7924 |
| 124 | Ga0207694_10033003 | 3300025924 | Bacteria | 3965 |
| 125 | Ga0207694_10039128 | 3300025924 | Bacteria | 3648 |
| 126 | Ga0207694_10235262 | 3300025924 | Bacteria | 1496 |
| 127 | Ga0207687_10047184 | 3300025927 | Bacteria | 2985 |
| 128 | Ga0207700_10174889 | 3300025928 | Bacteria | 1794 |
| 129 | Ga0207700_10383476 | 3300025928 | Bacteria | 1229 |
| 130 | Ga0207700_10455015 | 3300025928 | Bacteria | 1129 |
| 131 | Ga0207664_10159070 | 3300025929 | Bacteria | 1925 |
| 132 | Ga0207706_10086472 | 3300025933 | Bacteria | 2756 |
| 133 | Ga0207686_10097058 | 3300025934 | Bacteria | 1960 |
| 134 | Ga0207704_10338995 | 3300025938 | Bacteria | 1166 |
| 135 | Ga0207665_10000989 | 3300025939 | Bacteria | 19216 |
| 136 | Ga0207661_10049754 | 3300025944 | Bacteria | 3337 |
| 137 | Ga0207679_10317704 | 3300025945 | Bacteria | 1347 |
| 138 | Ga0207667_10026795 | 3300025949 | Bacteria | 6289 |
| 139 | Ga0207667_10043944 | 3300025949 | Bacteria | 4738 |
| 140 | Ga0207667_10069196 | 3300025949 | Bacteria | 3674 |
| 141 | Ga0207667_10119857 | 3300025949 | Bacteria | 2711 |
| 142 | Ga0207668_10183636 | 3300025972 | Bacteria | 1652 |
| 143 | Ga0207640_10022798 | 3300025981 | Bacteria | 3754 |
| 144 | Ga0207640_10072944 | 3300025981 | Bacteria | 2318 |
| 145 | Ga0207658_10577865 | 3300025986 | Bacteria | 1008 |
| 146 | Ga0207703_10303507 | 3300026035 | Bacteria | 1457 |
| 147 | Ga0207639_10050338 | 3300026041 | Bacteria | 3164 |
| 148 | Ga0207639_10384781 | 3300026041 | Bacteria | 1261 |
| 149 | Ga0207639_10412142 | 3300026041 | Bacteria | 1220 |
| 150 | Ga0207678_10148352 | 3300026067 | Bacteria | 2002 |
| 151 | Ga0207702_10000026 | 3300026078 | Bacteria | 186067 |
| 152 | Ga0207702_10000044 | 3300026078 | Bacteria | 149419 |
| 153 | Ga0207702_10041050 | 3300026078 | Bacteria | 3879 |
| 154 | Ga0207702_10220186 | 3300026078 | Bacteria | 1768 |
| 155 | Ga0207674_10007755 | 3300026116 | Bacteria | 12489 |
| 156 | Ga0207674_10009205 | 3300026116 | Bacteria | 11320 |
| 157 | Ga0207674_10015882 | 3300026116 | Bacteria | 8252 |
| 158 | Ga0207683_10037450 | 3300026121 | Bacteria | 4224 |
| 159 | Ga0207698_10105188 | 3300026142 | Bacteria | 2351 |
| 160 | Ga0207698_10125334 | 3300026142 | Bacteria | 2183 |
| 161 | Ga0207698_10381964 | 3300026142 | Bacteria | 1340 |
| 162 | Ga0207698_10393366 | 3300026142 | Bacteria | 1322 |
| 163 | Ga0209813_10033084 | 3300027866 | Bacteria | 1535 |
| 164 | Ga0265326_10001217 | 3300028558 | Bacteria | 9204 |
| 165 | Ga0265319_1001686 | 3300028563 | Bacteria | 12764 |
| 166 | Ga0265334_10001564 | 3300028573 | Bacteria | 11023 |
| 167 | Ga0265323_10003591 | 3300028653 | Bacteria | 6810 |
| 168 | Ga0265322_10007205 | 3300028654 | Bacteria | 3257 |
| 169 | Ga0265336_10000135 | 3300028666 | Bacteria | 52478 |
| 170 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 171 | Ga0265324_10001198 | 3300029957 | Bacteria | 15406 |
| 172 | Ga0307511_10017697 | 3300030521 | Bacteria | 6831 |
| 173 | Ga0265330_10002696 | 3300031235 | Bacteria | 9591 |
| 174 | Ga0265330_10025408 | 3300031235 | Bacteria | 2685 |
| 175 | Ga0265328_10036359 | 3300031239 | Bacteria | 1820 |
| 176 | Ga0265325_10004578 | 3300031241 | Bacteria | 8695 |
| 177 | Ga0265340_10005773 | 3300031247 | Bacteria | 6844 |
| 178 | Ga0265339_10010950 | 3300031249 | Bacteria | 5606 |
| 179 | Ga0265331_10010689 | 3300031250 | Bacteria | 5063 |
| 180 | Ga0265316_10096037 | 3300031344 | Bacteria | 2257 |
| 181 | Ga0307509_10114022 | 3300031507 | Bacteria | 2698 |
| 182 | Ga0265314_10009236 | 3300031711 | Bacteria | 8354 |
| 183 | Ga0265314_10027041 | 3300031711 | Bacteria | 4300 |
| 184 | Ga0265342_10029497 | 3300031712 | Bacteria | 3405 |
| 185 | Ga0307507_10116166 | 3300033179 | Bacteria | 2162 |
| 186 | Ga0316214_1016047 | 3300033545 | Bacteria | 1035 |
| 187 | Ga0373954_0003228 | 3300035118 | Bacteria | 6891 |
| 188 | Ga0373957_0000798 | 3300035120 | Bacteria | 8172 |
| 189 | Ga0373962_0049325 | 3300035242 | Bacteria | 1210 |
| 190 | Ga0373924_0003115 | 3300035410 | Bacteria | 5661 |
| 191 | Ga0373927_0036832 | 3300035695 | Bacteria | 3180 |
| 192 | Ga0373927_0210056 | 3300035695 | Bacteria | 1278 |
| 193 | Ga0373933_0007121 | 3300035724 | Bacteria | 6089 |
| 194 | Ga0373937_0086078 | 3300036401 | Bacteria | 2908 |
| 195 | Ga0373937_0090738 | 3300036401 | Bacteria | 2830 |
| 196 | Ga0373925_0072614 | 3300037068 | Bacteria | 2603 |
| 197 | Ga0373925_0095272 | 3300037068 | Bacteria | 2280 |
| 198 | Ga0395900_0107199 | 3300037418 | Bacteria | 2870 |
| 199 | Ga0395900_0282950 | 3300037418 | Bacteria | 1650 |
| 200 | Ga0395898_0035125 | 3300037466 | Bacteria | 4989 |
