F407101

General Info

Members Datasets Scaffolds Average Seq Length
323 240 207 287

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0104025|Ga0501034_0104025_698_1528
Length 265
Sequence MAAPTRSTPTGPAIALILVGVVLTLLFIAAPLIVIFDQAFAKGFAVYRDNILHGETLHAIWLTIATALVVLPVNILFGLSAAWAITKFEFPGKRLLLTVIDIPFSISPIVAGVSYLLMYGALGLVGPFLIEHDIRIMFSVPAIFLVTMFVTSPFVARELITLMQAQGREREEVAATLGASGWQMFYRVTLPNIKARVMGEFGAVSVVSGNLRGETLTLPLQVQLLYHDYNATGAFAAASVLTLLAIVTMVLKSVLERRTQHRRRP

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
4 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
5 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
6 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
7 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
8 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
9 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
10 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
11 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
12 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
13 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
14 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
15 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
16 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
17 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
18 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
19 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
20 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
21 2643221557 Ensifer sp. Root558 Isolate Unclassified
22 2643221558 Rhizobium sp. Root149 Isolate Unclassified
23 2643221568 Rhizobium sp. Root564 Isolate Unclassified
24 2643221582 Rhizobium sp. Root651 Isolate Unclassified
25 2643221607 Rhizobium sp. Root73 Isolate Unclassified
26 2643221610 Ensifer sp. Root74 Isolate Unclassified
27 2643221618 Ensifer sp. Root231 Isolate Unclassified
28 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
29 2643221626 Ensifer sp. Root31 Isolate Unclassified
30 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
31 2643221655 Ensifer sp. Root1252 Isolate Unclassified
32 2643221659 Ensifer sp. Root127 Isolate Unclassified
33 2643221668 Ensifer sp. Root423 Isolate Unclassified
34 2643221675 Ensifer sp. Root1298 Isolate Unclassified
35 2643221680 Ensifer sp. Root1312 Isolate Unclassified
36 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
37 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
38 2643221693 Rhizobium sp. Root491 Isolate Unclassified
39 2643221698 Ensifer sp. Root142 Isolate Unclassified
40 2643221712 Ensifer sp. Root258 Isolate Unclassified
41 2643221726 Ensifer sp. Root954 Isolate Unclassified
42 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
43 2738541293 Rhizobium sp. GV031 Isolate Unclassified
44 2738543024 Aminobacter sp. AP02 Isolate Unclassified
45 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
46 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
47 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
48 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
49 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
50 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
51 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
52 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
53 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
54 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
55 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
56 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
57 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
58 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
59 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
60 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
61 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
62 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
63 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
64 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
65 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
66 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
67 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
68 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
69 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
70 2842694124 Methylopila sp. R-72369 Isolate Unclassified
71 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
72 2844163670 Ensifer sp. 1H6 Isolate Unclassified
73 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
74 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
75 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
76 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
77 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
78 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
79 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
