F407001

General Info

Members Datasets Scaffolds Average Seq Length
323 233 320 281

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0107199|Ga0395900_0107199_247_1221
Length 324
Sequence MKRGIAVLASVCLLTAAVYVAIVKWGIVHEPLKFYDASRQRPIAVELSVRRDYQLKADEGFWKLPVAIISNGNTVKNTEYSFLANAFAARGYLVASIQQDNPSDPPLMTIPGQPYVGRIGVYKKGEANILFVLNQLKKRQPDADYDHLTLVGHSNGGDTSMYFAKMHPELVSKVVTLDNLRVPFVENAKMKILSFRSDDPNFKTDPGVLPTAAQAIKNSIDIIRTKFQHTEMSDRGPSSVKEQIQADLDKFLNSTSSSSELGPAGTDNPLIARTPPSSHAAPKQQPAANQSASDSDAQRAATPNVPSPEAESNPNMPKAGARGS

Samples

Sample ID Description Type Environment
1 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
2 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
110 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
126 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
129 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
228 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
229 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 0.93
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 0.93
Rhizoplane 7.74
Rhizosphere 77.71
Stem 0
Stem Tuber 0
Unclassified 7.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10029538 3300001989 Bacteria 1905
2 JGI24737J22298_10044505 3300001990 Bacteria 1357
3 JGI24735J21928_10008379 3300002067 Bacteria 3345
4 rootH2_10073498 3300003320 Bacteria 2290
5 rootH1_10093152 3300003323 Bacteria 1324
6 rootH1_10354076 3300003323 Bacteria 1415
7 Ga0055539_1007277 3300003752 Bacteria 1404
8 Ga0070683_100011858 3300005329 Bacteria 7553
9 Ga0070680_100288479 3300005336 Bacteria 1391
10 Ga0068868_100142676 3300005338 Bacteria 1967
11 Ga0070660_100050407 3300005339 Bacteria 3203
12 Ga0070661_100067689 3300005344 Bacteria 2624
13 Ga0070671_100040018 3300005355 Bacteria 3892
14 Ga0070659_100395531 3300005366 Bacteria 1166
15 Ga0070667_100104714 3300005367 Bacteria 2448
16 Ga0070709_10009482 3300005434 Bacteria 5372
17 Ga0070714_100084387 3300005435 Bacteria 2771
18 Ga0070713_100021640 3300005436 Bacteria 4951
19 Ga0070710_10000885 3300005437 Bacteria 14319
20 Ga0070711_100030988 3300005439 Bacteria 3546
21 Ga0070663_100265522 3300005455 Bacteria 1363
22 Ga0070678_100034501 3300005456 Bacteria 3525
23 Ga0070707_100070822 3300005468 Bacteria 3359
24 Ga0070679_100017216 3300005530 Bacteria 6990
25 Ga0070684_100024534 3300005535 Bacteria 5060
26 Ga0070684_100354921 3300005535 Bacteria 1349
27 Ga0068853_100008031 3300005539 Bacteria 8464
28 Ga0068853_100047269 3300005539 Bacteria 3692
29 Ga0068853_100484783 3300005539 Bacteria 1166
30 Ga0068853_100501317 3300005539 Bacteria 1146
31 Ga0068853_100527789 3300005539 Bacteria 1116
32 Ga0070672_100169884 3300005543 Bacteria 1813
33 Ga0068855_100039656 3300005563 Bacteria 5591
34 Ga0068855_100045924 3300005563 Bacteria 5164
35 Ga0070664_100329361 3300005564 Bacteria 1385
36 Ga0068857_100127839 3300005577 Bacteria 2290
37 Ga0068856_100000197 3300005614 Bacteria 63857
38 Ga0068856_100272160 3300005614 Bacteria 1710
39 Ga0068852_100008061 3300005616 Bacteria 7728
40 Ga0068852_100176126 3300005616 Bacteria 2008
41 Ga0068852_100215826 3300005616 Bacteria 1822
42 Ga0068852_100327691 3300005616 Bacteria 1489
43 Ga0068864_100023167 3300005618 Bacteria 5213
44 Ga0068851_10009720 3300005834 Bacteria 4479
45 Ga0068858_100439828 3300005842 Bacteria 1256
46 Ga0070717_10225148 3300006028 Bacteria 1650
47 Ga0070716_100036116 3300006173 Bacteria 2722
48 Ga0070712_100021196 3300006175 Bacteria 4263
49 Ga0070712_100184246 3300006175 Bacteria 1629
50 Ga0097621_100030055 3300006237 Bacteria 4298
51 Ga0068871_100376828 3300006358 Bacteria 1260
52 Ga0099794_10097822 3300007265 Bacteria 1462
53 Ga0099795_10135754 3300007788 Bacteria 996
54 Ga0105240_10062122 3300009093 Bacteria 4652
55 Ga0105240_10099560 3300009093 Bacteria 3538
56 Ga0105240_10217323 3300009093 Bacteria 2229
57 Ga0105240_10355699 3300009093 Bacteria 1660
58 Ga0105240_10467080 3300009093 Bacteria 1409
59 Ga0105245_10052877 3300009098 Bacteria 3644
60 Ga0105243_10157654 3300009148 Bacteria 1954
61 Ga0105242_10080404 3300009176 Bacteria 2724
62 Ga0105248_10326640 3300009177 Bacteria 1728
63 Ga0105237_10010244 3300009545 Bacteria 9985
64 Ga0105237_10011950 3300009545 Bacteria 9177
65 Ga0105237_10131264 3300009545 Bacteria 2500
66 Ga0105237_10173707 3300009545 Bacteria 2155
67 Ga0105237_10275111 3300009545 Bacteria 1686
68 Ga0105238_10026483 3300009551 Bacteria 5913
69 Ga0105238_10038322 3300009551 Bacteria 4868
70 Ga0105238_10040481 3300009551 Bacteria 4722
71 Ga0105238_10048125 3300009551 Bacteria 4298
72 Ga0105238_10273631 3300009551 Bacteria 1669
73 Ga0105239_10020271 3300010375 Bacteria 7336
74 Ga0105239_10116652 3300010375 Bacteria 2963
75 Ga0105239_10127203 3300010375 Bacteria 2833
