F407100

General Info

Members Datasets Scaffolds Average Seq Length
323 208 646 263

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0012354|Ga0501034_0012354_5910_6803
Length 297
Sequence MGGQEGDDEPLGAPPDGRLGAGAGGMKIATYNVNGINGRLPVLLRWLKQAKPDVVCLQELKAPEEKFPALALRDAGYGAIWHGQKSWNGVAILARGEAAPVETRRGLPGDPADLHSRYLEATVGGVTVGCLYLPNGNPAPGPKFDYKLKWLARLTKHAARLQKSKVPVVLAGDFNVIPTETDVYKPENWKTDALFLPESRAAFHKLVKQGWIDALRELHPDERVYTFWDYFRNAWPRNAGIRIDHFLLNPAVAKRLVAAGVDREVRGWEKTSDHAPVWIELKSSAPKSRKKVRKVTE

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
196 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
197 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
203 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
204 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
205 2643221638 Duganella sp. Root336D2 Isolate Unclassified
206 2643221734 Bosea sp. Root670 Isolate Unclassified
207 2842733646 Variovorax sp. R-72446 Isolate Unclassified
208 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.15
Nodule 0
Rhizoplane 2.79
Rhizosphere 69.35
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0012354 3300049571 Bacteria 8822
2 JGI25158J39367_1001886 3300002739 Bacteria 3542
3 JGI25158J39367_1005346 3300002739 Bacteria 1886
4 JGI25152J39213_1000002 3300002773 Bacteria 219237
5 JGI25152J39213_1017356 3300002773 Bacteria 1361
6 JGI25150J39212_1000353 3300002774 Bacteria 22643
7 JGI25150J39212_1004683 3300002774 Bacteria 3008
8 JGI25159J45721_1000898 3300002987 Bacteria 12949
9 JGI25159J45721_1004396 3300002987 Bacteria 4688
10 JGI25165J46597_1000013 3300003214 Bacteria 402100
11 JGI25153J46596_10002515 3300003215 Bacteria 10526
12 JGI25161J50226_1000715 3300003374 Bacteria 12929
13 Ga0055526_1001002 3300003771 Bacteria 20751
14 Ga0055526_1001190 3300003771 Bacteria 18847
15 Ga0055526_1003211 3300003771 Bacteria 10555
16 Ga0055526_1006658 3300003771 Bacteria 6202
17 Ga0055537_1000027 3300003773 Bacteria 102244
18 Ga0055524_1000372 3300003775 Bacteria 39278
19 Ga0055524_1018647 3300003775 Bacteria 2401
20 Ga0055524_1021414 3300003775 Bacteria 2144
21 Ga0055534_1000019 3300003784 Bacteria 137920
22 Ga0055534_1008944 3300003784 Bacteria 2219
23 Ga0055528_1000055 3300003790 Bacteria 89917
24 Ga0055528_1004886 3300003790 Bacteria 6344
25 Ga0055530_10009265 3300003791 Bacteria 3811
26 Ga0055530_10038416 3300003791 Bacteria 1190
27 Ga0055531_10001695 3300003794 Bacteria 15819
28 Ga0055543_1000667 3300004625 Bacteria 18080
29 Ga0055543_1002196 3300004625 Bacteria 6683
30 Ga0065165_1001017 3300005262 Bacteria 34070
31 Ga0065165_1001551 3300005262 Bacteria 23972
32 Ga0065165_1003793 3300005262 Bacteria 10109
33 Ga0065714_10064560 3300005288 Bacteria 36054
34 Ga0065704_10072807 3300005289 Bacteria 7978
35 Ga0070658_10028117 3300005327 Bacteria 4513
36 Ga0070658_10034487 3300005327 Bacteria 4071
37 Ga0070658_10136420 3300005327 Bacteria 2047
38 Ga0070658_10142498 3300005327 Bacteria 2002
39 Ga0070658_10343211 3300005327 Bacteria 1277
40 Ga0070683_100055106 3300005329 Bacteria 3689
41 Ga0070683_100426740 3300005329 Bacteria 1265
42 Ga0070677_10000029 3300005333 Bacteria 42300
43 Ga0070666_10121758 3300005335 Bacteria 1809