80 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
81 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
82 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
83 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
84 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
85 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
86 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
87 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
88 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
89 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
90 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
91 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
92 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
93 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
94 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
95 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
96 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
97 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
98 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
99 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
100 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
101 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
102 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
103 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
104 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
105 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
106 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
107 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
108 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
109 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
110 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
111 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
112 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
113 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
114 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
115 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
116 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
117 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
118 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
119 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
120 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
121 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
122 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
123 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
124 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
125 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
126 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
127 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
128 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
129 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
134 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
135 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
156 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
167 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
216 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
217 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
218 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
228 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
234 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
235 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
236 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
237 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
238 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
239 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
240 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 64.4
Metatranscriptomes 0
Isolates 35.6

Biome Distribution

Category Percentage (%)
Aerial Root 1.55
Bulb 0
Endosphere 26.63
Nodule 9.6
Rhizoplane 3.72
Rhizosphere 26.01
Stem 0
Stem Tuber 0
Unclassified 32.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000525 3300002737 Bacteria 28580
2 JGI25152J39213_1000256 3300002773 Bacteria 35313
3 JGI25151J46595_10000007 3300003187 Bacteria 411751
4 JGI25151J46595_10000880 3300003187 Bacteria 23701
5 JGI25151J46595_10021564 3300003187 Bacteria 2693
6 JGI25165J46597_1000632 3300003214 Bacteria 29113
7 JGI25153J46596_10000313 3300003215 Bacteria 35777
8 rootH2_10034074 3300003320 Bacteria 1298
9 Ga0055526_1002320 3300003771 Bacteria 12959
10 Ga0055524_1000633 3300003775 Bacteria 25060
11 Ga0055524_1017272 3300003775 Bacteria 2550
12 Ga0055536_1009532 3300003781 Bacteria 3999
13 Ga0055540_1005914 3300003792 Bacteria 4994
14 Ga0055531_10003683 3300003794 Bacteria 9650
15 Ga0055531_10007318 3300003794 Bacteria 6051
16 Ga0058692_1001955 3300003856 Bacteria 7181