| 201 | Ga0436365_0217978 | 3300039437 | Bacteria | 3993 |
| 202 | Ga0436360_0618278 | 3300039438 | Bacteria | 1787 |
| 203 | Ga0436363_0496256 | 3300039450 | Bacteria | 1083 |
| 204 | Ga0436363_0984063 | 3300039450 | Bacteria | 5731 |
| 205 | Ga0436362_0306292 | 3300039453 | Bacteria | 4387 |
| 206 | Ga0466959_0266503 | 3300045049 | Bacteria | 1178 |
| 207 | Ga0466967_0024628 | 3300045976 | Bacteria | 4952 |
| 208 | Ga0466967_0043049 | 3300045976 | Bacteria | 3908 |
| 209 | Ga0495592_0141281 | 3300046454 | Bacteria | 1674 |
| 210 | Ga0495603_0091600 | 3300046455 | Bacteria | 1777 |
| 211 | Ga0495629_0000356 | 3300046459 | Bacteria | 38962 |
| 212 | Ga0495651_0136827 | 3300046462 | Bacteria | 1781 |
| 213 | Ga0495651_0153693 | 3300046462 | Bacteria | 1655 |
| 214 | Ga0495653_0003356 | 3300046463 | Bacteria | 12866 |
| 215 | Ga0495580_0049034 | 3300046472 | Bacteria | 2988 |
| 216 | Ga0495664_0197688 | 3300046477 | Bacteria | 1219 |
| 217 | Ga0495594_0160014 | 3300046499 | Bacteria | 1280 |
| 218 | Ga0495618_0011549 | 3300046514 | Bacteria | 5358 |
| 219 | Ga0495652_0015405 | 3300046529 | Bacteria | 6847 |
| 220 | Ga0495587_0070598 | 3300046536 | Bacteria | 2032 |
| 221 | Ga0495587_0106907 | 3300046536 | Bacteria | 1609 |
| 222 | Ga0495645_0004510 | 3300046543 | Bacteria | 9503 |
| 223 | Ga0495622_0034588 | 3300046557 | Bacteria | 2357 |
| 224 | Ga0495667_0003189 | 3300046559 | Bacteria | 10999 |
| 225 | Ga0495634_0011379 | 3300046642 | Bacteria | 6482 |
| 226 | Ga0495635_0002330 | 3300046663 | Bacteria | 12907 |
| 227 | Ga0495588_0013854 | 3300046674 | Bacteria | 3849 |
| 228 | Ga0495599_0002522 | 3300046678 | Bacteria | 10651 |
| 229 | Ga0495599_0160041 | 3300046678 | Bacteria | 1392 |
| 230 | Ga0495623_0025602 | 3300046679 | Bacteria | 3800 |
| 231 | Ga0495646_0005144 | 3300046680 | Bacteria | 8252 |
| 232 | Ga0495613_0042532 | 3300046689 | Bacteria | 3361 |
| 233 | Ga0495600_0009976 | 3300046809 | Bacteria | 5884 |
| 234 | Ga0495600_0336527 | 3300046809 | Bacteria | 947 |
| 235 | Ga0495581_0057755 | 3300047315 | Bacteria | 2240 |
| 236 | Ga0495604_0014030 | 3300047317 | Bacteria | 6390 |
| 237 | Ga0495674_0016704 | 3300047319 | Bacteria | 6848 |
| 238 | Ga0495672_0035061 | 3300047320 | Bacteria | 3092 |
| 239 | Ga0495680_0008144 | 3300047322 | Bacteria | 9553 |
| 240 | Ga0495675_0001783 | 3300047444 | Bacteria | 12829 |
| 241 | Ga0495684_0003370 | 3300047471 | Bacteria | 12551 |
| 242 | Ga0495593_0009502 | 3300047673 | Bacteria | 5642 |
| 243 | Ga0495602_0022453 | 3300048088 | Bacteria | 6175 |
| 244 | Ga0496100_0045642 | 3300048903 | Bacteria | 2813 |
| 245 | Ga0496101_0084447 | 3300048904 | Bacteria | 2351 |
| 246 | Ga0496102_0003787 | 3300048905 | Bacteria | 12788 |
| 247 | Ga0496102_0372606 | 3300048905 | Bacteria | 1344 |
| 248 | Ga0496104_0191718 | 3300048907 | Bacteria | 1955 |
| 249 | Ga0496105_0485896 | 3300048908 | Bacteria | 971 |
| 250 | Ga0496106_0005562 | 3300048909 | Bacteria | 9327 |
| 251 | Ga0496106_0028963 | 3300048909 | Bacteria | 4127 |
| 252 | Ga0496106_0135341 | 3300048909 | Bacteria | 1935 |
| 253 | Ga0496107_0003377 | 3300048910 | Bacteria | 10668 |
| 254 | Ga0496107_0059988 | 3300048910 | Bacteria | 2753 |
| 255 | Ga0496108_0273490 | 3300048911 | Bacteria | 1470 |
| 256 | Ga0496108_0285591 | 3300048911 | Bacteria | 1436 |
| 257 | Ga0496109_0038544 | 3300048912 | Bacteria | 4321 |
| 258 | Ga0496110_0049439 | 3300048913 | Bacteria | 3689 |
| 259 | Ga0496110_0062194 | 3300048913 | Bacteria | 3297 |
| 260 | Ga0496110_0405324 | 3300048913 | Bacteria | 1243 |
| 261 | Ga0496112_0006158 | 3300048915 | Bacteria | 10489 |
| 262 | Ga0496112_0385514 | 3300048915 | Bacteria | 1342 |
| 263 | Ga0496112_0614512 | 3300048915 | Bacteria | 1018 |
| 264 | Ga0496113_0100088 | 3300048916 | Bacteria | 2246 |
| 265 | Ga0496114_0035225 | 3300048917 | Bacteria | 4133 |
| 266 | Ga0496114_0127606 | 3300048917 | Bacteria | 2194 |
| 267 | Ga0496115_0107757 | 3300048918 | Bacteria | 2288 |
| 268 | Ga0496115_0398822 | 3300048918 | Bacteria | 1116 |
| 269 | Ga0496117_0093306 | 3300048920 | Bacteria | 1931 |
| 270 | Ga0496118_0021594 | 3300048921 | Bacteria | 5660 |
| 271 | Ga0496121_0006360 | 3300048924 | Bacteria | 14719 |
| 272 | Ga0496121_0105526 | 3300048924 | Bacteria | 2162 |
| 273 | Ga0496124_0182164 | 3300048927 | Bacteria | 1615 |
| 274 | Ga0496125_0108758 | 3300048928 | Bacteria | 2015 |
| 275 | Ga0496126_0016601 | 3300048929 | Bacteria | 7358 |
| 276 | Ga0496126_0029068 | 3300048929 | Bacteria | 5254 |
| 277 | Ga0496126_0089940 | 3300048929 | Bacteria | 2701 |
| 278 | Ga0496126_0216866 | 3300048929 | Bacteria | 1609 |