76 Ga0105246_10093192 3300011119 Bacteria 2175
77 Ga0105246_10138730 3300011119 Bacteria 1825
78 Ga0157370_10043014 3300013104 Bacteria 4350
79 Ga0157370_10180484 3300013104 Bacteria 1962
80 Ga0157369_10249440 3300013105 Bacteria 1853
81 Ga0157374_10019257 3300013296 Bacteria 6038
82 Ga0157374_10031413 3300013296 Bacteria 4827
83 Ga0157378_10020276 3300013297 Bacteria 5846
84 Ga0163162_10020844 3300013306 Bacteria 6444
85 Ga0157372_10299500 3300013307 Bacteria 1870
86 Ga0157372_10495048 3300013307 Bacteria 1425
87 Ga0163163_10210320 3300014325 Bacteria 1994
88 Ga0157379_10167447 3300014968 Bacteria 1984
89 Ga0157376_10010309 3300014969 Bacteria 6827
90 Ga0197907_10254023 3300020069 Bacteria 1130
91 Ga0213873_10004790 3300021358 Bacteria 2552
92 Ga0213874_10006356 3300021377 Bacteria 2798
93 Ga0213876_10001294 3300021384 Bacteria 15771
94 Ga0213876_10036196 3300021384 Bacteria 2604
95 Ga0224712_10029800 3300022467 Bacteria 1964
96 Ga0224712_10030859 3300022467 Bacteria 1939
97 Ga0209677_100141 3300025253 Bacteria 66656
98 Ga0209677_101481 3300025253 Bacteria 10100
99 Ga0209233_1011133 3300025261 Bacteria 2660
100 Ga0209455_1001124 3300025272 Bacteria 12995
101 Ga0209455_1006334 3300025272 Bacteria 3507
102 Ga0209758_1043338 3300025297 Bacteria 1658
103 Ga0207692_10237904 3300025898 Bacteria 1086
104 Ga0207642_10037931 3300025899 Bacteria 2081
105 Ga0207647_10000685 3300025904 Bacteria 26588
106 Ga0207699_10009447 3300025906 Bacteria 4856
107 Ga0207699_10162054 3300025906 Bacteria 1489
108 Ga0207654_10000909 3300025911 Bacteria 16367
109 Ga0207707_10005313 3300025912 Bacteria 11255
110 Ga0207695_10008184 3300025913 Bacteria 13135
111 Ga0207695_10246015 3300025913 Bacteria 1688
112 Ga0207671_10020448 3300025914 Bacteria 5038
113 Ga0207671_10064207 3300025914 Bacteria 2729
114 Ga0207671_10196675 3300025914 Bacteria 1573
115 Ga0207693_10020092 3300025915 Bacteria 5313
116 Ga0207663_10003525 3300025916 Bacteria 7674
117 Ga0207663_10086375 3300025916 Bacteria 2069
118 Ga0207663_10123952 3300025916 Bacteria 1774
119 Ga0207660_10020237 3300025917 Bacteria 4463
120 Ga0207657_10013264 3300025919 Bacteria 8085
121 Ga0207652_10027459 3300025921 Bacteria 4743
122 Ga0207652_10330016 3300025921 Bacteria 1377
123 Ga0207694_10008135 3300025924 Bacteria 7924
124 Ga0207694_10033003 3300025924 Bacteria 3965
125 Ga0207694_10039128 3300025924 Bacteria 3648
126 Ga0207694_10235262 3300025924 Bacteria 1496
127 Ga0207687_10047184 3300025927 Bacteria 2985
128 Ga0207700_10174889 3300025928 Bacteria 1794
129 Ga0207700_10383476 3300025928 Bacteria 1229
130 Ga0207700_10455015 3300025928 Bacteria 1129
131 Ga0207664_10159070 3300025929 Bacteria 1925
132 Ga0207706_10086472 3300025933 Bacteria 2756
133 Ga0207686_10097058 3300025934 Bacteria 1960
134 Ga0207704_10338995 3300025938 Bacteria 1166
135 Ga0207665_10000989 3300025939 Bacteria 19216
136 Ga0207661_10049754 3300025944 Bacteria 3337
137 Ga0207679_10317704 3300025945 Bacteria 1347
138 Ga0207667_10026795 3300025949 Bacteria 6289
139 Ga0207667_10043944 3300025949 Bacteria 4738
140 Ga0207667_10069196 3300025949 Bacteria 3674
141 Ga0207667_10119857 3300025949 Bacteria 2711
142 Ga0207668_10183636 3300025972 Bacteria 1652
143 Ga0207640_10022798 3300025981 Bacteria 3754
144 Ga0207640_10072944 3300025981 Bacteria 2318
145 Ga0207658_10577865 3300025986 Bacteria 1008
146 Ga0207703_10303507 3300026035 Bacteria 1457
147 Ga0207639_10050338 3300026041 Bacteria 3164
148 Ga0207639_10384781 3300026041 Bacteria 1261
149 Ga0207639_10412142 3300026041 Bacteria 1220
150 Ga0207678_10148352 3300026067 Bacteria 2002
151 Ga0207702_10000026 3300026078 Bacteria 186067
152 Ga0207702_10000044 3300026078 Bacteria 149419
153 Ga0207702_10041050 3300026078 Bacteria 3879
154 Ga0207702_10220186 3300026078 Bacteria 1768
155 Ga0207674_10007755 3300026116 Bacteria 12489
156 Ga0207674_10009205 3300026116 Bacteria 11320
157 Ga0207674_10015882 3300026116 Bacteria 8252
158 Ga0207683_10037450 3300026121 Bacteria 4224
159 Ga0207698_10105188 3300026142 Bacteria 2351
160 Ga0207698_10125334 3300026142 Bacteria 2183
161 Ga0207698_10381964 3300026142 Bacteria 1340
162 Ga0207698_10393366 3300026142 Bacteria 1322
163 Ga0209813_10033084 3300027866 Bacteria 1535
164 Ga0265326_10001217 3300028558 Bacteria 9204
165 Ga0265319_1001686 3300028563 Bacteria 12764
166 Ga0265334_10001564 3300028573 Bacteria 11023
167 Ga0265323_10003591 3300028653 Bacteria 6810
168 Ga0265322_10007205 3300028654 Bacteria 3257
169 Ga0265336_10000135 3300028666 Bacteria 52478
170 Ga0265338_10000034 3300028800 Bacteria 244623
171 Ga0265324_10001198 3300029957 Bacteria 15406
172 Ga0307511_10017697 3300030521 Bacteria 6831
173 Ga0265330_10002696 3300031235 Bacteria 9591