17 Ga0058692_1002400 3300003856 Bacteria 6280
18 Ga0070668_100077750 3300005347 Bacteria 2594
19 Ga0068853_100143951 3300005539 Bacteria 2141
20 Ga0070665_100041488 3300005548 Bacteria 4626
21 Ga0081540_1044448 3300005983 Bacteria 2267
22 Ga0075368_10121599 3300006042 Bacteria 1081
23 Ga0075363_100168279 3300006048 Bacteria 1243
24 Ga0075364_10022607 3300006051 Bacteria 3973
25 Ga0075364_10034208 3300006051 Bacteria 3277
26 Ga0075364_10241844 3300006051 Bacteria 1226
27 Ga0075369_10021857 3300006186 Bacteria 2634
28 Ga0079104_1000063 3300006946 Bacteria 159519
29 Ga0099826_10000590 3300006948 Bacteria 18363
30 Ga0099826_10006096 3300006948 Bacteria 8735
31 Ga0157371_10000002 3300013102 Bacteria 665040
32 Ga0157371_10021906 3300013102 Bacteria 4689
33 Ga0157370_10000143 3300013104 Bacteria 87289
34 Ga0157369_10031956 3300013105 Bacteria 5791
35 Ga0171463_1005 3300013249 Bacteria 358236
36 Ga0183363_1026 3300015690 Bacteria 53052
37 Ga0209437_100248 3300025233 Bacteria 86351
38 Ga0207425_1000018 3300025245 Bacteria 411841
39 Ga0209129_1000026 3300025258 Bacteria 411839
40 Ga0209233_1000241 3300025261 Bacteria 90643
41 Ga0209565_1025783 3300025263 Bacteria 1185
42 Ga0209673_1020731 3300025273 Bacteria 2320
43 Ga0209130_1000345 3300025284 Bacteria 53433
44 Ga0209130_1011347 3300025284 Bacteria 2390
45 Ga0209675_1002035 3300025291 Bacteria 10790
46 Ga0209676_1006075 3300025292 Bacteria 6078
47 Ga0209025_1000035 3300025294 Bacteria 411841
48 Ga0209025_1000245 3300025294 Bacteria 127801
49 Ga0209025_1000957 3300025294 Bacteria 43532
50 Ga0209025_1001475 3300025294 Bacteria 30611
51 Ga0209025_1022228 3300025294 Bacteria 3374
52 Ga0209025_1032072 3300025294 Bacteria 2467
53 Ga0209564_1000250 3300025295 Bacteria 114790
54 Ga0209758_1000040 3300025297 Bacteria 411841
55 Ga0209758_1000105 3300025297 Bacteria 221415
56 Ga0209758_1006974 3300025297 Bacteria 7875
57 Ga0209050_1015665 3300025298 Bacteria 3163
58 Ga0209256_1000310 3300025299 Bacteria 85227
59 Ga0209256_1000623 3300025299 Bacteria 48795
60 Ga0207426_1000065 3300025302 Bacteria 353625
61 Ga0209051_1000968 3300025303 Bacteria 28047
62 Ga0209051_1001021 3300025303 Bacteria 26776
63 Ga0209257_1004715 3300025304 Bacteria 10227
64 Ga0209257_1006614 3300025304 Bacteria 7377
65 Ga0207709_10058414 3300025935 Bacteria 2397
66 Ga0207668_10109280 3300025972 Bacteria 2071
67 Ga0207639_10164903 3300026041 Bacteria 1871
68 Ga0209281_1000110 3300027111 Bacteria 215631
69 Ga0209371_1000003 3300027312 Bacteria 1122971
70 Ga0209371_1001357 3300027312 Bacteria 16945
71 Ga0209371_1001699 3300027312 Bacteria 13954
72 Ga0209282_1001047 3300027666 Bacteria 14588
73 Ga0209282_1041736 3300027666 Bacteria 2714
74 Ga0209813_10006356 3300027866 Bacteria 2916
75 Ga0268266_10005338 3300028379 Bacteria 12023
76 Ga0307515_10000556 3300028794 Bacteria 88174
77 Ga0307515_10075924 3300028794 Bacteria 4468
78 Ga0268256_1000004 3300030500 Bacteria 1122967
79 Ga0268256_1010820 3300030500 Bacteria 2931
80 Ga0307406_10275438 3300031901 Bacteria 1280
81 Ga0307412_10004557 3300031911 Bacteria 7720
82 Ga0307412_10282933 3300031911 Bacteria 1303
83 Ga0307414_10329953 3300032004 Bacteria 1302
84 Ga0439465_0025980 3300041413 Bacteria 1850
85 Ga0439431_0011473 3300041997 Bacteria 2025
86 Ga0439456_025590 3300042013 Bacteria 1254
87 Ga0495638_0007422 3300046460 Bacteria 7863
88 Ga0495610_0008097 3300046512 Bacteria 6878
89 Ga0495610_0012159 3300046512 Bacteria 5203
90 Ga0495610_0046806 3300046512 Bacteria 2132
91 Ga0495654_0000121 3300046530 Bacteria 86743
92 Ga0495633_0077288 3300046558 Bacteria 1550
93 Ga0495625_0265722 3300046660 Bacteria 1109
94 Ga0495588_0001686 3300046674 Bacteria 9404
95 Ga0495671_0019002 3300046692 Bacteria 3638
96 Ga0495673_0050422 3300047469 Bacteria 1827
97 Ga0495681_0003679 3300047470 Bacteria 10645
98 Ga0495686_0004992 3300047472 Bacteria 10668
99 Ga0496101_0008116 3300048904 Bacteria 6850
100 Ga0496101_0107628 3300048904 Bacteria 2095
101 Ga0496104_0199343 3300048907 Bacteria 1914
102 Ga0496106_0167536 3300048909 Bacteria 1740
103 Ga0496111_0001699 3300048914 Bacteria 12839
104 Ga0496113_0182213 3300048916 Bacteria 1665
105 Ga0496116_0000167 3300048919 Bacteria 132540
106 Ga0496116_0001372 3300048919 Bacteria 27550
107 Ga0496116_0001915 3300048919 Bacteria 22407
108 Ga0496116_0010207 3300048919 Bacteria 7900
109 Ga0496116_0088701 3300048919 Bacteria 1889
110 Ga0496117_0000016 3300048920 Bacteria 523642
111 Ga0496117_0008240 3300048920 Bacteria 9933
112 Ga0496117_0014330 3300048920 Bacteria 6838
113 Ga0496117_0027734 3300048920 Bacteria 4403
114 Ga0496117_0161993 3300048920 Bacteria 1309
115 Ga0496118_0002108 3300048921 Bacteria 27877
116 Ga0496118_0002721 3300048921 Bacteria 23309
117 Ga0496118_0017698 3300048921 Bacteria 6470
118 Ga0496118_0021360 3300048921 Bacteria 5700
119 Ga0496118_0047772 3300048921 Bacteria 3314