| 279 | Ga0496126_0442889 | 3300048929 | Bacteria | 1047 |
| 280 | Ga0496126_0447570 | 3300048929 | Bacteria | 1040 |
| 281 | Ga0501031_0000543 | 3300049568 | Bacteria | 22072 |
| 282 | Ga0501032_0000188 | 3300049569 | Bacteria | 51273 |
| 283 | Ga0501033_0000241 | 3300049570 | Bacteria | 52500 |
| 284 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 285 | Ga0501036_0000697 | 3300049572 | Bacteria | 24782 |
| 286 | Ga0501038_0000052 | 3300049574 | Bacteria | 94841 |
| 287 | Ga0501039_0000849 | 3300049575 | Bacteria | 22069 |
| 288 | Ga0501042_0067195 | 3300049578 | Bacteria | 2563 |
| 289 | Ga0501043_0000033 | 3300049579 | Bacteria | 139500 |
| 290 | Ga0501046_0000133 | 3300049580 | Bacteria | 79467 |
| 291 | Ga0501047_0000511 | 3300049581 | Bacteria | 41841 |
| 292 | Ga0501048_0001138 | 3300049582 | Bacteria | 19960 |
| 293 | Ga0501067_0000045 | 3300049583 | Bacteria | 73394 |
| 294 | Ga0501068_0000593 | 3300049584 | Bacteria | 18421 |
| 295 | Ga0501070_0004293 | 3300049586 | Bacteria | 12253 |
| 296 | Ga0501071_0421414 | 3300049587 | Bacteria | 1020 |
| 297 | Ga0501072_0001192 | 3300049588 | Bacteria | 19395 |
| 298 | Ga0501073_0000217 | 3300049589 | Bacteria | 37553 |
| 299 | Ga0501074_0000487 | 3300049590 | Bacteria | 24178 |
| 300 | Ga0501079_0001437 | 3300049741 | Bacteria | 16821 |
| 301 | Ga0501080_0005479 | 3300049742 | Bacteria | 11328 |
| 302 | Ga0501083_0015449 | 3300049744 | Bacteria | 5347 |
| 303 | Ga0501035_0003793 | 3300049822 | Bacteria | 14399 |
| 304 | Ga0501044_0000141 | 3300049823 | Bacteria | 88569 |
| 305 | Ga0501045_0009267 | 3300049824 | Bacteria | 6885 |
| 306 | nmdc:mga04h51_39382_c1 | 3300050495 | Bacteria | 1535 |
| 307 | Ga0495612_0064664 | 3300053078 | Bacteria | 1518 |
| 308 | Ga0495619_0002869 | 3300053085 | Bacteria | 11211 |
| 309 | Ga0500566_0069614 | 3300053094 | Bacteria | 1977 |
| 310 | Ga0500556_0054279 | 3300053104 | Bacteria | 1459 |
| 311 | Ga0500595_001500 | 3300053119 | Bacteria | 12403 |
| 312 | Ga0500595_003624 | 3300053119 | Bacteria | 7157 |
| 313 | Ga0500559_0048240 | 3300053136 | Bacteria | 1872 |
| 314 | Ga0500568_0001940 | 3300053139 | Bacteria | 12677 |
| 315 | Ga0500603_015119 | 3300053150 | Bacteria | 1812 |
| 316 | Ga0500638_003395 | 3300053162 | Bacteria | 5887 |
| 317 | Ga0500637_0000042 | 3300053178 | Bacteria | 46215 |
| 318 | Ga0501084_0002023 | 3300054114 | Bacteria | 16192 |
| 319 | Ga0500661_000689 | 3300055283 | Bacteria | 6342 |
| 320 | Ga0501082_0002281 | 3300060353 | Bacteria | 16799 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046678 | Ga0495599_0160041 | Ga0495599_0160041_277_1065 | 262 |
| 2 | 3300048920 | Ga0496117_0093306 | Ga0496117_0093306_525_1328 | 265 |
| 3 | 3300048921 | Ga0496118_0021594 | Ga0496118_0021594_1570_2373 | 265 |
| 4 | 3300005468 | Ga0070707_100070822 | Ga0070707_1000708224 | 273 |
| 5 | 3300005539 | Ga0068853_100527789 | Ga0068853_1005277891 | 273 |
| 6 | 3300007788 | Ga0099795_10135754 | Ga0099795_101357541 | 273 |
| 7 | 3300009093 | Ga0105240_10467080 | Ga0105240_104670802 | 273 |
| 8 | 3300009545 | Ga0105237_10011950 | Ga0105237_100119502 | 273 |
| 9 | 3300009551 | Ga0105238_10026483 | Ga0105238_100264835 | 273 |
| 10 | 3300010375 | Ga0105239_10020271 | Ga0105239_100202718 | 273 |
| 11 | 3300013296 | Ga0157374_10031413 | Ga0157374_100314133 | 273 |
| 12 | 3300025924 | Ga0207694_10039128 | Ga0207694_100391282 | 273 |
| 13 | 3300026041 | Ga0207639_10050338 | Ga0207639_100503384 | 273 |
| 14 | 3300035242 | Ga0373962_0049325 | Ga0373962_0049325_93_947 | 273 |
| 15 | 3300037068 | Ga0373925_0095272 | Ga0373925_0095272_551_1405 | 273 |
| 16 | 3300045049 | Ga0466959_0266503 | Ga0466959_0266503_188_1015 | 273 |
| 17 | 3300046455 | Ga0495603_0091600 | Ga0495603_0091600_900_1754 | 273 |
| 18 | 3300046472 | Ga0495580_0049034 | Ga0495580_0049034_1557_2411 | 273 |
| 19 | 3300046499 | Ga0495594_0160014 | Ga0495594_0160014_235_1089 | 273 |
| 20 | 3300046674 | Ga0495588_0013854 | Ga0495588_0013854_2353_3207 | 273 |
| 21 | 3300047315 | Ga0495581_0057755 | Ga0495581_0057755_806_1660 | 273 |
| 22 | 3300048905 | Ga0496102_0372606 | Ga0496102_0372606_296_1123 | 273 |
| 23 | 3300048929 | Ga0496126_0442889 | Ga0496126_0442889_79_939 | 273 |
| 24 | 3300007265 | Ga0099794_10097822 | Ga0099794_100978222 | 274 |
| 25 | 3300021377 | Ga0213874_10006356 | Ga0213874_100063563 | 274 |
| 26 | 3300039450 | Ga0436363_0984063 | Ga0436363_0984063_4369_5199 | 274 |
| 27 | iso_pu_bacteria | 2524023210 | 2524466063 | 274 |
| 28 | iso_pu_bacteria | 2922361189 | 2922362721 | 274 |
| 29 | iso_pu_bacteria | 8056681323 | 8056684413 | 274 |
| 30 | 3300009093 | Ga0105240_10217323 | Ga0105240_102173231 | 275 |