174 Ga0265330_10025408 3300031235 Bacteria 2685
175 Ga0265328_10036359 3300031239 Bacteria 1820
176 Ga0265325_10004578 3300031241 Bacteria 8695
177 Ga0265340_10005773 3300031247 Bacteria 6844
178 Ga0265339_10010950 3300031249 Bacteria 5606
179 Ga0265331_10010689 3300031250 Bacteria 5063
180 Ga0265316_10096037 3300031344 Bacteria 2257
181 Ga0307509_10114022 3300031507 Bacteria 2698
182 Ga0265314_10009236 3300031711 Bacteria 8354
183 Ga0265314_10027041 3300031711 Bacteria 4300
184 Ga0265342_10029497 3300031712 Bacteria 3405
185 Ga0307507_10116166 3300033179 Bacteria 2162
186 Ga0316214_1016047 3300033545 Bacteria 1035
187 Ga0373954_0003228 3300035118 Bacteria 6891
188 Ga0373957_0000798 3300035120 Bacteria 8172
189 Ga0373962_0049325 3300035242 Bacteria 1210
190 Ga0373924_0003115 3300035410 Bacteria 5661
191 Ga0373927_0036832 3300035695 Bacteria 3180
192 Ga0373927_0210056 3300035695 Bacteria 1278
193 Ga0373933_0007121 3300035724 Bacteria 6089
194 Ga0373937_0086078 3300036401 Bacteria 2908
195 Ga0373937_0090738 3300036401 Bacteria 2830
196 Ga0373925_0072614 3300037068 Bacteria 2603
197 Ga0373925_0095272 3300037068 Bacteria 2280
198 Ga0395900_0107199 3300037418 Bacteria 2870
199 Ga0395900_0282950 3300037418 Bacteria 1650
200 Ga0395898_0035125 3300037466 Bacteria 4989
201 Ga0436365_0217978 3300039437 Bacteria 3993
202 Ga0436360_0618278 3300039438 Bacteria 1787
203 Ga0436363_0496256 3300039450 Bacteria 1083
204 Ga0436363_0984063 3300039450 Bacteria 5731
205 Ga0436362_0306292 3300039453 Bacteria 4387
206 Ga0466959_0266503 3300045049 Bacteria 1178
207 Ga0466967_0024628 3300045976 Bacteria 4952
208 Ga0466967_0043049 3300045976 Bacteria 3908
209 Ga0495592_0141281 3300046454 Bacteria 1674
210 Ga0495603_0091600 3300046455 Bacteria 1777
211 Ga0495629_0000356 3300046459 Bacteria 38962
212 Ga0495651_0136827 3300046462 Bacteria 1781
213 Ga0495651_0153693 3300046462 Bacteria 1655
214 Ga0495653_0003356 3300046463 Bacteria 12866
215 Ga0495580_0049034 3300046472 Bacteria 2988
216 Ga0495664_0197688 3300046477 Bacteria 1219
217 Ga0495594_0160014 3300046499 Bacteria 1280
218 Ga0495618_0011549 3300046514 Bacteria 5358
219 Ga0495652_0015405 3300046529 Bacteria 6847
220 Ga0495587_0070598 3300046536 Bacteria 2032
221 Ga0495587_0106907 3300046536 Bacteria 1609
222 Ga0495645_0004510 3300046543 Bacteria 9503
223 Ga0495622_0034588 3300046557 Bacteria 2357
224 Ga0495667_0003189 3300046559 Bacteria 10999
225 Ga0495634_0011379 3300046642 Bacteria 6482
226 Ga0495635_0002330 3300046663 Bacteria 12907
227 Ga0495588_0013854 3300046674 Bacteria 3849
228 Ga0495599_0002522 3300046678 Bacteria 10651
229 Ga0495599_0160041 3300046678 Bacteria 1392
230 Ga0495623_0025602 3300046679 Bacteria 3800
231 Ga0495646_0005144 3300046680 Bacteria 8252
232 Ga0495613_0042532 3300046689 Bacteria 3361
233 Ga0495600_0009976 3300046809 Bacteria 5884
234 Ga0495600_0336527 3300046809 Bacteria 947
235 Ga0495581_0057755 3300047315 Bacteria 2240
236 Ga0495604_0014030 3300047317 Bacteria 6390
237 Ga0495674_0016704 3300047319 Bacteria 6848
238 Ga0495672_0035061 3300047320 Bacteria 3092
239 Ga0495680_0008144 3300047322 Bacteria 9553
240 Ga0495675_0001783 3300047444 Bacteria 12829
241 Ga0495684_0003370 3300047471 Bacteria 12551
242 Ga0495593_0009502 3300047673 Bacteria 5642
243 Ga0495602_0022453 3300048088 Bacteria 6175
244 Ga0496100_0045642 3300048903 Bacteria 2813
245 Ga0496101_0084447 3300048904 Bacteria 2351
246 Ga0496102_0003787 3300048905 Bacteria 12788
247 Ga0496102_0372606 3300048905 Bacteria 1344
248 Ga0496104_0191718 3300048907 Bacteria 1955
249 Ga0496105_0485896 3300048908 Bacteria 971
250 Ga0496106_0005562 3300048909 Bacteria 9327
251 Ga0496106_0028963 3300048909 Bacteria 4127
252 Ga0496106_0135341 3300048909 Bacteria 1935
253 Ga0496107_0003377 3300048910 Bacteria 10668
254 Ga0496107_0059988 3300048910 Bacteria 2753
255 Ga0496108_0273490 3300048911 Bacteria 1470
256 Ga0496108_0285591 3300048911 Bacteria 1436
257 Ga0496109_0038544 3300048912 Bacteria 4321
258 Ga0496110_0049439 3300048913 Bacteria 3689
259 Ga0496110_0062194 3300048913 Bacteria 3297
260 Ga0496110_0405324 3300048913 Bacteria 1243
261 Ga0496112_0006158 3300048915 Bacteria 10489
262 Ga0496112_0385514 3300048915 Bacteria 1342
263 Ga0496112_0614512 3300048915 Bacteria 1018
264 Ga0496113_0100088 3300048916 Bacteria 2246
265 Ga0496114_0035225 3300048917 Bacteria 4133
266 Ga0496114_0127606 3300048917 Bacteria 2194
267 Ga0496115_0107757 3300048918 Bacteria 2288
268 Ga0496115_0398822 3300048918 Bacteria 1116
269 Ga0496117_0093306 3300048920 Bacteria 1931
270 Ga0496118_0021594 3300048921 Bacteria 5660
271 Ga0496121_0006360 3300048924 Bacteria 14719
272 Ga0496121_0105526 3300048924 Bacteria 2162
273 Ga0496124_0182164 3300048927 Bacteria 1615