120 Ga0496119_0001369 3300048922 Bacteria 29726
121 Ga0496120_0000164 3300048923 Bacteria 111959
122 Ga0496121_0000003 3300048924 Bacteria 1191431
123 Ga0496121_0000180 3300048924 Bacteria 141128
124 Ga0496122_0000002 3300048925 Bacteria 905834
125 Ga0496122_0001100 3300048925 Bacteria 46751
126 Ga0496122_0002703 3300048925 Bacteria 24669
127 Ga0496122_0003869 3300048925 Bacteria 19213
128 Ga0496122_0013640 3300048925 Bacteria 7932
129 Ga0496122_0052564 3300048925 Bacteria 3082
130 Ga0496123_0000002 3300048926 Bacteria 1811682
131 Ga0496123_0001129 3300048926 Bacteria 39855
132 Ga0496123_0003310 3300048926 Bacteria 18254
133 Ga0496123_0012303 3300048926 Bacteria 7311
134 Ga0496123_0025365 3300048926 Bacteria 4471
135 Ga0496123_0043597 3300048926 Bacteria 3079
136 Ga0496124_0000239 3300048927 Bacteria 106633
137 Ga0496124_0000610 3300048927 Bacteria 60097
138 Ga0496124_0010543 3300048927 Bacteria 9343
139 Ga0496124_0049939 3300048927 Bacteria 3565
140 Ga0496124_0064554 3300048927 Bacteria 3055
141 Ga0496124_0100373 3300048927 Bacteria 2346
142 Ga0496125_0000200 3300048928 Bacteria 126369
143 Ga0496125_0000564 3300048928 Bacteria 63635
144 Ga0496125_0003773 3300048928 Bacteria 18023
145 Ga0496125_0006078 3300048928 Bacteria 13179
146 Ga0496125_0092036 3300048928 Bacteria 2269
147 Ga0496125_0103663 3300048928 Bacteria 2086
148 Ga0496125_0172231 3300048928 Bacteria 1453
149 Ga0496126_0000768 3300048929 Bacteria 58074
150 Ga0496126_0002716 3300048929 Bacteria 23394
151 Ga0496126_0089501 3300048929 Bacteria 2709
152 Ga0501034_0077042 3300049571 Bacteria 3340
153 Ga0501034_0104025 3300049571 Bacteria 2833
154 Ga0501034_0156713 3300049571 Bacteria 2250
155 Ga0501034_0538012 3300049571 Bacteria 1078
156 Ga0501043_0001865 3300049579 Bacteria 18055
157 Ga0501043_0013344 3300049579 Bacteria 6424
158 Ga0501046_0020720 3300049580 Bacteria 5434
159 Ga0501047_0003874 3300049581 Bacteria 14078
160 Ga0501047_0036814 3300049581 Bacteria 4730
161 Ga0501070_0205788 3300049586 Bacteria 1616
162 Ga0501072_0030714 3300049588 Bacteria 4203
163 Ga0501073_0151181 3300049589 Bacteria 1609
164 Ga0501080_0228101 3300049742 Bacteria 1703
165 Ga0501081_0354197 3300049743 Bacteria 1082
166 Ga0501083_0000420 3300049744 Bacteria 27191
167 Ga0501044_0176478 3300049823 Bacteria 2105
168 nmdc:mga03683_25413_c1 3300050489 Bacteria 2327
169 nmdc:mga03n38_38595_c1 3300050490 Bacteria 2067
170 nmdc:mga00v17_1002_c1 3300050491 Bacteria 15107
171 nmdc:mga00v17_177938_c1 3300050491 Bacteria 1372
172 nmdc:mga00v17_213339_c1 3300050491 Bacteria 1249
173 nmdc:mga00v17_53_c1 3300050491 Bacteria 72424
174 nmdc:mga0yw44_25330_c1 3300050492 Bacteria 3372
175 nmdc:mga0k408_121269_c1 3300050493 Bacteria 1549
176 nmdc:mga06z11_142177_c1 3300050494 Bacteria 1358
177 nmdc:mga04h51_50880_c1 3300050495 Bacteria 1390
178 nmdc:mga0qj67_380139_c1 3300050509 Bacteria 1140
179 nmdc:mga0sz30_6399_c1 3300050516 Bacteria 4370
180 Ga0500644_0107053 3300053088 Bacteria 1071
181 Ga0500556_0000113 3300053104 Bacteria 70501
182 Ga0500560_000068 3300053107 Bacteria 10023
183 Ga0500593_000061 3300053117 Bacteria 40152
184 Ga0500618_000171 3300053125 Bacteria 54421
185 Ga0500618_000581 3300053125 Bacteria 22578
186 Ga0500618_006862 3300053125 Bacteria 3301
187 Ga0500618_008973 3300053125 Bacteria 2753
188 Ga0500559_0006066 3300053136 Bacteria 5479
189 Ga0500559_0068597 3300053136 Bacteria 1593
190 Ga0500561_0017861 3300053137 Bacteria 1616
191 Ga0500568_0000005 3300053139 Bacteria 614296
192 Ga0500568_0000118 3300053139 Bacteria 70929
193 Ga0500568_0033255 3300053139 Bacteria 2118
194 Ga0500568_0058175 3300053139 Bacteria 1503
195 Ga0500573_0001032 3300053140 Bacteria 12865
196 Ga0500577_0037669 3300053142 Bacteria 1741
197 Ga0500604_0005081 3300053151 Bacteria 3477
198 Ga0500616_0001649 3300053153 Bacteria 20642
199 Ga0500622_0003223 3300053156 Bacteria 11096
200 Ga0500624_001293 3300053157 Bacteria 4321
201 Ga0500634_0002361 3300053161 Bacteria 7920
202 Ga0500634_0027100 3300053161 Bacteria 3123
203 Ga0500636_0000039 3300053177 Bacteria 69891
204 Ga0500636_0002615 3300053177 Bacteria 9998
205 Ga0500645_043858 3300053730 Bacteria 1316
206 Ga0501084_0004215 3300054114 Bacteria 11725
207 Ga0501082_0281849 3300060353 Bacteria 1446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041997 Ga0439431_0011473 Ga0439431_0011473_251_1162 244
2 3300049742 Ga0501080_0228101 Ga0501080_0228101_18_887 246
3 3300005539 Ga0068853_100143951 Ga0068853_1001439512 247
4 3300026041 Ga0207639_10164903 Ga0207639_101649033 247
5 3300042013 Ga0439456_025590 Ga0439456_025590_452_1231 247
6 3300003187 JGI25151J46595_10000880 JGI25151J46595_100008804 248
7 3300049580 Ga0501046_0020720 Ga0501046_0020720_2037_2906 248
8 3300049589 Ga0501073_0151181 Ga0501073_0151181_69_938 248
9 3300049743 Ga0501081_0354197 Ga0501081_0354197_16_798 248
10 3300049744 Ga0501083_0000420 Ga0501083_0000420_13944_14813 248
11 iso_pu_bacteria 2671180139 2671694537 248
12 3300025294 Ga0209025_1000957 Ga0209025_100095741 249
13 3300025297 Ga0209758_1006974 Ga0209758_10069749 249
14 3300049588 Ga0501072_0030714 Ga0501072_0030714_1061_1930 249
15 3300046660 Ga0495625_0265722 Ga0495625_0265722_72_881 250
16 3300053136 Ga0500559_0006066 Ga0500559_0006066_4270_5106 251
17 3300053139 Ga0500568_0058175 Ga0500568_0058175_503_1360 252
18 3300028794 Ga0307515_10075924 Ga0307515_100759242 253
19 3300046512 Ga0495610_0012159 Ga0495610_0012159_1057_1959 253
20 3300049571 Ga0501034_0104025 Ga0501034_0104025_698_1528 253
21 3300049581 Ga0501047_0036814 Ga0501047_0036814_353_1183 253
22 3300049586 Ga0501070_0205788 Ga0501070_0205788_705_1535 253
23 3300041413 Ga0439465_0025980 Ga0439465_0025980_1018_1839 254
24 3300050509 nmdc:mga0qj67_380139_c1 nmdc:mga0qj67_380139_c1_31_846 257
25 3300013249 Ga0171463_1005 Ga0171463_1005212 258
26 3300053161 Ga0500634_0002361 Ga0500634_0002361_6788_7627 259
27 3300048928 Ga0496125_0092036 Ga0496125_0092036_1061_1903 260
28 iso_pu_bacteria 2842694124 2842695862 260
29 3300048909 Ga0496106_0167536 Ga0496106_0167536_71_949 261
30 3300049571 Ga0501034_0156713 Ga0501034_0156713_643_1539 261
31 3300049579 Ga0501043_0013344 Ga0501043_0013344_2495_3391 261
32 3300025284 Ga0209130_1000345 Ga0209130_100034536 262
33 3300025302 Ga0207426_1000065 Ga0207426_100006574 262
34 3300046460 Ga0495638_0007422 Ga0495638_0007422_2536_3414 262
35 3300049823 Ga0501044_0176478 Ga0501044_0176478_997_1893 262
36 3300053088 Ga0500644_0107053 Ga0500644_0107053_68_946 262
37 3300053142 Ga0500577_0037669 Ga0500577_0037669_648_1526 262
38 3300053156 Ga0500622_0003223 Ga0500622_0003223_9372_10250 262
39 3300005983 Ga0081540_1044448 Ga0081540_10444482 263
40 3300031911 Ga0307412_10282933 Ga0307412_102829332 264
41 3300050491 nmdc:mga00v17_177938_c1 nmdc:mga00v17_177938_c1_171_1052 264
42 iso_pu_bacteria 2513237087 2513592556 264
43 iso_pu_bacteria 2939669807 2939670412 264
44 3300003771 Ga0055526_1002320 Ga0055526_100232013 265
45 3300003775 Ga0055524_1017272 Ga0055524_10172722 265
46 3300003794 Ga0055531_10007318 Ga0055531_100073183 265
47 3300025263 Ga0209565_1025783 Ga0209565_10257831 265
48 3300025292 Ga0209676_1006075 Ga0209676_10060753 265
49 3300025295 Ga0209564_1000250 Ga0209564_100025063 265
50 3300025299 Ga0209256_1000623 Ga0209256_100062327 265
51 3300025304 Ga0209257_1006614 Ga0209257_10066145 265
52 3300046512 Ga0495610_0046806 Ga0495610_0046806_1026_1913 265
53 3300053125 Ga0500618_006862 Ga0500618_006862_91_978 265
54 3300053153 Ga0500616_0001649 Ga0500616_0001649_17412_18311 265
55 3300003781 Ga0055536_1009532 Ga0055536_10095321 266
56 3300003794 Ga0055531_10003683 Ga0055531_100036832 266
57 3300025297 Ga0209758_1000105 Ga0209758_1000105107 266
58 3300025304 Ga0209257_1004715 Ga0209257_10047159 266
59 3300049571 Ga0501034_0538012 Ga0501034_0538012_43_933 266
60 3300053125 Ga0500618_008973 Ga0500618_008973_182_1069 266
61 3300003775 Ga0055524_1000633 Ga0055524_100063310 267
62 3300025294 Ga0209025_1032072 Ga0209025_10320722 267
63 3300025299 Ga0209256_1000310 Ga0209256_100031061 267
64 3300048919 Ga0496116_0000167 Ga0496116_0000167_3864_4757 267
65 3300048927 Ga0496124_0000239 Ga0496124_0000239_10320_11210 267
66 3300048929 Ga0496126_0000768 Ga0496126_0000768_53700_54593 267
67 3300053125 Ga0500618_000171 Ga0500618_000171_23371_24252 267
68 3300003792 Ga0055540_1005914 Ga0055540_10059145 268
69 3300006051 Ga0075364_10034208 Ga0075364_100342083 268
70 3300013102 Ga0157371_10021906 Ga0157371_100219063 268
71 3300013105 Ga0157369_10031956 Ga0157369_100319563 268
72 3300025291 Ga0209675_1002035 Ga0209675_10020354 268
73 3300025294 Ga0209025_1022228 Ga0209025_10222282 268
74 3300025298 Ga0209050_1015665 Ga0209050_10156653 268
75 3300025303 Ga0209051_1000968 Ga0209051_10009682 268
76 3300025303 Ga0209051_1001021 Ga0209051_10010216 268
77 3300048920 Ga0496117_0027734 Ga0496117_0027734_766_1659 268
78 3300048924 Ga0496121_0000003 Ga0496121_0000003_1102924_1103817 268
79 3300048925 Ga0496122_0052564 Ga0496122_0052564_1705_2598 268
80 3300048926 Ga0496123_0043597 Ga0496123_0043597_657_1550 268
81 3300048927 Ga0496124_0064554 Ga0496124_0064554_1640_2533 268
82 3300048928 Ga0496125_0000200 Ga0496125_0000200_86344_87237 268
83 iso_pu_bacteria 2919450847 2919453760 269
84 iso_pu_bacteria 8001845381 8001846710 269
85 3300049571 Ga0501034_0077042 Ga0501034_0077042_671_1540 270
86 3300049579 Ga0501043_0001865 Ga0501043_0001865_6047_6916 270
87 3300049581 Ga0501047_0003874 Ga0501047_0003874_2261_3130 270
88 3300053117 Ga0500593_000061 Ga0500593_000061_28064_28954 270
89 3300053139 Ga0500568_0000005 Ga0500568_0000005_592353_593240 270
90 3300054114 Ga0501084_0004215 Ga0501084_0004215_2316_3185 270
91 3300060353 Ga0501082_0281849 Ga0501082_0281849_511_1380 270
92 3300046512 Ga0495610_0008097 Ga0495610_0008097_906_1805 271
93 3300047469 Ga0495673_0050422 Ga0495673_0050422_756_1655 271
94 3300047472 Ga0495686_0004992 Ga0495686_0004992_5495_6394 271
95 3300053125 Ga0500618_000581 Ga0500618_000581_13988_14872 271
96 3300025284 Ga0209130_1011347 Ga0209130_10113472 272
97 iso_pu_bacteria 2582581283 2585166132 272
98 iso_pu_bacteria 2643221607 2644050736 272
99 iso_pu_bacteria 2643221618 2644110271 272
100 iso_pu_bacteria 2643221626 2644144844 272
101 iso_pu_bacteria 2643221636 2644205210 272
102 iso_pu_bacteria 2643221655 2644310165 272
103 iso_pu_bacteria 2643221659 2644336929 272
104 iso_pu_bacteria 2643221686 2644483654 272
105 iso_pu_bacteria 2643221698 2644540727 272
106 iso_pu_bacteria 2643221712 2644613105 272
107 iso_pu_bacteria 2844163670 2844165370 272
108 iso_pu_bacteria 2919100787 2919103613 272
109 iso_pu_bacteria 2941499720 2941502912 272
110 3300048922 Ga0496119_0001369 Ga0496119_0001369_26072_26953 273
111 3300048925 Ga0496122_0003869 Ga0496122_0003869_5923_6804 273
112 3300048926 Ga0496123_0003310 Ga0496123_0003310_3122_4003 273
113 3300053104 Ga0500556_0000113 Ga0500556_0000113_55412_56293 273
114 3300053730 Ga0500645_043858 Ga0500645_043858_90_971 273
115 iso_pu_bacteria 2844533157 2844533510 273
116 iso_pu_bacteria 2920822456 2920822670 273
117 3300006051 Ga0075364_10241844 Ga0075364_102418442 274
118 3300048924 Ga0496121_0000180 Ga0496121_0000180_91114_91992 274
119 3300050491 nmdc:mga00v17_213339_c1 nmdc:mga00v17_213339_c1_232_1107 274
120 iso_pu_bacteria 2582581306 2585267664 274
121 iso_pu_bacteria 2582581865 2585386723 274
122 iso_pu_bacteria 2821443989 2821447680 274
123 iso_pu_bacteria 2996310559 2996314118 274
124 iso_pu_bacteria 3003930520 3003930845 274
125 3300031911 Ga0307412_10004557 Ga0307412_100045575 275
126 iso_pu_bacteria 2537561587 2537875802 275
127 iso_pu_bacteria 2554235003 2554245391 275
128 iso_pu_bacteria 2558860242 2559296780 275
129 iso_pu_bacteria 2599185156 2599331582 275
130 iso_pu_bacteria 2599185210 2599602729 275
131 iso_pu_bacteria 2600255279 2601610350 275
132 iso_pu_bacteria 2600255308 2601747320 275
133 iso_pu_bacteria 2643221557 2643809459 275
134 iso_pu_bacteria 2643221582 2643917243 275
135 iso_pu_bacteria 2643221610 2644066855 275
136 iso_pu_bacteria 2643221623 2644129251 275
137 iso_pu_bacteria 2643221668 2644375800 275
138 iso_pu_bacteria 2643221675 2644418058 275
139 iso_pu_bacteria 2643221680 2644451313 275
140 iso_pu_bacteria 2643221693 2644520907 275
141 iso_pu_bacteria 2643221726 2644691658 275
142 iso_pu_bacteria 2738543024 2739308356 275
143 iso_pu_bacteria 2808606387 2808987233 275
144 iso_pu_bacteria 2818991439 2819557431 275
145 iso_pu_bacteria 2838675328 2838678063 275
146 iso_pu_bacteria 2838714209 2838717031 275
147 iso_pu_bacteria 2838719591 2838722358 275
148 iso_pu_bacteria 2838724970 2838727780 275
149 iso_pu_bacteria 2841846520 2841849437 275
150 iso_pu_bacteria 2841859092 2841861521 275
151 iso_pu_bacteria 2842124991 2842127814 275
152 iso_pu_bacteria 2842130223 2842132956 275
153 iso_pu_bacteria 2842152218 2842154949 275
154 iso_pu_bacteria 2842170452 2842173448 275
155 iso_pu_bacteria 2842175837 2842178570 275
156 iso_pu_bacteria 2842187318 2842190139 275
157 iso_pu_bacteria 2842211629 2842214453 275
158 iso_pu_bacteria 2842224351 2842227172 275
159 iso_pu_bacteria 2842515876 2842518213 275
160 iso_pu_bacteria 2842922631 2842923979 275
161 iso_pu_bacteria 2891373044 2891373774 275
162 iso_pu_bacteria 2899792073 2899792643 275
163 iso_pu_bacteria 2899845264 2899850087 275
164 iso_pu_bacteria 2919114240 2919117289 275
165 iso_pu_bacteria 2926754445 2926758736 275
166 iso_pu_bacteria 2926760298 2926763733 275
167 iso_pu_bacteria 2933006813 2933009668 275
168 iso_pu_bacteria 2933011516 2933013841 275
169 iso_pu_bacteria 2933594066 2933595655 275
170 iso_pu_bacteria 2979089926 2979091225 275
171 iso_pu_bacteria 2979095461 2979096749 275
172 iso_pu_bacteria 2979100975 2979102471 275
173 iso_pu_bacteria 2984509177 2984509643 275
174 iso_pu_bacteria 2984518228 2984519658 275
175 iso_pu_bacteria 2984537506 2984537981 275
176 iso_pu_bacteria 2984601300 2984604725 275
177 iso_pu_bacteria 2989349275 2989350860 275
178 iso_pu_bacteria 2996336353 2996336493 275
179 iso_pu_bacteria 650716007 650843202 275
180 iso_pu_bacteria 8002285264 8002288910 275
181 iso_pu_bacteria 8003570095 8003572777 275
182 iso_pu_bacteria 8018150411 8018152224 275
183 iso_pu_bacteria 8054558443 8054561361 275
184 3300005548 Ga0070665_100041488 Ga0070665_1000414882 276
185 3300006042 Ga0075368_10121599 Ga0075368_101215991 276
186 3300006048 Ga0075363_100168279 Ga0075363_1001682792 276
187 3300006186 Ga0075369_10021857 Ga0075369_100218573 276
188 3300013102 Ga0157371_10000002 Ga0157371_10000002267 276
189 3300013104 Ga0157370_10000143 Ga0157370_1000014320 276
190 3300025935 Ga0207709_10058414 Ga0207709_100584143 276
191 3300027866 Ga0209813_10006356 Ga0209813_100063561 276
192 3300028379 Ga0268266_10005338 Ga0268266_100053383 276
193 3300046692 Ga0495671_0019002 Ga0495671_0019002_814_1701 276
194 3300047470 Ga0495681_0003679 Ga0495681_0003679_4582_5469 276
195 3300048907 Ga0496104_0199343 Ga0496104_0199343_352_1239 276
196 3300048919 Ga0496116_0010207 Ga0496116_0010207_2263_3150 276
197 3300048920 Ga0496117_0000016 Ga0496117_0000016_125612_126499 276
198 3300048921 Ga0496118_0002108 Ga0496118_0002108_15368_16255 276
199 3300048921 Ga0496118_0021360 Ga0496118_0021360_3346_4233 276
200 3300048923 Ga0496120_0000164 Ga0496120_0000164_90795_91682 276
201 3300048925 Ga0496122_0000002 Ga0496122_0000002_126273_127160 276
202 3300048926 Ga0496123_0000002 Ga0496123_0000002_126273_127160 276
203 3300048926 Ga0496123_0000002 Ga0496123_0000002_1684523_1685410 276
204 3300048926 Ga0496123_0012303 Ga0496123_0012303_2656_3543 276
205 3300048927 Ga0496124_0049939 Ga0496124_0049939_329_1216 276
206 3300048928 Ga0496125_0006078 Ga0496125_0006078_2467_3354 276
207 3300050489 nmdc:mga03683_25413_c1 nmdc:mga03683_25413_c1_146_1033 276
208 3300050490 nmdc:mga03n38_38595_c1 nmdc:mga03n38_38595_c1_432_1319 276
209 3300050491 nmdc:mga00v17_53_c1 nmdc:mga00v17_53_c1_62671_63558 276
210 3300050492 nmdc:mga0yw44_25330_c1 nmdc:mga0yw44_25330_c1_544_1431 276
211 3300050493 nmdc:mga0k408_121269_c1 nmdc:mga0k408_121269_c1_397_1284 276
212 3300050494 nmdc:mga06z11_142177_c1 nmdc:mga06z11_142177_c1_443_1330 276
213 3300050495 nmdc:mga04h51_50880_c1 nmdc:mga04h51_50880_c1_26_913 276
214 3300050516 nmdc:mga0sz30_6399_c1 nmdc:mga0sz30_6399_c1_2417_3304 276
215 3300053107 Ga0500560_000068 Ga0500560_000068_3829_4716 276
216 3300053137 Ga0500561_0017861 Ga0500561_0017861_366_1253 276
217 3300053139 Ga0500568_0000118 Ga0500568_0000118_20568_21449 276
218 3300053151 Ga0500604_0005081 Ga0500604_0005081_900_1787 276
219 3300053161 Ga0500634_0027100 Ga0500634_0027100_431_1318 276
220 iso_pu_bacteria 2585427633 2585997300 276
221 iso_pu_bacteria 2585427634 2586001908 276
222 iso_pu_bacteria 2643221558 2643813358 276
223 iso_pu_bacteria 2775507049 2776914961 276
224 iso_pu_bacteria 2818991461 2819686593 276
225 iso_pu_bacteria 2854896431 2854897422 276
226 iso_pu_bacteria 2854916844 2854921447 276
227 iso_pu_bacteria 2989771324 2989771374 276
228 iso_pu_bacteria 8054460903 8054463569 276
229 3300028794 Ga0307515_10000556 Ga0307515_100005567 277
230 3300032004 Ga0307414_10329953 Ga0307414_103299532 277
231 3300053139 Ga0500568_0033255 Ga0500568_0033255_247_1140 277
232 iso_pu_bacteria 2510917026 2511168323 277
233 iso_pu_bacteria 2582581294 2585204699 277
234 iso_pu_bacteria 2582581304 2585258681 277
235 iso_pu_bacteria 2582581316 2585334591 277
236 iso_pu_bacteria 2585427594 2585842585 277
237 iso_pu_bacteria 2600254933 2600373504 277
238 iso_pu_bacteria 2643221568 2643858050 277
239 iso_pu_bacteria 2738541293 2738799925 277
240 iso_pu_bacteria 2821123053 2821126306 277
241 iso_pu_bacteria 2838736955 2838737218 277
242 iso_pu_bacteria 2841840854 2841842413 277
243 iso_pu_bacteria 2842140634 2842142193 277
244 iso_pu_bacteria 2857531043 2857532867 277
245 iso_pu_bacteria 2919166419 2919170985 277
246 iso_pu_bacteria 2919171160 2919173594 277
247 iso_pu_bacteria 2929138655 2929141472 277
248 iso_pu_bacteria 2978969890 2978970416 277
249 iso_pu_bacteria 2984587000 2984587444 277
250 iso_pu_bacteria 8056875544 8056876284 277
251 3300015690 Ga0183363_1026 Ga0183363_10264 278
252 3300046558 Ga0495633_0077288 Ga0495633_0077288_476_1363 278
253 3300046674 Ga0495588_0001686 Ga0495588_0001686_3717_4604 278
254 3300053157 Ga0500624_001293 Ga0500624_001293_919_1806 278
255 iso_pu_bacteria 2599185236 2599719961 278
256 iso_pu_bacteria 2791355253 2793280781 278
257 3300003187 JGI25151J46595_10021564 JGI25151J46595_100215643 279
258 3300003320 rootH2_10034074 rootH2_100340742 279
259 3300003856 Ga0058692_1001955 Ga0058692_10019554 279
260 3300003856 Ga0058692_1002400 Ga0058692_10024003 279
261 3300005347 Ga0070668_100077750 Ga0070668_1000777501 279
262 3300006948 Ga0099826_10000590 Ga0099826_100005906 279
263 3300006948 Ga0099826_10006096 Ga0099826_100060965 279
264 3300025273 Ga0209673_1020731 Ga0209673_10207312 279
265 3300025294 Ga0209025_1000245 Ga0209025_100024569 279
266 3300025294 Ga0209025_1001475 Ga0209025_10014754 279
267 3300025972 Ga0207668_10109280 Ga0207668_101092802 279
268 3300027312 Ga0209371_1000003 Ga0209371_1000003545 279
269 3300027312 Ga0209371_1001357 Ga0209371_10013575 279
270 3300027312 Ga0209371_1001699 Ga0209371_100169916 279
271 3300027666 Ga0209282_1001047 Ga0209282_10010475 279
272 3300027666 Ga0209282_1041736 Ga0209282_10417363 279
273 3300030500 Ga0268256_1000004 Ga0268256_1000004506 279
274 3300030500 Ga0268256_1010820 Ga0268256_10108202 279
275 3300048904 Ga0496101_0008116 Ga0496101_0008116_4302_5207 279
276 3300048916 Ga0496113_0182213 Ga0496113_0182213_723_1628 279
277 3300048919 Ga0496116_0001372 Ga0496116_0001372_20134_21039 279
278 3300048919 Ga0496116_0088701 Ga0496116_0088701_801_1688 279
279 3300048920 Ga0496117_0014330 Ga0496117_0014330_763_1659 279
280 3300048920 Ga0496117_0161993 Ga0496117_0161993_105_992 279
281 3300048921 Ga0496118_0047772 Ga0496118_0047772_541_1428 279
282 3300048925 Ga0496122_0001100 Ga0496122_0001100_2770_3666 279
283 3300048926 Ga0496123_0001129 Ga0496123_0001129_36840_37736 279
284 3300048927 Ga0496124_0010543 Ga0496124_0010543_1929_2825 279
285 3300048928 Ga0496125_0000564 Ga0496125_0000564_19114_20010 279
286 3300048928 Ga0496125_0003773 Ga0496125_0003773_12966_13853 279
287 3300048928 Ga0496125_0103663 Ga0496125_0103663_1136_2041 279
288 3300048928 Ga0496125_0172231 Ga0496125_0172231_450_1346 279
289 3300048929 Ga0496126_0002716 Ga0496126_0002716_4257_5153 279
290 3300053136 Ga0500559_0068597 Ga0500559_0068597_478_1368 279
291 3300053140 Ga0500573_0001032 Ga0500573_0001032_532_1428 279
292 iso_pu_bacteria 2643221689 2644501348 279
293 3300031901 Ga0307406_10275438 Ga0307406_102754382 280
294 3300048920 Ga0496117_0008240 Ga0496117_0008240_4303_5211 280
295 3300048921 Ga0496118_0017698 Ga0496118_0017698_2032_2940 280
296 3300048929 Ga0496126_0089501 Ga0496126_0089501_1159_2067 280
297 3300053177 Ga0500636_0000039 Ga0500636_0000039_19163_20044 280
298 3300053177 Ga0500636_0002615 Ga0500636_0002615_3604_4488 280
299 3300002737 JGI25162J39368_1000525 JGI25162J39368_100052517 281
300 3300002773 JGI25152J39213_1000256 JGI25152J39213_100025613 281
301 3300003187 JGI25151J46595_10000007 JGI25151J46595_1000000759 281
302 3300003214 JGI25165J46597_1000632 JGI25165J46597_100063217 281
303 3300003215 JGI25153J46596_10000313 JGI25153J46596_100003136 281
304 3300006051 Ga0075364_10022607 Ga0075364_100226075 281
305 3300006946 Ga0079104_1000063 Ga0079104_100006351 281
306 3300025233 Ga0209437_100248 Ga0209437_10024814 281
307 3300025245 Ga0207425_1000018 Ga0207425_1000018271 281
308 3300025258 Ga0209129_1000026 Ga0209129_100002658 281
309 3300025261 Ga0209233_1000241 Ga0209233_100024163 281
310 3300025294 Ga0209025_1000035 Ga0209025_100003558 281
311 3300025297 Ga0209758_1000040 Ga0209758_100004058 281
312 3300027111 Ga0209281_1000110 Ga0209281_100011052 281
313 3300046530 Ga0495654_0000121 Ga0495654_0000121_28666_29556 281
314 3300048904 Ga0496101_0107628 Ga0496101_0107628_568_1476 281
315 3300048914 Ga0496111_0001699 Ga0496111_0001699_2529_3407 281
316 3300048919 Ga0496116_0001915 Ga0496116_0001915_3621_4529 281
317 3300048921 Ga0496118_0002721 Ga0496118_0002721_20346_21254 281
318 3300048925 Ga0496122_0002703 Ga0496122_0002703_660_1553 281
319 3300048925 Ga0496122_0013640 Ga0496122_0013640_1200_2078 281
320 3300048926 Ga0496123_0025365 Ga0496123_0025365_1754_2632 281
321 3300048927 Ga0496124_0000610 Ga0496124_0000610_38784_39692 281
322 3300048927 Ga0496124_0100373 Ga0496124_0100373_649_1527 281
323 3300050491 nmdc:mga00v17_1002_c1 nmdc:mga00v17_1002_c1_1779_2657 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

74

261

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7426 20 263
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.7414 18 263
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.7377 20 269
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7317 20 263
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7279 18 254
ID Description Score Start End Superfamily
af_Q2FZR6_145_349_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8204 69 215 1.10.3720.10
af_P0AEB0_20_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7992 22 256 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.789 23 273 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7863 24 262 1.10.3720.10
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7762 22 262 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A150UHH8-F1-model_v4 Sulfate/thiosulfate transporter permease subunit 0.8535 15 225 GO:0005886
GO:0015419
AF-A0A2S5ITH2-F1-model_v4 Sulfate ABC transporter permease subunit CysW 0.8527 16 230 GO:0005886
GO:0015419
AF-A0A532B2R8-F1-model_v4 Sulfate ABC transporter permease subunit CysW 0.8469 15 227 GO:0005886
GO:0015419
AF-A0A378TLN8-F1-model_v4 Sulfate ABC transporter, permease protein CysW 0.8447 16 224 GO:0005886
GO:0015419
AF-A0A4Q3TCD8-F1-model_v4 Sulfate ABC transporter permease 0.8446 11 224 GO:0005886
GO:0015419

Feature Viewer

pLDDT pTM Quality
69.21 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map