| 31 | 3300021384 | Ga0213876_10036196 | Ga0213876_100361964 | 275 |
| 32 | 3300025253 | Ga0209677_100141 | Ga0209677_10014138 | 275 |
| 33 | 3300025261 | Ga0209233_1011133 | Ga0209233_10111333 | 275 |
| 34 | 3300025272 | Ga0209455_1006334 | Ga0209455_10063343 | 275 |
| 35 | 3300025928 | Ga0207700_10383476 | Ga0207700_103834761 | 275 |
| 36 | 3300046477 | Ga0495664_0197688 | Ga0495664_0197688_174_1001 | 275 |
| 37 | 3300025938 | Ga0207704_10338995 | Ga0207704_103389951 | 276 |
| 38 | 3300026035 | Ga0207703_10303507 | Ga0207703_103035071 | 276 |
| 39 | 3300035695 | Ga0373927_0210056 | Ga0373927_0210056_59_889 | 276 |
| 40 | 3300048929 | Ga0496126_0016601 | Ga0496126_0016601_2219_3163 | 276 |
| 41 | 3300003320 | rootH2_10073498 | rootH2_100734983 | 277 |
| 42 | 3300003323 | rootH1_10093152 | rootH1_100931521 | 277 |
| 43 | 3300005842 | Ga0068858_100439828 | Ga0068858_1004398282 | 277 |
| 44 | 3300009177 | Ga0105248_10326640 | Ga0105248_103266401 | 277 |
| 45 | 3300009545 | Ga0105237_10275111 | Ga0105237_102751112 | 277 |
| 46 | 3300009551 | Ga0105238_10048125 | Ga0105238_100481255 | 277 |
| 47 | 3300013104 | Ga0157370_10180484 | Ga0157370_101804842 | 277 |
| 48 | 3300013307 | Ga0157372_10299500 | Ga0157372_102995001 | 277 |
| 49 | 3300020069 | Ga0197907_10254023 | Ga0197907_102540231 | 277 |
| 50 | 3300025272 | Ga0209455_1001124 | Ga0209455_10011249 | 277 |
| 51 | 3300025297 | Ga0209758_1043338 | Ga0209758_10433382 | 277 |
| 52 | 3300025914 | Ga0207671_10196675 | Ga0207671_101966751 | 277 |
| 53 | 3300028558 | Ga0265326_10001217 | Ga0265326_100012176 | 277 |
| 54 | 3300028563 | Ga0265319_1001686 | Ga0265319_10016865 | 277 |
| 55 | 3300028573 | Ga0265334_10001564 | Ga0265334_100015645 | 277 |
| 56 | 3300028653 | Ga0265323_10003591 | Ga0265323_100035915 | 277 |
| 57 | 3300028654 | Ga0265322_10007205 | Ga0265322_100072053 | 277 |
| 58 | 3300028666 | Ga0265336_10000135 | Ga0265336_1000013510 | 277 |
| 59 | 3300028800 | Ga0265338_10000034 | Ga0265338_10000034196 | 277 |
| 60 | 3300029957 | Ga0265324_10001198 | Ga0265324_1000119815 | 277 |
| 61 | 3300031711 | Ga0265314_10027041 | Ga0265314_100270415 | 277 |
| 62 | 3300045976 | Ga0466967_0043049 | Ga0466967_0043049_1224_2195 | 277 |
| 63 | 3300048913 | Ga0496110_0405324 | Ga0496110_0405324_153_986 | 277 |
| 64 | 3300048915 | Ga0496112_0614512 | Ga0496112_0614512_128_961 | 277 |
| 65 | 3300048927 | Ga0496124_0182164 | Ga0496124_0182164_548_1381 | 277 |
| 66 | 3300048928 | Ga0496125_0108758 | Ga0496125_0108758_208_1041 | 277 |
| 67 | 3300048929 | Ga0496126_0447570 | Ga0496126_0447570_121_954 | 277 |
| 68 | 3300003323 | rootH1_10354076 | rootH1_103540761 | 278 |
| 69 | 3300003752 | Ga0055539_1007277 | Ga0055539_10072772 | 278 |
| 70 | 3300005329 | Ga0070683_100011858 | Ga0070683_1000118586 | 278 |
| 71 | 3300005336 | Ga0070680_100288479 | Ga0070680_1002884791 | 278 |
| 72 | 3300005338 | Ga0068868_100142676 | Ga0068868_1001426761 | 278 |
| 73 | 3300005339 | Ga0070660_100050407 | Ga0070660_1000504071 | 278 |
| 74 | 3300005344 | Ga0070661_100067689 | Ga0070661_1000676893 | 278 |
| 75 | 3300005355 | Ga0070671_100040018 | Ga0070671_1000400183 | 278 |
| 76 | 3300005366 | Ga0070659_100395531 | Ga0070659_1003955311 | 278 |
| 77 | 3300005367 | Ga0070667_100104714 | Ga0070667_1001047143 | 278 |
| 78 | 3300005434 | Ga0070709_10009482 | Ga0070709_100094824 | 278 |
| 79 | 3300005435 | Ga0070714_100084387 | Ga0070714_1000843874 | 278 |
| 80 | 3300005436 | Ga0070713_100021640 | Ga0070713_1000216405 | 278 |
| 81 | 3300005437 | Ga0070710_10000885 | Ga0070710_1000088512 | 278 |
| 82 | 3300005439 | Ga0070711_100030988 | Ga0070711_1000309884 | 278 |
| 83 | 3300005455 | Ga0070663_100265522 | Ga0070663_1002655221 | 278 |
| 84 | 3300005456 | Ga0070678_100034501 | Ga0070678_1000345012 | 278 |
| 85 | 3300005530 | Ga0070679_100017216 | Ga0070679_1000172164 | 278 |
| 86 | 3300005535 | Ga0070684_100024534 | Ga0070684_1000245342 | 278 |
| 87 | 3300005535 | Ga0070684_100354921 | Ga0070684_1003549212 | 278 |
| 88 | 3300005539 | Ga0068853_100008031 | Ga0068853_1000080311 | 278 |
| 89 | 3300005539 | Ga0068853_100047269 | Ga0068853_1000472693 | 278 |
| 90 | 3300005539 | Ga0068853_100484783 | Ga0068853_1004847831 | 278 |
| 91 | 3300005539 | Ga0068853_100501317 | Ga0068853_1005013171 | 278 |
| 92 | 3300005543 | Ga0070672_100169884 | Ga0070672_1001698841 | 278 |
| 93 | 3300005563 | Ga0068855_100039656 | Ga0068855_1000396563 | 278 |
| 94 | 3300005563 | Ga0068855_100045924 | Ga0068855_1000459245 | 278 |
| 95 | 3300005564 | Ga0070664_100329361 | Ga0070664_1003293612 | 278 |
| 96 | 3300005614 | Ga0068856_100000197 | Ga0068856_10000019725 | 278 |