274 Ga0496125_0108758 3300048928 Bacteria 2015
275 Ga0496126_0016601 3300048929 Bacteria 7358
276 Ga0496126_0029068 3300048929 Bacteria 5254
277 Ga0496126_0089940 3300048929 Bacteria 2701
278 Ga0496126_0216866 3300048929 Bacteria 1609
279 Ga0496126_0442889 3300048929 Bacteria 1047
280 Ga0496126_0447570 3300048929 Bacteria 1040
281 Ga0501031_0000543 3300049568 Bacteria 22072
282 Ga0501032_0000188 3300049569 Bacteria 51273
283 Ga0501033_0000241 3300049570 Bacteria 52500
284 Ga0501034_0000021 3300049571 Bacteria 266023
285 Ga0501036_0000697 3300049572 Bacteria 24782
286 Ga0501038_0000052 3300049574 Bacteria 94841
287 Ga0501039_0000849 3300049575 Bacteria 22069
288 Ga0501042_0067195 3300049578 Bacteria 2563
289 Ga0501043_0000033 3300049579 Bacteria 139500
290 Ga0501046_0000133 3300049580 Bacteria 79467
291 Ga0501047_0000511 3300049581 Bacteria 41841
292 Ga0501048_0001138 3300049582 Bacteria 19960
293 Ga0501067_0000045 3300049583 Bacteria 73394
294 Ga0501068_0000593 3300049584 Bacteria 18421
295 Ga0501070_0004293 3300049586 Bacteria 12253
296 Ga0501071_0421414 3300049587 Bacteria 1020
297 Ga0501072_0001192 3300049588 Bacteria 19395
298 Ga0501073_0000217 3300049589 Bacteria 37553
299 Ga0501074_0000487 3300049590 Bacteria 24178
300 Ga0501079_0001437 3300049741 Bacteria 16821
301 Ga0501080_0005479 3300049742 Bacteria 11328
302 Ga0501083_0015449 3300049744 Bacteria 5347
303 Ga0501035_0003793 3300049822 Bacteria 14399
304 Ga0501044_0000141 3300049823 Bacteria 88569
305 Ga0501045_0009267 3300049824 Bacteria 6885
306 nmdc:mga04h51_39382_c1 3300050495 Bacteria 1535
307 Ga0495612_0064664 3300053078 Bacteria 1518
308 Ga0495619_0002869 3300053085 Bacteria 11211
309 Ga0500566_0069614 3300053094 Bacteria 1977
310 Ga0500556_0054279 3300053104 Bacteria 1459
311 Ga0500595_001500 3300053119 Bacteria 12403
312 Ga0500595_003624 3300053119 Bacteria 7157
313 Ga0500559_0048240 3300053136 Bacteria 1872
314 Ga0500568_0001940 3300053139 Bacteria 12677
315 Ga0500603_015119 3300053150 Bacteria 1812
316 Ga0500638_003395 3300053162 Bacteria 5887
317 Ga0500637_0000042 3300053178 Bacteria 46215
318 Ga0501084_0002023 3300054114 Bacteria 16192
319 Ga0500661_000689 3300055283 Bacteria 6342
320 Ga0501082_0002281 3300060353 Bacteria 16799

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046678 Ga0495599_0160041 Ga0495599_0160041_277_1065 262
2 3300048920 Ga0496117_0093306 Ga0496117_0093306_525_1328 265
3 3300048921 Ga0496118_0021594 Ga0496118_0021594_1570_2373 265
4 3300005468 Ga0070707_100070822 Ga0070707_1000708224 273
5 3300005539 Ga0068853_100527789 Ga0068853_1005277891 273
6 3300007788 Ga0099795_10135754 Ga0099795_101357541 273
7 3300009093 Ga0105240_10467080 Ga0105240_104670802 273
8 3300009545 Ga0105237_10011950 Ga0105237_100119502 273
9 3300009551 Ga0105238_10026483 Ga0105238_100264835 273
10 3300010375 Ga0105239_10020271 Ga0105239_100202718 273
11 3300013296 Ga0157374_10031413 Ga0157374_100314133 273
12 3300025924 Ga0207694_10039128 Ga0207694_100391282 273
13 3300026041 Ga0207639_10050338 Ga0207639_100503384 273
14 3300035242 Ga0373962_0049325 Ga0373962_0049325_93_947 273
15 3300037068 Ga0373925_0095272 Ga0373925_0095272_551_1405 273
16 3300045049 Ga0466959_0266503 Ga0466959_0266503_188_1015 273
17 3300046455 Ga0495603_0091600 Ga0495603_0091600_900_1754 273
18 3300046472 Ga0495580_0049034 Ga0495580_0049034_1557_2411 273
19 3300046499 Ga0495594_0160014 Ga0495594_0160014_235_1089 273
20 3300046674 Ga0495588_0013854 Ga0495588_0013854_2353_3207 273
21 3300047315 Ga0495581_0057755 Ga0495581_0057755_806_1660 273
22 3300048905 Ga0496102_0372606 Ga0496102_0372606_296_1123 273
23 3300048929 Ga0496126_0442889 Ga0496126_0442889_79_939 273
24 3300007265 Ga0099794_10097822 Ga0099794_100978222 274
25 3300021377 Ga0213874_10006356 Ga0213874_100063563 274
26 3300039450 Ga0436363_0984063 Ga0436363_0984063_4369_5199 274
27 iso_pu_bacteria 2524023210 2524466063 274
28 iso_pu_bacteria 2922361189 2922362721 274
29 iso_pu_bacteria 8056681323 8056684413 274
30 3300009093 Ga0105240_10217323 Ga0105240_102173231 275
31 3300021384 Ga0213876_10036196 Ga0213876_100361964 275
32 3300025253 Ga0209677_100141 Ga0209677_10014138 275
33 3300025261 Ga0209233_1011133 Ga0209233_10111333 275
34 3300025272 Ga0209455_1006334 Ga0209455_10063343 275
35 3300025928 Ga0207700_10383476 Ga0207700_103834761 275
36 3300046477 Ga0495664_0197688 Ga0495664_0197688_174_1001 275
37 3300025938 Ga0207704_10338995 Ga0207704_103389951 276
38 3300026035 Ga0207703_10303507 Ga0207703_103035071 276
39 3300035695 Ga0373927_0210056 Ga0373927_0210056_59_889 276
40 3300048929 Ga0496126_0016601 Ga0496126_0016601_2219_3163 276
41 3300003320 rootH2_10073498 rootH2_100734983 277
42 3300003323 rootH1_10093152 rootH1_100931521 277