44 Ga0070680_100168212 3300005336 Bacteria 1844
45 Ga0070680_100569609 3300005336 Bacteria 971
46 Ga0070660_100018796 3300005339 Bacteria 5056
47 Ga0070660_100024157 3300005339 Bacteria 4508
48 Ga0070660_100486651 3300005339 Bacteria 1026
49 Ga0070689_100394366 3300005340 Bacteria 1169
50 Ga0070692_10006775 3300005345 Bacteria 4999
51 Ga0070668_100017364 3300005347 Bacteria 5389
52 Ga0070668_100041710 3300005347 Bacteria 3516
53 Ga0070669_100018292 3300005353 Bacteria 5008
54 Ga0070669_100443411 3300005353 Bacteria 1069
55 Ga0070675_100014706 3300005354 Bacteria 6174
56 Ga0070671_100007611 3300005355 Bacteria 8663
57 Ga0070671_100257999 3300005355 Bacteria 1481
58 Ga0070673_100137798 3300005364 Bacteria 2056
59 Ga0070673_100275413 3300005364 Bacteria 1474
60 Ga0070659_100049997 3300005366 Bacteria 3288
61 Ga0070711_100107707 3300005439 Bacteria 2040
62 Ga0070663_100048820 3300005455 Bacteria 3003
63 Ga0070662_100008501 3300005457 Bacteria 6700
64 Ga0070681_10084471 3300005458 Bacteria 3127
65 Ga0070681_10185189 3300005458 Bacteria 2003
66 Ga0070681_10240816 3300005458 Bacteria 1723
67 Ga0070679_100032548 3300005530 Bacteria 5158
68 Ga0070679_100044439 3300005530 Bacteria 4426
69 Ga0070679_100087348 3300005530 Bacteria 3105
70 Ga0070679_100419460 3300005530 Bacteria 1284
71 Ga0070679_100436615 3300005530 Bacteria 1254
72 Ga0070684_100182519 3300005535 Bacteria 1908
73 Ga0070672_100001685 3300005543 Bacteria 13779
74 Ga0070665_100670375 3300005548 Bacteria 1050
75 Ga0070704_100003187 3300005549 Bacteria 9379
76 Ga0068855_100025618 3300005563 Bacteria 7055
77 Ga0068855_100208652 3300005563 Bacteria 2196
78 Ga0070664_100121412 3300005564 Bacteria 2288
79 Ga0068854_100138697 3300005578 Bacteria 1864
80 Ga0068856_100022099 3300005614 Bacteria 6186
81 Ga0068856_100036265 3300005614 Bacteria 4835
82 Ga0068856_100038866 3300005614 Bacteria 4672
83 Ga0068856_100072854 3300005614 Bacteria 3401
84 Ga0068852_100007647 3300005616 Bacteria 7903
85 Ga0068852_100041154 3300005616 Bacteria 3903
86 Ga0068859_100437064 3300005617 Bacteria 1405
87 Ga0068864_100077720 3300005618 Bacteria 2903
88 Ga0068861_100013732 3300005719 Bacteria 5671
89 Ga0068861_100041229 3300005719 Bacteria 3457
90 Ga0068858_100380551 3300005842 Bacteria 1354
91 Ga0068860_100014946 3300005843 Bacteria 7589
92 Ga0068860_100033228 3300005843 Bacteria 4952
93 Ga0068860_100033926 3300005843 Bacteria 4896
94 Ga0097621_100183289 3300006237 Bacteria 1810
95 Ga0075370_10006286 3300006353 Bacteria 5964
96 Ga0068871_100093571 3300006358 Bacteria 2508
97 Ga0075430_100028664 3300006846 Bacteria 4728
98 Ga0075436_100030601 3300006914 Bacteria 3704
99 Ga0097620_100437035 3300006931 Bacteria 1405
100 Ga0105240_10028621 3300009093 Bacteria 7273
101 Ga0105240_10073044 3300009093 Bacteria 4237
102 Ga0105240_10166690 3300009093 Bacteria 2612
103 Ga0105240_10797557 3300009093 Bacteria 1023
104 Ga0111539_10139001 3300009094 Bacteria 2844
105 Ga0105241_10367697 3300009174 Bacteria 1253
106 Ga0105248_10090483 3300009177 Bacteria 3446
107 Ga0105237_10041514 3300009545 Bacteria 4639
108 Ga0105238_10003838 3300009551 Bacteria 14926
109 Ga0105239_10453120 3300010375 Bacteria 1456