| 97 | 3300005614 | Ga0068856_100272160 | Ga0068856_1002721601 | 278 |
| 98 | 3300005616 | Ga0068852_100008061 | Ga0068852_1000080619 | 278 |
| 99 | 3300005616 | Ga0068852_100176126 | Ga0068852_1001761262 | 278 |
| 100 | 3300005616 | Ga0068852_100215826 | Ga0068852_1002158263 | 278 |
| 101 | 3300005616 | Ga0068852_100327691 | Ga0068852_1003276911 | 278 |
| 102 | 3300005618 | Ga0068864_100023167 | Ga0068864_1000231672 | 278 |
| 103 | 3300005834 | Ga0068851_10009720 | Ga0068851_100097205 | 278 |
| 104 | 3300006175 | Ga0070712_100021196 | Ga0070712_1000211963 | 278 |
| 105 | 3300006175 | Ga0070712_100184246 | Ga0070712_1001842462 | 278 |
| 106 | 3300006237 | Ga0097621_100030055 | Ga0097621_1000300554 | 278 |
| 107 | 3300006358 | Ga0068871_100376828 | Ga0068871_1003768282 | 278 |
| 108 | 3300009093 | Ga0105240_10062122 | Ga0105240_100621223 | 278 |
| 109 | 3300009093 | Ga0105240_10099560 | Ga0105240_100995603 | 278 |
| 110 | 3300009093 | Ga0105240_10355699 | Ga0105240_103556991 | 278 |
| 111 | 3300009098 | Ga0105245_10052877 | Ga0105245_100528772 | 278 |
| 112 | 3300009148 | Ga0105243_10157654 | Ga0105243_101576542 | 278 |
| 113 | 3300009176 | Ga0105242_10080404 | Ga0105242_100804042 | 278 |
| 114 | 3300009545 | Ga0105237_10010244 | Ga0105237_100102448 | 278 |
| 115 | 3300009551 | Ga0105238_10273631 | Ga0105238_102736312 | 278 |
| 116 | 3300010375 | Ga0105239_10127203 | Ga0105239_101272033 | 278 |
| 117 | 3300011119 | Ga0105246_10093192 | Ga0105246_100931922 | 278 |
| 118 | 3300011119 | Ga0105246_10138730 | Ga0105246_101387303 | 278 |
| 119 | 3300013104 | Ga0157370_10043014 | Ga0157370_100430143 | 278 |
| 120 | 3300013296 | Ga0157374_10019257 | Ga0157374_100192574 | 278 |
| 121 | 3300013297 | Ga0157378_10020276 | Ga0157378_100202765 | 278 |
| 122 | 3300013306 | Ga0163162_10020844 | Ga0163162_100208447 | 278 |
| 123 | 3300013307 | Ga0157372_10495048 | Ga0157372_104950482 | 278 |
| 124 | 3300014325 | Ga0163163_10210320 | Ga0163163_102103202 | 278 |
| 125 | 3300014968 | Ga0157379_10167447 | Ga0157379_101674472 | 278 |
| 126 | 3300014969 | Ga0157376_10010309 | Ga0157376_100103096 | 278 |
| 127 | 3300021358 | Ga0213873_10004790 | Ga0213873_100047901 | 278 |
| 128 | 3300021384 | Ga0213876_10001294 | Ga0213876_1000129411 | 278 |
| 129 | 3300022467 | Ga0224712_10029800 | Ga0224712_100298004 | 278 |
| 130 | 3300025253 | Ga0209677_101481 | Ga0209677_1014815 | 278 |
| 131 | 3300025898 | Ga0207692_10237904 | Ga0207692_102379042 | 278 |
| 132 | 3300025899 | Ga0207642_10037931 | Ga0207642_100379311 | 278 |
| 133 | 3300025906 | Ga0207699_10009447 | Ga0207699_100094474 | 278 |
| 134 | 3300025906 | Ga0207699_10162054 | Ga0207699_101620541 | 278 |
| 135 | 3300025911 | Ga0207654_10000909 | Ga0207654_100009098 | 278 |
| 136 | 3300025912 | Ga0207707_10005313 | Ga0207707_100053132 | 278 |
| 137 | 3300025913 | Ga0207695_10008184 | Ga0207695_100081848 | 278 |
| 138 | 3300025913 | Ga0207695_10246015 | Ga0207695_102460151 | 278 |
| 139 | 3300025914 | Ga0207671_10020448 | Ga0207671_100204487 | 278 |
| 140 | 3300025915 | Ga0207693_10020092 | Ga0207693_100200925 | 278 |
| 141 | 3300025916 | Ga0207663_10003525 | Ga0207663_100035254 | 278 |
| 142 | 3300025916 | Ga0207663_10086375 | Ga0207663_100863752 | 278 |
| 143 | 3300025916 | Ga0207663_10123952 | Ga0207663_101239521 | 278 |
| 144 | 3300025917 | Ga0207660_10020237 | Ga0207660_100202372 | 278 |
| 145 | 3300025919 | Ga0207657_10013264 | Ga0207657_100132647 | 278 |
| 146 | 3300025921 | Ga0207652_10027459 | Ga0207652_100274592 | 278 |
| 147 | 3300025921 | Ga0207652_10330016 | Ga0207652_103300161 | 278 |
| 148 | 3300025924 | Ga0207694_10008135 | Ga0207694_100081352 | 278 |
| 149 | 3300025924 | Ga0207694_10033003 | Ga0207694_100330031 | 278 |
| 150 | 3300025927 | Ga0207687_10047184 | Ga0207687_100471842 | 278 |
| 151 | 3300025928 | Ga0207700_10455015 | Ga0207700_104550151 | 278 |
| 152 | 3300025934 | Ga0207686_10097058 | Ga0207686_100970582 | 278 |
| 153 | 3300025939 | Ga0207665_10000989 | Ga0207665_1000098911 | 278 |
| 154 | 3300025944 | Ga0207661_10049754 | Ga0207661_100497544 | 278 |
| 155 | 3300025945 | Ga0207679_10317704 | Ga0207679_103177041 | 278 |
| 156 | 3300025949 | Ga0207667_10026795 | Ga0207667_100267957 | 278 |
| 157 | 3300025949 | Ga0207667_10043944 | Ga0207667_100439441 | 278 |
| 158 | 3300025949 | Ga0207667_10069196 | Ga0207667_100691962 | 278 |
| 159 | 3300025972 | Ga0207668_10183636 | Ga0207668_101836362 | 278 |
| 160 | 3300025981 | Ga0207640_10072944 | Ga0207640_100729442 | 278 |
| 161 | 3300025986 | Ga0207658_10577865 | Ga0207658_105778651 | 278 |
| 162 | 3300026041 | Ga0207639_10384781 | Ga0207639_103847811 | 278 |