43 3300005842 Ga0068858_100439828 Ga0068858_1004398282 277
44 3300009177 Ga0105248_10326640 Ga0105248_103266401 277
45 3300009545 Ga0105237_10275111 Ga0105237_102751112 277
46 3300009551 Ga0105238_10048125 Ga0105238_100481255 277
47 3300013104 Ga0157370_10180484 Ga0157370_101804842 277
48 3300013307 Ga0157372_10299500 Ga0157372_102995001 277
49 3300020069 Ga0197907_10254023 Ga0197907_102540231 277
50 3300025272 Ga0209455_1001124 Ga0209455_10011249 277
51 3300025297 Ga0209758_1043338 Ga0209758_10433382 277
52 3300025914 Ga0207671_10196675 Ga0207671_101966751 277
53 3300028558 Ga0265326_10001217 Ga0265326_100012176 277
54 3300028563 Ga0265319_1001686 Ga0265319_10016865 277
55 3300028573 Ga0265334_10001564 Ga0265334_100015645 277
56 3300028653 Ga0265323_10003591 Ga0265323_100035915 277
57 3300028654 Ga0265322_10007205 Ga0265322_100072053 277
58 3300028666 Ga0265336_10000135 Ga0265336_1000013510 277
59 3300028800 Ga0265338_10000034 Ga0265338_10000034196 277
60 3300029957 Ga0265324_10001198 Ga0265324_1000119815 277
61 3300031711 Ga0265314_10027041 Ga0265314_100270415 277
62 3300045976 Ga0466967_0043049 Ga0466967_0043049_1224_2195 277
63 3300048913 Ga0496110_0405324 Ga0496110_0405324_153_986 277
64 3300048915 Ga0496112_0614512 Ga0496112_0614512_128_961 277
65 3300048927 Ga0496124_0182164 Ga0496124_0182164_548_1381 277
66 3300048928 Ga0496125_0108758 Ga0496125_0108758_208_1041 277
67 3300048929 Ga0496126_0447570 Ga0496126_0447570_121_954 277
68 3300003323 rootH1_10354076 rootH1_103540761 278
69 3300003752 Ga0055539_1007277 Ga0055539_10072772 278
70 3300005329 Ga0070683_100011858 Ga0070683_1000118586 278
71 3300005336 Ga0070680_100288479 Ga0070680_1002884791 278
72 3300005338 Ga0068868_100142676 Ga0068868_1001426761 278
73 3300005339 Ga0070660_100050407 Ga0070660_1000504071 278
74 3300005344 Ga0070661_100067689 Ga0070661_1000676893 278
75 3300005355 Ga0070671_100040018 Ga0070671_1000400183 278
76 3300005366 Ga0070659_100395531 Ga0070659_1003955311 278
77 3300005367 Ga0070667_100104714 Ga0070667_1001047143 278
78 3300005434 Ga0070709_10009482 Ga0070709_100094824 278
79 3300005435 Ga0070714_100084387 Ga0070714_1000843874 278
80 3300005436 Ga0070713_100021640 Ga0070713_1000216405 278
81 3300005437 Ga0070710_10000885 Ga0070710_1000088512 278
82 3300005439 Ga0070711_100030988 Ga0070711_1000309884 278
83 3300005455 Ga0070663_100265522 Ga0070663_1002655221 278
84 3300005456 Ga0070678_100034501 Ga0070678_1000345012 278
85 3300005530 Ga0070679_100017216 Ga0070679_1000172164 278
86 3300005535 Ga0070684_100024534 Ga0070684_1000245342 278
87 3300005535 Ga0070684_100354921 Ga0070684_1003549212 278
88 3300005539 Ga0068853_100008031 Ga0068853_1000080311 278
89 3300005539 Ga0068853_100047269 Ga0068853_1000472693 278
90 3300005539 Ga0068853_100484783 Ga0068853_1004847831 278
91 3300005539 Ga0068853_100501317 Ga0068853_1005013171 278
92 3300005543 Ga0070672_100169884 Ga0070672_1001698841 278
93 3300005563 Ga0068855_100039656 Ga0068855_1000396563 278
94 3300005563 Ga0068855_100045924 Ga0068855_1000459245 278
95 3300005564 Ga0070664_100329361 Ga0070664_1003293612 278
96 3300005614 Ga0068856_100000197 Ga0068856_10000019725 278
97 3300005614 Ga0068856_100272160 Ga0068856_1002721601 278
98 3300005616 Ga0068852_100008061 Ga0068852_1000080619 278
99 3300005616 Ga0068852_100176126 Ga0068852_1001761262 278
100 3300005616 Ga0068852_100215826 Ga0068852_1002158263 278
101 3300005616 Ga0068852_100327691 Ga0068852_1003276911 278
102 3300005618 Ga0068864_100023167 Ga0068864_1000231672 278
103 3300005834 Ga0068851_10009720 Ga0068851_100097205 278
104 3300006175 Ga0070712_100021196 Ga0070712_1000211963 278
105 3300006175 Ga0070712_100184246 Ga0070712_1001842462 278
106 3300006237 Ga0097621_100030055 Ga0097621_1000300554 278
107 3300006358 Ga0068871_100376828 Ga0068871_1003768282 278
108 3300009093 Ga0105240_10062122 Ga0105240_100621223 278
109 3300009093 Ga0105240_10099560 Ga0105240_100995603 278
110 3300009093 Ga0105240_10355699 Ga0105240_103556991 278
111 3300009098 Ga0105245_10052877 Ga0105245_100528772 278
112 3300009148 Ga0105243_10157654 Ga0105243_101576542 278
113 3300009176 Ga0105242_10080404 Ga0105242_100804042 278
114 3300009545 Ga0105237_10010244 Ga0105237_100102448 278
115 3300009551 Ga0105238_10273631 Ga0105238_102736312 278
116 3300010375 Ga0105239_10127203 Ga0105239_101272033 278
117 3300011119 Ga0105246_10093192 Ga0105246_100931922 278
118 3300011119 Ga0105246_10138730 Ga0105246_101387303 278
119 3300013104 Ga0157370_10043014 Ga0157370_100430143 278
120 3300013296 Ga0157374_10019257 Ga0157374_100192574 278
121 3300013297 Ga0157378_10020276 Ga0157378_100202765 278
122 3300013306 Ga0163162_10020844 Ga0163162_100208447 278
123 3300013307 Ga0157372_10495048 Ga0157372_104950482 278
124 3300014325 Ga0163163_10210320 Ga0163163_102103202 278
125 3300014968 Ga0157379_10167447 Ga0157379_101674472 278
126 3300014969 Ga0157376_10010309 Ga0157376_100103096 278
127 3300021358 Ga0213873_10004790 Ga0213873_100047901 278
128 3300021384 Ga0213876_10001294 Ga0213876_1000129411 278
129 3300022467 Ga0224712_10029800 Ga0224712_100298004 278
130 3300025253 Ga0209677_101481 Ga0209677_1014815 278
131 3300025898 Ga0207692_10237904 Ga0207692_102379042 278
132 3300025899 Ga0207642_10037931 Ga0207642_100379311 278
133 3300025906 Ga0207699_10009447 Ga0207699_100094474 278
134 3300025906 Ga0207699_10162054 Ga0207699_101620541 278
135 3300025911 Ga0207654_10000909 Ga0207654_100009098 278
136 3300025912 Ga0207707_10005313 Ga0207707_100053132 278
137 3300025913 Ga0207695_10008184 Ga0207695_100081848 278
138 3300025913 Ga0207695_10246015 Ga0207695_102460151 278
139 3300025914 Ga0207671_10020448 Ga0207671_100204487 278
140 3300025915 Ga0207693_10020092 Ga0207693_100200925 278
141 3300025916 Ga0207663_10003525 Ga0207663_100035254 278
142 3300025916 Ga0207663_10086375 Ga0207663_100863752 278
143 3300025916 Ga0207663_10123952 Ga0207663_101239521 278
144 3300025917 Ga0207660_10020237 Ga0207660_100202372 278
145 3300025919 Ga0207657_10013264 Ga0207657_100132647 278
146 3300025921 Ga0207652_10027459 Ga0207652_100274592 278
147 3300025921 Ga0207652_10330016 Ga0207652_103300161 278
148 3300025924 Ga0207694_10008135 Ga0207694_100081352 278
149 3300025924 Ga0207694_10033003 Ga0207694_100330031 278
150 3300025927 Ga0207687_10047184 Ga0207687_100471842 278
151 3300025928 Ga0207700_10455015 Ga0207700_104550151 278
152 3300025934 Ga0207686_10097058 Ga0207686_100970582 278
153 3300025939 Ga0207665_10000989 Ga0207665_1000098911 278
154 3300025944 Ga0207661_10049754 Ga0207661_100497544 278
155 3300025945 Ga0207679_10317704 Ga0207679_103177041 278
156 3300025949 Ga0207667_10026795 Ga0207667_100267957 278
157 3300025949 Ga0207667_10043944 Ga0207667_100439441 278
158 3300025949 Ga0207667_10069196 Ga0207667_100691962 278
159 3300025972 Ga0207668_10183636 Ga0207668_101836362 278
160 3300025981 Ga0207640_10072944 Ga0207640_100729442 278
161 3300025986 Ga0207658_10577865 Ga0207658_105778651 278
162 3300026041 Ga0207639_10384781 Ga0207639_103847811 278
163 3300026041 Ga0207639_10412142 Ga0207639_104121421 278
164 3300026067 Ga0207678_10148352 Ga0207678_101483521 278
165 3300026078 Ga0207702_10000026 Ga0207702_100000269 278
166 3300026078 Ga0207702_10000044 Ga0207702_10000044140 278
167 3300026078 Ga0207702_10220186 Ga0207702_102201863 278
168 3300026116 Ga0207674_10007755 Ga0207674_100077553 278
169 3300026116 Ga0207674_10015882 Ga0207674_100158828 278
170 3300026121 Ga0207683_10037450 Ga0207683_100374502 278
171 3300026142 Ga0207698_10105188 Ga0207698_101051883 278
172 3300026142 Ga0207698_10381964 Ga0207698_103819642 278
173 3300026142 Ga0207698_10393366 Ga0207698_103933661 278
174 3300027866 Ga0209813_10033084 Ga0209813_100330841 278
175 3300030521 Ga0307511_10017697 Ga0307511_100176975 278
176 3300031235 Ga0265330_10002696 Ga0265330_100026964 278
177 3300031235 Ga0265330_10025408 Ga0265330_100254082 278
178 3300031239 Ga0265328_10036359 Ga0265328_100363593 278
179 3300031241 Ga0265325_10004578 Ga0265325_100045789 278
180 3300031247 Ga0265340_10005773 Ga0265340_100057736 278
181 3300031249 Ga0265339_10010950 Ga0265339_100109503 278
182 3300031250 Ga0265331_10010689 Ga0265331_100106895 278
183 3300031344 Ga0265316_10096037 Ga0265316_100960373 278
184 3300031507 Ga0307509_10114022 Ga0307509_101140222 278
185 3300031711 Ga0265314_10009236 Ga0265314_100092365 278
186 3300031712 Ga0265342_10029497 Ga0265342_100294974 278
187 3300033179 Ga0307507_10116166 Ga0307507_101161661 278
188 3300033545 Ga0316214_1016047 Ga0316214_10160471 278
189 3300035695 Ga0373927_0036832 Ga0373927_0036832_1277_2113 278
190 3300036401 Ga0373937_0090738 Ga0373937_0090738_913_1752 278
191 3300037068 Ga0373925_0072614 Ga0373925_0072614_144_980 278
192 3300037418 Ga0395900_0107199 Ga0395900_0107199_247_1221 278
193 3300039438 Ga0436360_0618278 Ga0436360_0618278_691_1527 278
194 3300046557 Ga0495622_0034588 Ga0495622_0034588_1000_1836 278
195 3300048903 Ga0496100_0045642 Ga0496100_0045642_118_954 278
196 3300048904 Ga0496101_0084447 Ga0496101_0084447_1082_1918 278
197 3300048905 Ga0496102_0003787 Ga0496102_0003787_11721_12557 278
198 3300048907 Ga0496104_0191718 Ga0496104_0191718_653_1489 278
199 3300048908 Ga0496105_0485896 Ga0496105_0485896_16_918 278
200 3300048909 Ga0496106_0005562 Ga0496106_0005562_6741_7643 278
201 3300048909 Ga0496106_0028963 Ga0496106_0028963_805_1641 278
202 3300048909 Ga0496106_0135341 Ga0496106_0135341_320_1156 278
203 3300048910 Ga0496107_0003377 Ga0496107_0003377_9808_10644 278
204 3300048910 Ga0496107_0059988 Ga0496107_0059988_254_1156 278
205 3300048911 Ga0496108_0273490 Ga0496108_0273490_320_1156 278
206 3300048911 Ga0496108_0285591 Ga0496108_0285591_209_1111 278
207 3300048912 Ga0496109_0038544 Ga0496109_0038544_475_1377 278
208 3300048913 Ga0496110_0062194 Ga0496110_0062194_494_1330 278
209 3300048915 Ga0496112_0006158 Ga0496112_0006158_4295_5197 278
210 3300048916 Ga0496113_0100088 Ga0496113_0100088_256_1158 278
211 3300048917 Ga0496114_0035225 Ga0496114_0035225_906_1742 278
212 3300048917 Ga0496114_0127606 Ga0496114_0127606_648_1550 278
213 3300048918 Ga0496115_0107757 Ga0496115_0107757_14_916 278
214 3300048924 Ga0496121_0105526 Ga0496121_0105526_1035_1871 278
215 3300049568 Ga0501031_0000543 Ga0501031_0000543_1479_2342 278
216 3300049569 Ga0501032_0000188 Ga0501032_0000188_33521_34384 278
217 3300049570 Ga0501033_0000241 Ga0501033_0000241_43877_44740 278
218 3300049571 Ga0501034_0000021 Ga0501034_0000021_92420_93283 278
219 3300049572 Ga0501036_0000697 Ga0501036_0000697_20122_20985 278
220 3300049574 Ga0501038_0000052 Ga0501038_0000052_92430_93293 278
221 3300049575 Ga0501039_0000849 Ga0501039_0000849_1371_2234 278
222 3300049578 Ga0501042_0067195 Ga0501042_0067195_1646_2509 278
223 3300049579 Ga0501043_0000033 Ga0501043_0000033_11543_12406 278
224 3300049580 Ga0501046_0000133 Ga0501046_0000133_74137_75000 278
225 3300049581 Ga0501047_0000511 Ga0501047_0000511_39786_40649 278
226 3300049582 Ga0501048_0001138 Ga0501048_0001138_11326_12189 278
227 3300049583 Ga0501067_0000045 Ga0501067_0000045_50403_51266 278
228 3300049584 Ga0501068_0000593 Ga0501068_0000593_11043_11906 278
229 3300049586 Ga0501070_0004293 Ga0501070_0004293_10212_11075 278
230 3300049587 Ga0501071_0421414 Ga0501071_0421414_137_1000 278
231 3300049588 Ga0501072_0001192 Ga0501072_0001192_14505_15368 278
232 3300049589 Ga0501073_0000217 Ga0501073_0000217_24656_25519 278
233 3300049590 Ga0501074_0000487 Ga0501074_0000487_21913_22776 278
234 3300049741 Ga0501079_0001437 Ga0501079_0001437_9230_10093 278
235 3300049742 Ga0501080_0005479 Ga0501080_0005479_832_1695 278
236 3300049744 Ga0501083_0015449 Ga0501083_0015449_1516_2379 278
237 3300049822 Ga0501035_0003793 Ga0501035_0003793_1664_2527 278
238 3300049823 Ga0501044_0000141 Ga0501044_0000141_83909_84772 278
239 3300049824 Ga0501045_0009267 Ga0501045_0009267_6010_6873 278
240 3300050495 nmdc:mga04h51_39382_c1 nmdc:mga04h51_39382_c1_585_1424 278
241 3300053094 Ga0500566_0069614 Ga0500566_0069614_405_1241 278
242 3300053119 Ga0500595_003624 Ga0500595_003624_1089_1925 278
243 3300053136 Ga0500559_0048240 Ga0500559_0048240_604_1440 278
244 3300053150 Ga0500603_015119 Ga0500603_015119_436_1272 278
245 3300053162 Ga0500638_003395 Ga0500638_003395_3283_4119 278
246 3300053178 Ga0500637_0000042 Ga0500637_0000042_40140_40976 278
247 3300054114 Ga0501084_0002023 Ga0501084_0002023_10881_11744 278
248 3300055283 Ga0500661_000689 Ga0500661_000689_1118_1954 278
249 3300060353 Ga0501082_0002281 Ga0501082_0002281_10278_11141 278
250 3300022467 Ga0224712_10030859 Ga0224712_100308592 280
251 3300037418 Ga0395900_0282950 Ga0395900_0282950_292_1140 280
252 3300037466 Ga0395898_0035125 Ga0395898_0035125_3250_4098 280
253 3300048915 Ga0496112_0385514 Ga0496112_0385514_272_1120 280
254 3300006028 Ga0070717_10225148 Ga0070717_102251482 281
255 3300006173 Ga0070716_100036116 Ga0070716_1000361163 281
256 3300025928 Ga0207700_10174889 Ga0207700_101748891 281
257 3300025929 Ga0207664_10159070 Ga0207664_101590701 281
258 3300035118 Ga0373954_0003228 Ga0373954_0003228_6021_6866 281
259 3300035120 Ga0373957_0000798 Ga0373957_0000798_53_898 281
260 3300035410 Ga0373924_0003115 Ga0373924_0003115_4679_5524 281
261 3300035724 Ga0373933_0007121 Ga0373933_0007121_3400_4245 281
262 3300036401 Ga0373937_0086078 Ga0373937_0086078_241_1086 281
263 3300039437 Ga0436365_0217978 Ga0436365_0217978_2638_3486 281
264 3300039450 Ga0436363_0496256 Ga0436363_0496256_131_979 281
265 3300039453 Ga0436362_0306292 Ga0436362_0306292_2566_3414 281
266 3300046454 Ga0495592_0141281 Ga0495592_0141281_466_1311 281
267 3300046459 Ga0495629_0000356 Ga0495629_0000356_31323_32168 281
268 3300046462 Ga0495651_0136827 Ga0495651_0136827_753_1598 281
269 3300046462 Ga0495651_0153693 Ga0495651_0153693_241_1086 281
270 3300046463 Ga0495653_0003356 Ga0495653_0003356_7172_8017 281
271 3300046514 Ga0495618_0011549 Ga0495618_0011549_1043_1888 281
272 3300046529 Ga0495652_0015405 Ga0495652_0015405_2055_2900 281
273 3300046536 Ga0495587_0070598 Ga0495587_0070598_241_1086 281
274 3300046536 Ga0495587_0106907 Ga0495587_0106907_207_1052 281
275 3300046543 Ga0495645_0004510 Ga0495645_0004510_4985_5830 281
276 3300046559 Ga0495667_0003189 Ga0495667_0003189_3493_4338 281
277 3300046642 Ga0495634_0011379 Ga0495634_0011379_1913_2758 281
278 3300046663 Ga0495635_0002330 Ga0495635_0002330_6804_7649 281
279 3300046678 Ga0495599_0002522 Ga0495599_0002522_5159_6004 281
280 3300046679 Ga0495623_0025602 Ga0495623_0025602_322_1167 281
281 3300046680 Ga0495646_0005144 Ga0495646_0005144_5736_6581 281
282 3300046689 Ga0495613_0042532 Ga0495613_0042532_2474_3319 281
283 3300046809 Ga0495600_0009976 Ga0495600_0009976_3254_4099 281
284 3300046809 Ga0495600_0336527 Ga0495600_0336527_30_875 281
285 3300047317 Ga0495604_0014030 Ga0495604_0014030_276_1121 281
286 3300047319 Ga0495674_0016704 Ga0495674_0016704_1202_2047 281
287 3300047320 Ga0495672_0035061 Ga0495672_0035061_412_1257 281
288 3300047322 Ga0495680_0008144 Ga0495680_0008144_4262_5107 281
289 3300047444 Ga0495675_0001783 Ga0495675_0001783_8492_9337 281
290 3300047471 Ga0495684_0003370 Ga0495684_0003370_8215_9060 281
291 3300047673 Ga0495593_0009502 Ga0495593_0009502_190_1035 281
292 3300048088 Ga0495602_0022453 Ga0495602_0022453_241_1086 281
293 3300048913 Ga0496110_0049439 Ga0496110_0049439_165_1010 281
294 3300048918 Ga0496115_0398822 Ga0496115_0398822_119_967 281
295 3300048924 Ga0496121_0006360 Ga0496121_0006360_7226_8071 281
296 3300048929 Ga0496126_0089940 Ga0496126_0089940_78_926 281
297 3300053085 Ga0495619_0002869 Ga0495619_0002869_5014_5859 281
298 3300053104 Ga0500556_0054279 Ga0500556_0054279_467_1312 281
299 3300053119 Ga0500595_001500 Ga0500595_001500_8347_9192 281
300 3300053139 Ga0500568_0001940 Ga0500568_0001940_10863_11708 281
301 3300045976 Ga0466967_0024628 Ga0466967_0024628_262_1119 283
302 3300053078 Ga0495612_0064664 Ga0495612_0064664_479_1336 283
303 3300048929 Ga0496126_0029068 Ga0496126_0029068_3857_4711 284
304 3300009551 Ga0105238_10038322 Ga0105238_100383227 286
305 3300013105 Ga0157369_10249440 Ga0157369_102494401 286
306 3300001989 JGI24739J22299_10029538 JGI24739J22299_100295381 287
307 3300001990 JGI24737J22298_10044505 JGI24737J22298_100445051 287
308 3300002067 JGI24735J21928_10008379 JGI24735J21928_100083792 287
309 3300005577 Ga0068857_100127839 Ga0068857_1001278392 287
310 3300009545 Ga0105237_10131264 Ga0105237_101312643 287
311 3300009545 Ga0105237_10173707 Ga0105237_101737073 287
312 3300009551 Ga0105238_10040481 Ga0105238_100404813 287
313 3300010375 Ga0105239_10116652 Ga0105239_101166522 287
314 3300025904 Ga0207647_10000685 Ga0207647_100006856 287
315 3300025914 Ga0207671_10064207 Ga0207671_100642074 287
316 3300025924 Ga0207694_10235262 Ga0207694_102352622 287
317 3300025933 Ga0207706_10086472 Ga0207706_100864721 287
318 3300025949 Ga0207667_10119857 Ga0207667_101198572 287
319 3300025981 Ga0207640_10022798 Ga0207640_100227982 287
320 3300026078 Ga0207702_10041050 Ga0207702_100410504 287
321 3300026116 Ga0207674_10009205 Ga0207674_100092053 287
322 3300026142 Ga0207698_10125334 Ga0207698_101253342 287
323 3300048929 Ga0496126_0216866 Ga0496126_0216866_604_1554 287

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gop-assembly1.cif.gz_A the beta-propeller domain of the trilobed protease from pyrococcus furiosus reveals an open velcro topology 0.8013 35 61
2e3j-assembly1.cif.gz_A the crystal structure of epoxide hydrolase b (rv1938) from mycobacterium tuberculosis at 2.1 angstrom 0.7307 37 193
5xg0-assembly2.cif.gz_B crystal structure of a novel pet hydrolase from ideonella sakaiensis 201-f6 0.7271 36 263
3i2h-assembly1.cif.gz_A-2 cocaine esterase with mutation l169k, bound to dtt adduct 0.7175 36 186
3i2g-assembly1.cif.gz_A cocaine esterase with mutation g173q, bound to dtt adduct 0.707 36 186
ID Description Score Start End Superfamily
af_A0A0R4IK35_1_258_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7583 133 196 3.40.50.1820
af_Q8IL54_9_192_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7533 38 185 3.40.50.1820
af_A0A2R8QLM0_155_480_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7528 36 59 2.130.10.10
3oc4B03 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.7517 36 59 3.30.390.30
af_P90848_196_338_2.30.180.10 Mainly Beta;Roll;FAS1 domain;FAS1 domain 0.7386 35 61 2.30.180.10
ID Description Score Start End GO Terms
AF-A0A0W1AKH5-F1-model_v4 Polysaccharide deacetylase 0.9588 35 262 GO:0005975
GO:0016020
GO:0016810
AF-A0A401U303-F1-model_v4 AB hydrolase-1 domain-containing protein 0.957 28 196
AF-A0A091B562-F1-model_v4 Alpha/beta hydrolase 0.9521 126 264
AF-A0A4V1ZEX7-F1-model_v4 deleted 0.9483 71 262
AF-A0A7K1T9F3-F1-model_v4 Alpha/beta hydrolase 0.9478 36 262 GO:0003847
GO:0016042

Feature Viewer

pLDDT pTM Quality
82.78 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map