110 Ga0157373_10137675 3300013100 Bacteria 1717
111 Ga0157371_10009845 3300013102 Bacteria 7489
112 Ga0157371_10099538 3300013102 Bacteria 2062
113 Ga0157370_10000155 3300013104 Bacteria 84680
114 Ga0157370_10022575 3300013104 Bacteria 6262
115 Ga0157370_10115573 3300013104 Bacteria 2506
116 Ga0157370_10230337 3300013104 Bacteria 1715
117 Ga0157369_10403752 3300013105 Bacteria 1418
118 Ga0163162_10049569 3300013306 Bacteria 4209
119 Ga0163162_10055459 3300013306 Bacteria 3990
120 Ga0157372_10111706 3300013307 Bacteria 3131
121 Ga0157372_10149691 3300013307 Bacteria 2693
122 Ga0157375_10088176 3300013308 Bacteria 3157
123 Ga0157380_10003879 3300014326 Bacteria 10314
124 Ga0157380_10054767 3300014326 Bacteria 3166
125 Ga0182008_10030039 3300014497 Bacteria 2742
126 Ga0157379_10285105 3300014968 Bacteria 1503
127 Ga0157379_10285898 3300014968 Bacteria 1501
128 Ga0157379_10373069 3300014968 Bacteria 1308
129 Ga0157376_10038224 3300014969 Bacteria 3904
130 Ga0157376_10075901 3300014969 Bacteria 2870
131 Ga0163161_10002604 3300017792 Bacteria 12862
132 Ga0163161_10036280 3300017792 Bacteria 3530
133 Ga0213876_10092122 3300021384 Bacteria 1605
134 Ga0209436_102410 3300025208 Bacteria 5658
135 Ga0209436_110203 3300025208 Bacteria 1733
136 Ga0207427_104155 3300025231 Bacteria 2576
137 Ga0207425_1000001 3300025245 Bacteria 2525432
138 Ga0207425_1000115 3300025245 Bacteria 76109
139 Ga0207425_1000790 3300025245 Bacteria 16150
140 Ga0209129_1000001 3300025258 Bacteria 1452436
141 Ga0209233_1000013 3300025261 Bacteria 1013785
142 Ga0209565_1000017 3300025263 Bacteria 462438
143 Ga0209565_1000233 3300025263 Bacteria 60923
144 Ga0209565_1000323 3300025263 Bacteria 43012
145 Ga0209565_1001356 3300025263 Bacteria 11045
146 Ga0209565_1002739 3300025263 Bacteria 6119
147 Ga0209565_1023501 3300025263 Bacteria 1265
148 Ga0209673_1000007 3300025273 Bacteria 634477
149 Ga0209130_1000055 3300025284 Bacteria 211696
150 Ga0209130_1000630 3300025284 Bacteria 33099
151 Ga0209675_1000009 3300025291 Bacteria 562872
152 Ga0209675_1007118 3300025291 Bacteria 4350
153 Ga0209564_1000036 3300025295 Bacteria 423455
154 Ga0209564_1000055 3300025295 Bacteria 343782
155 Ga0209564_1001991 3300025295 Bacteria 17896
156 Ga0209564_1002221 3300025295 Bacteria 16087
157 Ga0209564_1008887 3300025295 Bacteria 4881
158 Ga0209758_1000020 3300025297 Bacteria 734220
159 Ga0209758_1036630 3300025297 Bacteria 1911
160 Ga0209050_1001631 3300025298 Bacteria 22996
161 Ga0209050_1002661 3300025298 Bacteria 14602
162 Ga0209050_1011508 3300025298 Bacteria 4183
163 Ga0209256_1000028 3300025299 Bacteria 420213
164 Ga0209256_1000091 3300025299 Bacteria 210945
165 Ga0209256_1007370 3300025299 Bacteria 5454
166 Ga0207426_1005702 3300025302 Bacteria 5617
167 Ga0207426_1011387 3300025302 Bacteria 3392
168 Ga0209257_1001449 3300025304 Bacteria 28048
169 Ga0209257_1006197 3300025304 Bacteria 7852
170 Ga0207653_10052454 3300025885 Bacteria 1360
171 Ga0207688_10202419 3300025901 Bacteria 1191
172 Ga0207680_10058150 3300025903 Bacteria 2342
173 Ga0207699_10077027 3300025906 Bacteria 2056
174 Ga0207705_10000946 3300025909 Bacteria 23719