| 163 | 3300026041 | Ga0207639_10412142 | Ga0207639_104121421 | 278 |
| 164 | 3300026067 | Ga0207678_10148352 | Ga0207678_101483521 | 278 |
| 165 | 3300026078 | Ga0207702_10000026 | Ga0207702_100000269 | 278 |
| 166 | 3300026078 | Ga0207702_10000044 | Ga0207702_10000044140 | 278 |
| 167 | 3300026078 | Ga0207702_10220186 | Ga0207702_102201863 | 278 |
| 168 | 3300026116 | Ga0207674_10007755 | Ga0207674_100077553 | 278 |
| 169 | 3300026116 | Ga0207674_10015882 | Ga0207674_100158828 | 278 |
| 170 | 3300026121 | Ga0207683_10037450 | Ga0207683_100374502 | 278 |
| 171 | 3300026142 | Ga0207698_10105188 | Ga0207698_101051883 | 278 |
| 172 | 3300026142 | Ga0207698_10381964 | Ga0207698_103819642 | 278 |
| 173 | 3300026142 | Ga0207698_10393366 | Ga0207698_103933661 | 278 |
| 174 | 3300027866 | Ga0209813_10033084 | Ga0209813_100330841 | 278 |
| 175 | 3300030521 | Ga0307511_10017697 | Ga0307511_100176975 | 278 |
| 176 | 3300031235 | Ga0265330_10002696 | Ga0265330_100026964 | 278 |
| 177 | 3300031235 | Ga0265330_10025408 | Ga0265330_100254082 | 278 |
| 178 | 3300031239 | Ga0265328_10036359 | Ga0265328_100363593 | 278 |
| 179 | 3300031241 | Ga0265325_10004578 | Ga0265325_100045789 | 278 |
| 180 | 3300031247 | Ga0265340_10005773 | Ga0265340_100057736 | 278 |
| 181 | 3300031249 | Ga0265339_10010950 | Ga0265339_100109503 | 278 |
| 182 | 3300031250 | Ga0265331_10010689 | Ga0265331_100106895 | 278 |
| 183 | 3300031344 | Ga0265316_10096037 | Ga0265316_100960373 | 278 |
| 184 | 3300031507 | Ga0307509_10114022 | Ga0307509_101140222 | 278 |
| 185 | 3300031711 | Ga0265314_10009236 | Ga0265314_100092365 | 278 |
| 186 | 3300031712 | Ga0265342_10029497 | Ga0265342_100294974 | 278 |
| 187 | 3300033179 | Ga0307507_10116166 | Ga0307507_101161661 | 278 |
| 188 | 3300033545 | Ga0316214_1016047 | Ga0316214_10160471 | 278 |
| 189 | 3300035695 | Ga0373927_0036832 | Ga0373927_0036832_1277_2113 | 278 |
| 190 | 3300036401 | Ga0373937_0090738 | Ga0373937_0090738_913_1752 | 278 |
| 191 | 3300037068 | Ga0373925_0072614 | Ga0373925_0072614_144_980 | 278 |
| 192 | 3300037418 | Ga0395900_0107199 | Ga0395900_0107199_247_1221 | 278 |
| 193 | 3300039438 | Ga0436360_0618278 | Ga0436360_0618278_691_1527 | 278 |
| 194 | 3300046557 | Ga0495622_0034588 | Ga0495622_0034588_1000_1836 | 278 |
| 195 | 3300048903 | Ga0496100_0045642 | Ga0496100_0045642_118_954 | 278 |
| 196 | 3300048904 | Ga0496101_0084447 | Ga0496101_0084447_1082_1918 | 278 |
| 197 | 3300048905 | Ga0496102_0003787 | Ga0496102_0003787_11721_12557 | 278 |
| 198 | 3300048907 | Ga0496104_0191718 | Ga0496104_0191718_653_1489 | 278 |
| 199 | 3300048908 | Ga0496105_0485896 | Ga0496105_0485896_16_918 | 278 |
| 200 | 3300048909 | Ga0496106_0005562 | Ga0496106_0005562_6741_7643 | 278 |
| 201 | 3300048909 | Ga0496106_0028963 | Ga0496106_0028963_805_1641 | 278 |
| 202 | 3300048909 | Ga0496106_0135341 | Ga0496106_0135341_320_1156 | 278 |
| 203 | 3300048910 | Ga0496107_0003377 | Ga0496107_0003377_9808_10644 | 278 |
| 204 | 3300048910 | Ga0496107_0059988 | Ga0496107_0059988_254_1156 | 278 |
| 205 | 3300048911 | Ga0496108_0273490 | Ga0496108_0273490_320_1156 | 278 |
| 206 | 3300048911 | Ga0496108_0285591 | Ga0496108_0285591_209_1111 | 278 |
| 207 | 3300048912 | Ga0496109_0038544 | Ga0496109_0038544_475_1377 | 278 |
| 208 | 3300048913 | Ga0496110_0062194 | Ga0496110_0062194_494_1330 | 278 |
| 209 | 3300048915 | Ga0496112_0006158 | Ga0496112_0006158_4295_5197 | 278 |
| 210 | 3300048916 | Ga0496113_0100088 | Ga0496113_0100088_256_1158 | 278 |
| 211 | 3300048917 | Ga0496114_0035225 | Ga0496114_0035225_906_1742 | 278 |
| 212 | 3300048917 | Ga0496114_0127606 | Ga0496114_0127606_648_1550 | 278 |
| 213 | 3300048918 | Ga0496115_0107757 | Ga0496115_0107757_14_916 | 278 |
| 214 | 3300048924 | Ga0496121_0105526 | Ga0496121_0105526_1035_1871 | 278 |
| 215 | 3300049568 | Ga0501031_0000543 | Ga0501031_0000543_1479_2342 | 278 |
| 216 | 3300049569 | Ga0501032_0000188 | Ga0501032_0000188_33521_34384 | 278 |
| 217 | 3300049570 | Ga0501033_0000241 | Ga0501033_0000241_43877_44740 | 278 |
| 218 | 3300049571 | Ga0501034_0000021 | Ga0501034_0000021_92420_93283 | 278 |
| 219 | 3300049572 | Ga0501036_0000697 | Ga0501036_0000697_20122_20985 | 278 |
| 220 | 3300049574 | Ga0501038_0000052 | Ga0501038_0000052_92430_93293 | 278 |
| 221 | 3300049575 | Ga0501039_0000849 | Ga0501039_0000849_1371_2234 | 278 |
| 222 | 3300049578 | Ga0501042_0067195 | Ga0501042_0067195_1646_2509 | 278 |
| 223 | 3300049579 | Ga0501043_0000033 | Ga0501043_0000033_11543_12406 | 278 |
| 224 | 3300049580 | Ga0501046_0000133 | Ga0501046_0000133_74137_75000 | 278 |
| 225 | 3300049581 | Ga0501047_0000511 | Ga0501047_0000511_39786_40649 | 278 |
| 226 | 3300049582 | Ga0501048_0001138 | Ga0501048_0001138_11326_12189 | 278 |
| 227 | 3300049583 | Ga0501067_0000045 | Ga0501067_0000045_50403_51266 | 278 |
| 228 | 3300049584 | Ga0501068_0000593 | Ga0501068_0000593_11043_11906 | 278 |
| 229 | 3300049586 | Ga0501070_0004293 | Ga0501070_0004293_10212_11075 | 278 |
| 230 | 3300049587 | Ga0501071_0421414 | Ga0501071_0421414_137_1000 | 278 |
| 231 | 3300049588 | Ga0501072_0001192 | Ga0501072_0001192_14505_15368 | 278 |
| 232 | 3300049589 | Ga0501073_0000217 | Ga0501073_0000217_24656_25519 | 278 |
| 233 | 3300049590 | Ga0501074_0000487 | Ga0501074_0000487_21913_22776 | 278 |
| 234 | 3300049741 | Ga0501079_0001437 | Ga0501079_0001437_9230_10093 | 278 |
| 235 | 3300049742 | Ga0501080_0005479 | Ga0501080_0005479_832_1695 | 278 |
| 236 | 3300049744 | Ga0501083_0015449 | Ga0501083_0015449_1516_2379 | 278 |
| 237 | 3300049822 | Ga0501035_0003793 | Ga0501035_0003793_1664_2527 | 278 |
| 238 | 3300049823 | Ga0501044_0000141 | Ga0501044_0000141_83909_84772 | 278 |
| 239 | 3300049824 | Ga0501045_0009267 | Ga0501045_0009267_6010_6873 | 278 |
| 240 | 3300050495 | nmdc:mga04h51_39382_c1 | nmdc:mga04h51_39382_c1_585_1424 | 278 |
| 241 | 3300053094 | Ga0500566_0069614 | Ga0500566_0069614_405_1241 | 278 |
| 242 | 3300053119 | Ga0500595_003624 | Ga0500595_003624_1089_1925 | 278 |
| 243 | 3300053136 | Ga0500559_0048240 | Ga0500559_0048240_604_1440 | 278 |
| 244 | 3300053150 | Ga0500603_015119 | Ga0500603_015119_436_1272 | 278 |
| 245 | 3300053162 | Ga0500638_003395 | Ga0500638_003395_3283_4119 | 278 |
| 246 | 3300053178 | Ga0500637_0000042 | Ga0500637_0000042_40140_40976 | 278 |
| 247 | 3300054114 | Ga0501084_0002023 | Ga0501084_0002023_10881_11744 | 278 |
| 248 | 3300055283 | Ga0500661_000689 | Ga0500661_000689_1118_1954 | 278 |
| 249 | 3300060353 | Ga0501082_0002281 | Ga0501082_0002281_10278_11141 | 278 |
| 250 | 3300022467 | Ga0224712_10030859 | Ga0224712_100308592 | 280 |
| 251 | 3300037418 | Ga0395900_0282950 | Ga0395900_0282950_292_1140 | 280 |
| 252 | 3300037466 | Ga0395898_0035125 | Ga0395898_0035125_3250_4098 | 280 |
| 253 | 3300048915 | Ga0496112_0385514 | Ga0496112_0385514_272_1120 | 280 |
| 254 | 3300006028 | Ga0070717_10225148 | Ga0070717_102251482 | 281 |
| 255 | 3300006173 | Ga0070716_100036116 | Ga0070716_1000361163 | 281 |
| 256 | 3300025928 | Ga0207700_10174889 | Ga0207700_101748891 | 281 |
| 257 | 3300025929 | Ga0207664_10159070 | Ga0207664_101590701 | 281 |
| 258 | 3300035118 | Ga0373954_0003228 | Ga0373954_0003228_6021_6866 | 281 |
| 259 | 3300035120 | Ga0373957_0000798 | Ga0373957_0000798_53_898 | 281 |
| 260 | 3300035410 | Ga0373924_0003115 | Ga0373924_0003115_4679_5524 | 281 |
| 261 | 3300035724 | Ga0373933_0007121 | Ga0373933_0007121_3400_4245 | 281 |
| 262 | 3300036401 | Ga0373937_0086078 | Ga0373937_0086078_241_1086 | 281 |
| 263 | 3300039437 | Ga0436365_0217978 | Ga0436365_0217978_2638_3486 | 281 |
| 264 | 3300039450 | Ga0436363_0496256 | Ga0436363_0496256_131_979 | 281 |
| 265 | 3300039453 | Ga0436362_0306292 | Ga0436362_0306292_2566_3414 | 281 |
| 266 | 3300046454 | Ga0495592_0141281 | Ga0495592_0141281_466_1311 | 281 |
| 267 | 3300046459 | Ga0495629_0000356 | Ga0495629_0000356_31323_32168 | 281 |
| 268 | 3300046462 | Ga0495651_0136827 | Ga0495651_0136827_753_1598 | 281 |
| 269 | 3300046462 | Ga0495651_0153693 | Ga0495651_0153693_241_1086 | 281 |
| 270 | 3300046463 | Ga0495653_0003356 | Ga0495653_0003356_7172_8017 | 281 |
| 271 | 3300046514 | Ga0495618_0011549 | Ga0495618_0011549_1043_1888 | 281 |
| 272 | 3300046529 | Ga0495652_0015405 | Ga0495652_0015405_2055_2900 | 281 |
| 273 | 3300046536 | Ga0495587_0070598 | Ga0495587_0070598_241_1086 | 281 |
| 274 | 3300046536 | Ga0495587_0106907 | Ga0495587_0106907_207_1052 | 281 |
| 275 | 3300046543 | Ga0495645_0004510 | Ga0495645_0004510_4985_5830 | 281 |
| 276 | 3300046559 | Ga0495667_0003189 | Ga0495667_0003189_3493_4338 | 281 |
| 277 | 3300046642 | Ga0495634_0011379 | Ga0495634_0011379_1913_2758 | 281 |
| 278 | 3300046663 | Ga0495635_0002330 | Ga0495635_0002330_6804_7649 | 281 |
| 279 | 3300046678 | Ga0495599_0002522 | Ga0495599_0002522_5159_6004 | 281 |
| 280 | 3300046679 | Ga0495623_0025602 | Ga0495623_0025602_322_1167 | 281 |
| 281 | 3300046680 | Ga0495646_0005144 | Ga0495646_0005144_5736_6581 | 281 |
| 282 | 3300046689 | Ga0495613_0042532 | Ga0495613_0042532_2474_3319 | 281 |
| 283 | 3300046809 | Ga0495600_0009976 | Ga0495600_0009976_3254_4099 | 281 |
| 284 | 3300046809 | Ga0495600_0336527 | Ga0495600_0336527_30_875 | 281 |
| 285 | 3300047317 | Ga0495604_0014030 | Ga0495604_0014030_276_1121 | 281 |