175 Ga0207705_10003701 3300025909 Bacteria 11638
176 Ga0207705_10043783 3300025909 Bacteria 3216
177 Ga0207707_10067106 3300025912 Bacteria 3125
178 Ga0207707_10134067 3300025912 Bacteria 2166
179 Ga0207695_10020161 3300025913 Bacteria 7646
180 Ga0207695_10022362 3300025913 Bacteria 7180
181 Ga0207695_10082074 3300025913 Bacteria 3261
182 Ga0207671_10063974 3300025914 Bacteria 2734
183 Ga0207660_10277699 3300025917 Bacteria 1329
184 Ga0207657_10015111 3300025919 Bacteria 7498
185 Ga0207657_10016835 3300025919 Bacteria 7038
186 Ga0207657_10310232 3300025919 Bacteria 1249
187 Ga0207649_10062391 3300025920 Bacteria 2350
188 Ga0207652_10030464 3300025921 Bacteria 4519
189 Ga0207652_10031422 3300025921 Bacteria 4460
190 Ga0207681_10000372 3300025923 Bacteria 31712
191 Ga0207694_10146409 3300025924 Bacteria 1901
192 Ga0207650_10197351 3300025925 Bacteria 1610
193 Ga0207659_10015033 3300025926 Bacteria 5005
194 Ga0207700_10079589 3300025928 Bacteria 2553
195 Ga0207644_10004914 3300025931 Bacteria 8713
196 Ga0207690_10097363 3300025932 Bacteria 2093
197 Ga0207706_10003602 3300025933 Bacteria 14787
198 Ga0207669_10110204 3300025937 Bacteria 1843
199 Ga0207665_10006054 3300025939 Bacteria 8035
200 Ga0207691_10002365 3300025940 Bacteria 18475
201 Ga0207691_10041838 3300025940 Bacteria 4227
202 Ga0207711_10054582 3300025941 Bacteria 3429
203 Ga0207711_10130398 3300025941 Bacteria 2254
204 Ga0207661_10271082 3300025944 Bacteria 1515
205 Ga0207667_10003395 3300025949 Bacteria 19649
206 Ga0207667_10242272 3300025949 Bacteria 1845
207 Ga0207651_10520834 3300025960 Bacteria 1030
208 Ga0207668_10010359 3300025972 Bacteria 5633
209 Ga0207668_10091464 3300025972 Bacteria 2236
210 Ga0207640_10118464 3300025981 Bacteria 1892
211 Ga0207658_10226393 3300025986 Bacteria 1576
212 Ga0207703_10484375 3300026035 Bacteria 1159
213 Ga0207678_10036559 3300026067 Bacteria 4275
214 Ga0207678_10071256 3300026067 Bacteria 2980
215 Ga0207708_10141086 3300026075 Bacteria 1890
216 Ga0207702_10017610 3300026078 Bacteria 5911
217 Ga0207702_10039224 3300026078 Bacteria 3967
218 Ga0207648_10022251 3300026089 Bacteria 5696
219 Ga0207648_10080140 3300026089 Bacteria 2849
220 Ga0207676_10044026 3300026095 Bacteria 3441
221 Ga0207674_10485305 3300026116 Bacteria 1194
222 Ga0207675_100062180 3300026118 Bacteria 3486
223 Ga0207683_10178298 3300026121 Bacteria 1926
224 Ga0268266_10764296 3300028379 Bacteria 933
225 Ga0268265_10412175 3300028380 Bacteria 1252
226 Ga0268264_10028419 3300028381 Bacteria 4575
227 Ga0268264_10047779 3300028381 Unclassified 3559
228 Ga0268264_10091177 3300028381 Bacteria 2629
229 Ga0307408_100000022 3300031548 Bacteria 310242
230 Ga0307408_100001119 3300031548 Bacteria 20426
231 Ga0307408_100037865 3300031548 Bacteria 3399
232 Ga0307414_10033746 3300032004 Bacteria 3386
233 Ga0307414_10420998 3300032004 Bacteria 1165
234 Ga0373941_0024896 3300035115 Bacteria 1723
235 Ga0373953_0040319 3300035117 Bacteria 1854
236 Ga0373954_0032381 3300035118 Bacteria 2416
237 Ga0373935_0240863 3300035692 Bacteria 1263
238 Ga0373935_0274136 3300035692 Bacteria 1186
239 Ga0373937_0470182 3300036401 Bacteria 1194
240 Ga0395899_0038274 3300037312 Bacteria 3593
241 Ga0395899_0051941 3300037312 Bacteria 3040
242 Ga0395899_0122360 3300037312 Bacteria 1862
243 Ga0395900_0006824 3300037418 Bacteria 11846
244 Ga0395900_0065734 3300037418 Bacteria 3725
245 Ga0395900_0119293 3300037418 Bacteria 2707
246 Ga0395900_0296121 3300037418 Bacteria 1605
247 Ga0395898_0042711 3300037466 Bacteria 4471
248 Ga0395898_0064022 3300037466 Bacteria 3567
249 Ga0395898_0487614 3300037466 Bacteria 1172
250 Ga0395905_0020616 3300037471 Bacteria 6241
251 Ga0395905_0054386 3300037471 Bacteria 3747
252 Ga0395905_0073266 3300037471 Bacteria 3210
253 Ga0395901_0115480 3300038443 Bacteria 2819
254 Ga0395901_0139959 3300038443 Bacteria 2543
255 Ga0436365_0550838 3300039437 Bacteria 7531
256 Ga0466969_0011294 3300044656 Bacteria 4729
257 Ga0495617_000384 3300046452 Bacteria 24540
258 Ga0495590_0066774 3300046457 Bacteria 1260
259 Ga0495638_0021647 3300046460 Bacteria 4232
260 Ga0495580_0069168 3300046472 Bacteria 2467
261 Ga0495582_0015102 3300046473 Bacteria 4247
262 Ga0495585_0000406 3300046492 Bacteria 41715
263 Ga0495607_0027335 3300046501 Bacteria 3529
264 Ga0495583_0000049 3300046506 Bacteria 216069
265 Ga0495606_0112637 3300046507 Bacteria 1639
266 Ga0495608_0170847 3300046511 Bacteria 1379
267 Ga0495616_0004686 3300046513 Bacteria 8576
268 Ga0495637_0008454 3300046520 Bacteria 5056
269 Ga0495648_0000057 3300046524 Bacteria 157446
270 Ga0495587_0028617 3300046536 Bacteria 3388
271 Ga0495609_0002345 3300046538 Bacteria 11687
272 Ga0495656_0069892 3300046615 Bacteria 1557
273 Ga0495668_0000018 3300046616 Bacteria 417480
274 Ga0495668_0021825 3300046616 Bacteria 3665
275 Ga0495625_0004566 3300046660 Bacteria 13025
276 Ga0495661_0023873 3300046665 Bacteria 3964
277 Ga0495658_0001375 3300046683 Bacteria 12752
278 Ga0495669_0035732 3300046684 Bacteria 2194
279 Ga0495671_0132199 3300046692 Bacteria 1217
280 Ga0495649_0032251 3300046694 Bacteria 2887
281 Ga0495649_0231524 3300046694 Bacteria 953
282 Ga0495660_0006997 3300046810 Bacteria 6649
283 Ga0495683_0057336 3300047323 Bacteria 1936
284 Ga0495675_0098103 3300047444 Bacteria 1836
285 Ga0495677_0002839 3300047445 Bacteria 6749
286 Ga0495681_0011728 3300047470 Bacteria 5196
287 Ga0495686_0000773 3300047472 Bacteria 42004
288 Ga0495686_0008303 3300047472 Bacteria 7637
289 Ga0496102_0076347 3300048905 Bacteria 3082
290 Ga0496105_0073953 3300048908 Bacteria 2815
291 Ga0496105_0121794 3300048908 Bacteria 2151
292 Ga0496108_0313779 3300048911 Bacteria 1366
293 Ga0496110_0266886 3300048913 Bacteria 1558
294 Ga0496112_0111863 3300048915 Bacteria 2700
295 Ga0496112_0458957 3300048915 Bacteria 1211
296 Ga0496113_0012651 3300048916 Bacteria 5679
297 Ga0496115_0120136 3300048918 Bacteria 2162
298 Ga0496119_0000450 3300048922 Bacteria 56283
299 Ga0496122_0000018 3300048925 Bacteria 426350
300 Ga0496123_0000015 3300048926 Bacteria 426088
301 Ga0496124_0174426 3300048927 Bacteria 1661
302 Ga0496126_0001897 3300048929 Bacteria 30122
303 Ga0495678_051019 3300049459 Bacteria 1601
304 Ga0501034_0162725 3300049571 Bacteria 2202
305 Ga0501034_0444356 3300049571 Bacteria 1215
306 nmdc:mga05p37_1576_c1 3300050507 Bacteria 19968
307 nmdc:mga0qj67_67891_c1 3300050509 Bacteria 2841
308 nmdc:mga0n895_86710_c1 3300050512 Bacteria 3127
309 Ga0500650_0032471 3300053098 Bacteria 2378
310 Ga0500554_001903 3300053102 Bacteria 4036
311 Ga0500592_000041 3300053116 Bacteria 40085
312 Ga0500595_032705 3300053119 Bacteria 1733
313 Ga0500642_0006312 3300053130 Bacteria 3892
314 Ga0500568_0004294 3300053139 Bacteria 7644
315 Ga0500622_0000007 3300053156 Bacteria 425621
316 Ga0500622_0000013 3300053156 Bacteria 371650
317 Ga0500627_0000157 3300053158 Bacteria 20081
318 Ga0500609_010914 3300053731 Bacteria 1226
319 2643790863 2643221554 Bacteria 6603920
320 2644211782 2643221638 Bacteria 6579467
321 2644734519 2643221734 Bacteria 5365412
322 2842739115 2842733646 Bacteria 5716726
323 2842806400 2842805378 Bacteria 5385175
324 Ga0501034_0012354
325 JGI25158J39367_1001886
326 JGI25158J39367_1005346
327 JGI25152J39213_1000002
328 JGI25152J39213_1017356
329 JGI25150J39212_1000353
330 JGI25150J39212_1004683
331 JGI25159J45721_1000898
332 JGI25159J45721_1004396
333 JGI25165J46597_1000013
334 JGI25153J46596_10002515
335 JGI25161J50226_1000715
336 Ga0055526_1001002
337 Ga0055526_1001190
338 Ga0055526_1003211
339 Ga0055526_1006658
340 Ga0055537_1000027
341 Ga0055524_1000372
342 Ga0055524_1018647
343 Ga0055524_1021414
344 Ga0055534_1000019
345 Ga0055534_1008944
346 Ga0055528_1000055
347 Ga0055528_1004886
348 Ga0055530_10009265
349 Ga0055530_10038416
350 Ga0055531_10001695
351 Ga0055543_1000667
352 Ga0055543_1002196
353 Ga0065165_1001017
354 Ga0065165_1001551
355 Ga0065165_1003793
356 Ga0065714_10064560
357 Ga0065704_10072807
358 Ga0070658_10028117
359 Ga0070658_10034487
360 Ga0070658_10136420
361 Ga0070658_10142498
362 Ga0070658_10343211
363 Ga0070683_100055106
364 Ga0070683_100426740
365 Ga0070677_10000029
366 Ga0070666_10121758
367 Ga0070680_100168212
368 Ga0070680_100569609
369 Ga0070660_100018796
370 Ga0070660_100024157
371 Ga0070660_100486651
372 Ga0070689_100394366
373 Ga0070692_10006775
374 Ga0070668_100017364
375 Ga0070668_100041710
376 Ga0070669_100018292
377 Ga0070669_100443411
378 Ga0070675_100014706
379 Ga0070671_100007611
380 Ga0070671_100257999
381 Ga0070673_100137798
382 Ga0070673_100275413
383 Ga0070659_100049997
384 Ga0070711_100107707
385 Ga0070663_100048820
386 Ga0070662_100008501
387 Ga0070681_10084471
388 Ga0070681_10185189
389 Ga0070681_10240816
390 Ga0070679_100032548
391 Ga0070679_100044439
392 Ga0070679_100087348
393 Ga0070679_100419460
394 Ga0070679_100436615
395 Ga0070684_100182519
396 Ga0070672_100001685
397 Ga0070665_100670375
398 Ga0070704_100003187
399 Ga0068855_100025618
400 Ga0068855_100208652
401 Ga0070664_100121412
402 Ga0068854_100138697
403 Ga0068856_100022099
404 Ga0068856_100036265
405 Ga0068856_100038866
406 Ga0068856_100072854
407 Ga0068852_100007647
408 Ga0068852_100041154
409 Ga0068859_100437064
410 Ga0068864_100077720
411 Ga0068861_100013732
412 Ga0068861_100041229
413 Ga0068858_100380551
414 Ga0068860_100014946
415 Ga0068860_100033228
416 Ga0068860_100033926
417 Ga0097621_100183289
418 Ga0075370_10006286
419 Ga0068871_100093571
420 Ga0075430_100028664
421 Ga0075436_100030601
422 Ga0097620_100437035
423 Ga0105240_10028621
424 Ga0105240_10073044
425 Ga0105240_10166690
426 Ga0105240_10797557
427 Ga0111539_10139001
428 Ga0105241_10367697
429 Ga0105248_10090483
430 Ga0105237_10041514
431 Ga0105238_10003838
432 Ga0105239_10453120
433 Ga0157373_10137675
434 Ga0157371_10009845
435 Ga0157371_10099538
436 Ga0157370_10000155
437 Ga0157370_10022575
438 Ga0157370_10115573
439 Ga0157370_10230337
440 Ga0157369_10403752
441 Ga0163162_10049569
442 Ga0163162_10055459
443 Ga0157372_10111706
444 Ga0157372_10149691
445 Ga0157375_10088176
446 Ga0157380_10003879
447 Ga0157380_10054767
448 Ga0182008_10030039
449 Ga0157379_10285105
450 Ga0157379_10285898
451 Ga0157379_10373069
452 Ga0157376_10038224
453 Ga0157376_10075901
454 Ga0163161_10002604
455 Ga0163161_10036280
456 Ga0213876_10092122
457 Ga0209436_102410
458 Ga0209436_110203
459 Ga0207427_104155
460 Ga0207425_1000001
461 Ga0207425_1000115
462 Ga0207425_1000790
463 Ga0209129_1000001
464 Ga0209233_1000013
465 Ga0209565_1000017
466 Ga0209565_1000233
467 Ga0209565_1000323
468 Ga0209565_1001356
469 Ga0209565_1002739
470 Ga0209565_1023501
471 Ga0209673_1000007
472 Ga0209130_1000055
473 Ga0209130_1000630
474 Ga0209675_1000009
475 Ga0209675_1007118
476 Ga0209564_1000036
477 Ga0209564_1000055
478 Ga0209564_1001991
479 Ga0209564_1002221
480 Ga0209564_1008887
481 Ga0209758_1000020
482 Ga0209758_1036630
483 Ga0209050_1001631
484 Ga0209050_1002661
485 Ga0209050_1011508
486 Ga0209256_1000028
487 Ga0209256_1000091
488 Ga0209256_1007370
489 Ga0207426_1005702
490 Ga0207426_1011387
491 Ga0209257_1001449
492 Ga0209257_1006197
493 Ga0207653_10052454
494 Ga0207688_10202419
495 Ga0207680_10058150
496 Ga0207699_10077027
497 Ga0207705_10000946
498 Ga0207705_10003701
499 Ga0207705_10043783
500 Ga0207707_10067106
501 Ga0207707_10134067
502 Ga0207695_10020161
503 Ga0207695_10022362
504 Ga0207695_10082074
505 Ga0207671_10063974
506 Ga0207660_10277699
507 Ga0207657_10015111
508 Ga0207657_10016835
509 Ga0207657_10310232
510 Ga0207649_10062391
511 Ga0207652_10030464
512 Ga0207652_10031422
513 Ga0207681_10000372
514 Ga0207694_10146409
515 Ga0207650_10197351
516 Ga0207659_10015033
517 Ga0207700_10079589
518 Ga0207644_10004914
519 Ga0207690_10097363
520 Ga0207706_10003602
521 Ga0207669_10110204
522 Ga0207665_10006054
523 Ga0207691_10002365
524 Ga0207691_10041838
525 Ga0207711_10054582
526 Ga0207711_10130398
527 Ga0207661_10271082
528 Ga0207667_10003395
529 Ga0207667_10242272
530 Ga0207651_10520834
531 Ga0207668_10010359
532 Ga0207668_10091464
533 Ga0207640_10118464
534 Ga0207658_10226393
535 Ga0207703_10484375
536 Ga0207678_10036559
537 Ga0207678_10071256
538 Ga0207708_10141086
539 Ga0207702_10017610
540 Ga0207702_10039224
541 Ga0207648_10022251
542 Ga0207648_10080140
543 Ga0207676_10044026
544 Ga0207674_10485305
545 Ga0207675_100062180
546 Ga0207683_10178298
547 Ga0268266_10764296
548 Ga0268265_10412175
549 Ga0268264_10028419
550 Ga0268264_10047779
551 Ga0268264_10091177
552 Ga0307408_100000022
553 Ga0307408_100001119
554 Ga0307408_100037865
555 Ga0307414_10033746
556 Ga0307414_10420998
557 Ga0373941_0024896
558 Ga0373953_0040319
559 Ga0373954_0032381
560 Ga0373935_0240863
561 Ga0373935_0274136
562 Ga0373937_0470182
563 Ga0395899_0038274
564 Ga0395899_0051941
565 Ga0395899_0122360
566 Ga0395900_0006824
567 Ga0395900_0065734
568 Ga0395900_0119293
569 Ga0395900_0296121
570 Ga0395898_0042711
571 Ga0395898_0064022
572 Ga0395898_0487614
573 Ga0395905_0020616
574 Ga0395905_0054386
575 Ga0395905_0073266
576 Ga0395901_0115480
577 Ga0395901_0139959
578 Ga0436365_0550838
579 Ga0466969_0011294
580 Ga0495617_000384
581 Ga0495590_0066774
582 Ga0495638_0021647
583 Ga0495580_0069168
584 Ga0495582_0015102
585 Ga0495585_0000406
586 Ga0495607_0027335
587 Ga0495583_0000049
588 Ga0495606_0112637
589 Ga0495608_0170847
590 Ga0495616_0004686
591 Ga0495637_0008454
592 Ga0495648_0000057
593 Ga0495587_0028617
594 Ga0495609_0002345
595 Ga0495656_0069892
596 Ga0495668_0000018
597 Ga0495668_0021825
598 Ga0495625_0004566
599 Ga0495661_0023873
600 Ga0495658_0001375
601 Ga0495669_0035732
602 Ga0495671_0132199
603 Ga0495649_0032251
604 Ga0495649_0231524
605 Ga0495660_0006997
606 Ga0495683_0057336
607 Ga0495675_0098103
608 Ga0495677_0002839
609 Ga0495681_0011728
610 Ga0495686_0000773
611 Ga0495686_0008303
612 Ga0496102_0076347
613 Ga0496105_0073953
614 Ga0496105_0121794
615 Ga0496108_0313779
616 Ga0496110_0266886
617 Ga0496112_0111863
618 Ga0496112_0458957
619 Ga0496113_0012651
620 Ga0496115_0120136
621 Ga0496119_0000450
622 Ga0496122_0000018
623 Ga0496123_0000015
624 Ga0496124_0174426
625 Ga0496126_0001897
626 Ga0495678_051019
627 Ga0501034_0162725
628 Ga0501034_0444356
629 nmdc:mga05p37_1576_c1
630 nmdc:mga0qj67_67891_c1
631 nmdc:mga0n895_86710_c1
632 Ga0500650_0032471
633 Ga0500554_001903
634 Ga0500592_000041
635 Ga0500595_032705
636 Ga0500642_0006312
637 Ga0500568_0004294
638 Ga0500622_0000007
639 Ga0500622_0000013
640 Ga0500627_0000157
641 Ga0500609_010914
642 2643790863
643 2644211782
644 2644734519
645 2842739115
646 2842806400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

29

274

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9712 4 260
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9675 4 260
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.967 3 260
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9639 4 260
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9633 3 260
ID Description Score Start End Superfamily
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9733 3 260 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9696 3 260 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9637 4 260 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9564 4 260 3.60.10.10
af_P09030_1_268_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9513 4 260 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A6I3SU57-F1-model_v4 Exodeoxyribonuclease III (EC 3.1.11.2) 0.999 4 259 GO:0006281
GO:0008311
GO:0046872
AF-A0A2W5ADH5-F1-model_v4 Exodeoxyribonuclease III 0.9973 4 131 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A530LIU1-F1-model_v4 Exodeoxyribonuclease III 0.9972 4 100 GO:0006281
GO:0008311
AF-A0A4R3FGF6-F1-model_v4 Exodeoxyribonuclease III 0.9969 6 227 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A1G4ULC5-F1-model_v4 Exodeoxyribonuclease III 0.9966 4 185 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872

Map