| 286 | 3300047319 | Ga0495674_0016704 | Ga0495674_0016704_1202_2047 | 281 |
| 287 | 3300047320 | Ga0495672_0035061 | Ga0495672_0035061_412_1257 | 281 |
| 288 | 3300047322 | Ga0495680_0008144 | Ga0495680_0008144_4262_5107 | 281 |
| 289 | 3300047444 | Ga0495675_0001783 | Ga0495675_0001783_8492_9337 | 281 |
| 290 | 3300047471 | Ga0495684_0003370 | Ga0495684_0003370_8215_9060 | 281 |
| 291 | 3300047673 | Ga0495593_0009502 | Ga0495593_0009502_190_1035 | 281 |
| 292 | 3300048088 | Ga0495602_0022453 | Ga0495602_0022453_241_1086 | 281 |
| 293 | 3300048913 | Ga0496110_0049439 | Ga0496110_0049439_165_1010 | 281 |
| 294 | 3300048918 | Ga0496115_0398822 | Ga0496115_0398822_119_967 | 281 |
| 295 | 3300048924 | Ga0496121_0006360 | Ga0496121_0006360_7226_8071 | 281 |
| 296 | 3300048929 | Ga0496126_0089940 | Ga0496126_0089940_78_926 | 281 |
| 297 | 3300053085 | Ga0495619_0002869 | Ga0495619_0002869_5014_5859 | 281 |
| 298 | 3300053104 | Ga0500556_0054279 | Ga0500556_0054279_467_1312 | 281 |
| 299 | 3300053119 | Ga0500595_001500 | Ga0500595_001500_8347_9192 | 281 |
| 300 | 3300053139 | Ga0500568_0001940 | Ga0500568_0001940_10863_11708 | 281 |
| 301 | 3300045976 | Ga0466967_0024628 | Ga0466967_0024628_262_1119 | 283 |
| 302 | 3300053078 | Ga0495612_0064664 | Ga0495612_0064664_479_1336 | 283 |
| 303 | 3300048929 | Ga0496126_0029068 | Ga0496126_0029068_3857_4711 | 284 |
| 304 | 3300009551 | Ga0105238_10038322 | Ga0105238_100383227 | 286 |
| 305 | 3300013105 | Ga0157369_10249440 | Ga0157369_102494401 | 286 |
| 306 | 3300001989 | JGI24739J22299_10029538 | JGI24739J22299_100295381 | 287 |
| 307 | 3300001990 | JGI24737J22298_10044505 | JGI24737J22298_100445051 | 287 |
| 308 | 3300002067 | JGI24735J21928_10008379 | JGI24735J21928_100083792 | 287 |
| 309 | 3300005577 | Ga0068857_100127839 | Ga0068857_1001278392 | 287 |
| 310 | 3300009545 | Ga0105237_10131264 | Ga0105237_101312643 | 287 |
| 311 | 3300009545 | Ga0105237_10173707 | Ga0105237_101737073 | 287 |
| 312 | 3300009551 | Ga0105238_10040481 | Ga0105238_100404813 | 287 |
| 313 | 3300010375 | Ga0105239_10116652 | Ga0105239_101166522 | 287 |
| 314 | 3300025904 | Ga0207647_10000685 | Ga0207647_100006856 | 287 |
| 315 | 3300025914 | Ga0207671_10064207 | Ga0207671_100642074 | 287 |
| 316 | 3300025924 | Ga0207694_10235262 | Ga0207694_102352622 | 287 |
| 317 | 3300025933 | Ga0207706_10086472 | Ga0207706_100864721 | 287 |
| 318 | 3300025949 | Ga0207667_10119857 | Ga0207667_101198572 | 287 |
| 319 | 3300025981 | Ga0207640_10022798 | Ga0207640_100227982 | 287 |
| 320 | 3300026078 | Ga0207702_10041050 | Ga0207702_100410504 | 287 |
| 321 | 3300026116 | Ga0207674_10009205 | Ga0207674_100092053 | 287 |
| 322 | 3300026142 | Ga0207698_10125334 | Ga0207698_101253342 | 287 |
| 323 | 3300048929 | Ga0496126_0216866 | Ga0496126_0216866_604_1554 | 287 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gop-assembly1.cif.gz_A | the beta-propeller domain of the trilobed protease from pyrococcus furiosus reveals an open velcro topology | 0.8013 | 35 | 61 |
| 2e3j-assembly1.cif.gz_A | the crystal structure of epoxide hydrolase b (rv1938) from mycobacterium tuberculosis at 2.1 angstrom | 0.7307 | 37 | 193 |
| 5xg0-assembly2.cif.gz_B | crystal structure of a novel pet hydrolase from ideonella sakaiensis 201-f6 | 0.7271 | 36 | 263 |
| 3i2h-assembly1.cif.gz_A-2 | cocaine esterase with mutation l169k, bound to dtt adduct | 0.7175 | 36 | 186 |
| 3i2g-assembly1.cif.gz_A | cocaine esterase with mutation g173q, bound to dtt adduct | 0.707 | 36 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4IK35_1_258_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7583 | 133 | 196 | 3.40.50.1820 |
| af_Q8IL54_9_192_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7533 | 38 | 185 | 3.40.50.1820 |
| af_A0A2R8QLM0_155_480_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7528 | 36 | 59 | 2.130.10.10 |
| 3oc4B03 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain | 0.7517 | 36 | 59 | 3.30.390.30 |
| af_P90848_196_338_2.30.180.10 | Mainly Beta;Roll;FAS1 domain;FAS1 domain | 0.7386 | 35 | 61 | 2.30.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0W1AKH5-F1-model_v4 | Polysaccharide deacetylase | 0.9588 | 35 | 262 |
GO:0005975
GO:0016020 GO:0016810 |
| AF-A0A401U303-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.957 | 28 | 196 |
|
| AF-A0A091B562-F1-model_v4 | Alpha/beta hydrolase | 0.9521 | 126 | 264 |
|
| AF-A0A4V1ZEX7-F1-model_v4 | deleted | 0.9483 | 71 | 262 |
|
| AF-A0A7K1T9F3-F1-model_v4 | Alpha/beta hydrolase | 0.9478 | 36 | 262 |
GO:0003847
GO:0016042 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar