F407124

General Info

Members Datasets Scaffolds Average Seq Length
323 217 646 109

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_994496_c1|nmdc:mga05p37_994496_c1_130_516
Length 128
Sequence VEAAVGRFATQCTAAAEHFMKMTDIPFGTTDWSTIEPTEHAGDAGFAYWRTRNFGSIRVRMVEYTPGYIANHWCSKGHILFCIEGELHTELEDGRQFVLRPGMSYQVADNAEPHRSSTERGARLFIVD

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
171 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
214 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
215 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
216 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
217 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 3.1
Rhizosphere 90.09
Stem 0
Stem Tuber 0
Unclassified 2.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_994496_c1 3300050507 Bacteria 892
2 ARcpr5yngRDRAFT_c024108 3300000043 Bacteria 520
3 JGI25157J39369_1000938 3300002741 Bacteria 13774
4 Ga0065714_10101447 3300005288 Bacteria 1635
5 Ga0065712_10076927 3300005290 Bacteria 3578
6 Ga0065715_10216980 3300005293 Bacteria 1288
7 Ga0070690_100015899 3300005330 Bacteria 4497
8 Ga0070670_100055472 3300005331 Bacteria 3401
9 Ga0070670_100063263 3300005331 Bacteria 3176
10 Ga0068869_100004112 3300005334 Bacteria 9018
11 Ga0068869_100020524 3300005334 Bacteria 4531
12 Ga0068869_100572450 3300005334 Unclassified 951
13 Ga0070666_10000008 3300005335 Bacteria 293415
14 Ga0070666_10104158 3300005335 Bacteria 1958
15 Ga0070666_11519760 3300005335 Bacteria 501
16 Ga0070682_100080791 3300005337 Bacteria 2103
17 Ga0068868_100026500 3300005338 Bacteria 4419
18 Ga0068868_100117879 3300005338 Bacteria 2163
19 Ga0068868_100723444 3300005338 Bacteria 892
20 Ga0070660_100475247 3300005339 Bacteria 1038
21 Ga0070689_100001609 3300005340 Bacteria 14410
22 Ga0070689_100462196 3300005340 Bacteria 1081
23 Ga0070691_10580120 3300005341 Bacteria 659
24 Ga0070687_100341335 3300005343 Bacteria 964
25 Ga0070661_100026498 3300005344 Bacteria 4170
26 Ga0070692_10143948 3300005345 Bacteria 1352
27 Ga0070692_10290841 3300005345 Unclassified 994
28 Ga0070668_100111749 3300005347 Bacteria 2175
29 Ga0070668_100608018 3300005347 Bacteria 957
30 Ga0070669_100023949 3300005353 Bacteria 4374
31 Ga0070669_100052643 3300005353 Bacteria 2979
32 Ga0070675_100000934 3300005354 Bacteria 20807
33 Ga0070675_100097014 3300005354 Bacteria 2478
34 Ga0070675_100266208 3300005354 Bacteria 1503
35 Ga0070674_101926252 3300005356 Bacteria 537
36 Ga0070673_100284004 3300005364 Bacteria 1452
37 Ga0070688_100233501 3300005365 Bacteria 1302
38 Ga0070688_100359398 3300005365 Bacteria 1068
39 Ga0070659_100010774 3300005366 Bacteria 6741
40 Ga0070667_100153157 3300005367 Bacteria 2027
41 Ga0070714_100083194 3300005435 Bacteria 2790
42 Ga0070713_100004662 3300005436 Bacteria 9252
43 Ga0070710_10448106 3300005437 Bacteria 874
44 Ga0070701_10015634 3300005438 Bacteria 3510
45 Ga0070711_100092759 3300005439 Bacteria 2179
46 Ga0070711_100217764 3300005439 Bacteria 1482
47 Ga0070705_100005995 3300005440 Bacteria 5944
48 Ga0070700_100265908 3300005441 Bacteria 1237
49 Ga0070694_100015502 3300005444 Bacteria 4789
50 Ga0070694_100284728 3300005444 Bacteria 1261
51 Ga0070663_100075721 3300005455 Bacteria 2460
52 Ga0070678_100359123 3300005456 Bacteria 1255
53 Ga0070678_102246534 3300005456 Bacteria 518
54 Ga0070678_102365167 3300005456 Bacteria 504
55 Ga0070662_100116934 3300005457 Bacteria 2039
56 Ga0070685_10030138 3300005466 Bacteria 3020
57 Ga0070706_100039819 3300005467 Bacteria 4338
58 Ga0070707_100364157 3300005468 Bacteria 1404
59 Ga0070679_101956804 3300005530 Bacteria 535
60 Ga0070684_100004485 3300005535 Bacteria 10627
61 Ga0068853_100229974 3300005539 Bacteria 1696
62 Ga0068853_100553445 3300005539 Bacteria 1090
63 Ga0070672_100013555 3300005543 Bacteria 5762
64 Ga0070672_100231630 3300005543 Bacteria 1552
65 Ga0070686_100004993 3300005544 Bacteria 7321
66 Ga0070686_101919937 3300005544 Bacteria 506
67 Ga0070695_100499526 3300005545 Unclassified 940
68 Ga0070693_100216791 3300005547 Bacteria 1252
69 Ga0070665_100156992 3300005548 Bacteria 2277
70 Ga0070664_100049332 3300005564 Bacteria 3560
71 Ga0068857_101195895 3300005577 Bacteria 736
72 Ga0068854_102061564 3300005578 Bacteria 526
73 Ga0068856_100003391 3300005614 Bacteria 16130
74 Ga0070702_100008624 3300005615 Bacteria 4947
75 Ga0070702_100289285 3300005615 Bacteria 1128
76 Ga0068852_102316939 3300005616 Bacteria 558
77 Ga0068859_100032933 3300005617 Bacteria 5206
78 Ga0068859_100048820 3300005617 Bacteria 4252
79 Ga0068864_100022145 3300005618 Bacteria 5327
80 Ga0068864_101356650 3300005618 Bacteria 712
81 Ga0068866_10160552 3300005718 Bacteria 1310
82 Ga0068861_100014100 3300005719 Bacteria 5604
83 Ga0068861_100055480 3300005719 Bacteria 3021
84 Ga0068861_100241025 3300005719 Bacteria 1538
85 Ga0068863_100144668 3300005841 Bacteria 2273
86 Ga0068858_100040312 3300005842 Bacteria 4330
87 Ga0068858_100106146 3300005842 Bacteria 2622
88 Ga0068860_100032207 3300005843 Bacteria 5039
89 Ga0068860_100033255 3300005843 Bacteria 4949
90 Ga0068860_100092724 3300005843 Bacteria 2878
91 Ga0068862_100002858 3300005844 Bacteria 15133
92 Ga0068862_100048049 3300005844 Bacteria 3643
93 Ga0075427_10114692 3300006194 Bacteria 509
94 Ga0097621_102235925 3300006237 Bacteria 523
95 Ga0068871_100079094 3300006358 Bacteria 2720
96 Ga0068871_102379656 3300006358 Bacteria 505
97 Ga0075428_100193009 3300006844 Bacteria 2203
98 Ga0075428_100207896 3300006844 Bacteria 2115
99 Ga0075430_100018627 3300006846 Bacteria 5908
100 Ga0075430_100080136 3300006846 Bacteria 2735
101 Ga0075430_100692615 3300006846 Bacteria 840
102 Ga0075431_100023046 3300006847 Bacteria 6365
103 Ga0075431_100477747 3300006847 Bacteria 1239
104 Ga0075433_10534622 3300006852 Bacteria 1031
105 Ga0075434_100475278 3300006871 Bacteria 1271
106 Ga0075429_100011953 3300006880 Bacteria 7526
107 Ga0075429_101551999 3300006880 Bacteria 576
108 Ga0068865_100682616 3300006881 Bacteria 876
109 Ga0068865_101758482 3300006881 Bacteria 560
110 Ga0068865_101855161 3300006881 Bacteria 545
111 Ga0097620_100032933 3300006931 Bacteria 5206
112 Ga0097620_100048820 3300006931 Bacteria 4252
113 Ga0105250_10154848 3300009092 Bacteria 955
114 Ga0105240_10001334 3300009093 Bacteria 42438
115 Ga0105240_10480048 3300009093 Bacteria 1386
116 Ga0105240_10834641 3300009093 Bacteria 996
117 Ga0111539_10153743 3300009094 Bacteria 2692
118 Ga0111539_10881511 3300009094 Bacteria 1041
119 Ga0111539_12872708 3300009094 Bacteria 558
120 Ga0105245_10393550 3300009098 Bacteria 1383
121 Ga0105245_10423357 3300009098 Bacteria 1335
122 Ga0105247_10025956 3300009101 Bacteria 3536
123 Ga0105247_10364896 3300009101 Bacteria 1019
124 Ga0105247_11627568 3300009101 Bacteria 531
125 Ga0114129_10011568 3300009147 Bacteria 12565
126 Ga0114129_10603221 3300009147 Bacteria 1422
127 Ga0105243_10021344 3300009148 Bacteria 4915
128 Ga0105241_10500890 3300009174 Unclassified 1083
129 Ga0105242_10267372 3300009176 Bacteria 1547
130 Ga0105242_10438473 3300009176 Bacteria 1228
131 Ga0105248_10019723 3300009177 Bacteria 7465
132 Ga0105248_10290319 3300009177 Bacteria 1842
133 Ga0105248_10403251 3300009177 Bacteria 1540
134 Ga0105237_10062232 3300009545 Bacteria 3732
135 Ga0105237_10305069 3300009545 Bacteria 1595
136 Ga0105238_10000576 3300009551 Bacteria 38530
137 Ga0105238_10349572 3300009551 Bacteria 1467
138 Ga0105238_10895977 3300009551 Bacteria 905
139 Ga0105249_10015667 3300009553 Bacteria 6712
140 Ga0105249_11084539 3300009553 Bacteria 871
141 Ga0105239_10010078 3300010375 Bacteria 10593
142 Ga0105239_10894965 3300010375 Bacteria 1019
143 Ga0157371_11397350 3300013102 Bacteria 544
144 Ga0157370_10023824 3300013104 Bacteria 6073
145 Ga0157370_10101637 3300013104 Bacteria 2693
146 Ga0157370_11859006 3300013104 Unclassified 540
147 Ga0157369_10811432 3300013105 Bacteria 961
148 Ga0157374_10066426 3300013296 Bacteria 3389
149 Ga0157378_10242192 3300013297 Bacteria 1723
150 Ga0163162_10002160 3300013306 Bacteria 18447
151 Ga0163162_10017958 3300013306 Bacteria 6922
152 Ga0163162_12658773 3300013306 Bacteria 576
153 Ga0157375_10046838 3300013308 Bacteria 4219
154 Ga0157375_10213723 3300013308 Bacteria 2086
155 Ga0157375_10835317 3300013308 Bacteria 1068
156 Ga0163163_10000787 3300014325 Bacteria 26884
157 Ga0163163_10450212 3300014325 Bacteria 1348
158 Ga0163163_12151032 3300014325 Bacteria 617
159 Ga0182008_10017459 3300014497 Bacteria 3723
160 Ga0157377_10000749 3300014745 Bacteria 13459
161 Ga0157379_10519736 3300014968 Bacteria 1105
162 Ga0157376_10163892 3300014969 Bacteria 2018
163 Ga0157376_10504704 3300014969 Bacteria 1189
164 Ga0157376_10816483 3300014969 Bacteria 946
165 Ga0182007_10006487 3300015262 Bacteria 5019
166 Ga0163161_10037712 3300017792 Bacteria 3465
167 Ga0163161_10875537 3300017792 Bacteria 759
168 Ga0209674_101759 3300025226 Bacteria 5259
169 Ga0209258_104774 3300025242 Bacteria 2468
170 Ga0209026_1000113 3300025250 Bacteria 139047
171 Ga0209759_1010624 3300025256 Bacteria 2686
172 Ga0207692_10084687 3300025898 Bacteria 1704
173 Ga0207642_10229310 3300025899 Bacteria 1042
174 Ga0207710_10203700 3300025900 Bacteria 978
175 Ga0207680_10000005 3300025903 Bacteria 660983
176 Ga0207680_10093726 3300025903 Bacteria 1916
177 Ga0207684_10136720 3300025910 Bacteria 2105
178 Ga0207654_10295762 3300025911 Unclassified 1099
179 Ga0207695_10003395 3300025913 Bacteria 22500
180 Ga0207695_10225427 3300025913 Bacteria 1780
181 Ga0207693_11273194 3300025915 Unclassified 551
182 Ga0207663_10256200 3300025916 Bacteria 1290
183 Ga0207660_10297109 3300025917 Bacteria 1285
184 Ga0207662_10012621 3300025918 Bacteria 4708
185 Ga0207662_10030051 3300025918 Bacteria 3151
186 Ga0207657_10555889 3300025919 Bacteria 897
187 Ga0207649_10037489 3300025920 Bacteria 2928
188 Ga0207649_11209409 3300025920 Bacteria 597
189 Ga0207681_10300260 3300025923 Bacteria 1270
190 Ga0207694_10122079 3300025924 Bacteria 2081
191 Ga0207650_10015205 3300025925 Bacteria 5356
192 Ga0207650_10785487 3300025925 Bacteria 807
193 Ga0207659_10125826 3300025926 Bacteria 1971
194 Ga0207659_10151167 3300025926 Bacteria 1813
195 Ga0207700_10012298 3300025928 Bacteria 5511
196 Ga0207690_10018142 3300025932 Bacteria 4312
197 Ga0207706_10117157 3300025933 Bacteria 2343
198 Ga0207709_10160702 3300025935 Bacteria 1566
199 Ga0207670_10037558 3300025936 Bacteria 3157
200 Ga0207670_10580535 3300025936 Bacteria 919
201 Ga0207670_11422142 3300025936 Bacteria 589
202 Ga0207669_10609526 3300025937 Bacteria 888
203 Ga0207704_10014004 3300025938 Bacteria 4037
204 Ga0207691_10015433 3300025940 Bacteria 7266
205 Ga0207711_10005371 3300025941 Bacteria 10850
206 Ga0207711_10077845 3300025941 Bacteria 2892
207 Ga0207711_10279668 3300025941 Bacteria 1537
208 Ga0207689_10030153 3300025942 Bacteria 4520
209 Ga0207679_10056910 3300025945 Bacteria 2890
210 Ga0207651_10024204 3300025960 Bacteria 3751
211 Ga0207712_10002562 3300025961 Bacteria 11682
212 Ga0207668_10017734 3300025972 Bacteria 4467
213 Ga0207668_10075919 3300025972 Bacteria 2418
214 Ga0207640_11898566 3300025981 Bacteria 539
215 Ga0207658_10328190 3300025986 Bacteria 1326
216 Ga0207677_10125814 3300026023 Bacteria 1937
217 Ga0207677_10491349 3300026023 Bacteria 1059
218 Ga0207703_10028523 3300026035 Bacteria 4401
219 Ga0207703_10088214 3300026035 Bacteria 2603
220 Ga0207639_10071629 3300026041 Bacteria 2712
221 Ga0207639_10225093 3300026041 Bacteria 1622
222 Ga0207678_10475733 3300026067 Bacteria 1088
223 Ga0207678_10476715 3300026067 Bacteria 1086
224 Ga0207708_10038243 3300026075 Bacteria 3655
225 Ga0207702_10519409 3300026078 Bacteria 1162
226 Ga0207641_10065008 3300026088 Bacteria 3119
227 Ga0207648_10007695 3300026089 Bacteria 10541
228 Ga0207676_10038607 3300026095 Bacteria 3646
229 Ga0207674_10019603 3300026116 Bacteria 7323
230 Ga0207674_10436319 3300026116 Bacteria 1266
231 Ga0207675_100029635 3300026118 Bacteria 5097
232 Ga0207675_100885636 3300026118 Bacteria 908
233 Ga0207675_101657914 3300026118 Bacteria 660
234 Ga0207683_10522940 3300026121 Bacteria 1096
235 Ga0207683_10550847 3300026121 Bacteria 1066
236 Ga0207683_12167365 3300026121 Bacteria 504
237 Ga0268266_11139736 3300028379 Bacteria 754
238 Ga0268265_10006042 3300028380 Bacteria 8230
239 Ga0268265_10008291 3300028380 Bacteria 7020
240 Ga0268264_10019237 3300028381 Bacteria 5582
241 Ga0268264_10131421 3300028381 Bacteria 2220
242 Ga0316182_1251408 3300030745 Bacteria 1267
243 Ga0307408_100003879 3300031548 Bacteria 10180
244 Ga0307408_100004186 3300031548 Bacteria 9835
245 Ga0307405_10316618 3300031731 Bacteria 1190
246 Ga0307405_10974900 3300031731 Bacteria 722
247 Ga0307413_10477187 3300031824 Bacteria 996
248 Ga0307406_10384914 3300031901 Bacteria 1107
249 Ga0307406_10559708 3300031901 Bacteria 937
250 Ga0307416_100029934 3300032002 Bacteria 4077
251 Ga0307415_100451815 3300032126 Bacteria 1111
252 Ga0307510_10000038 3300033180 Bacteria 106256
253 Ga0373932_0382623 3300035112 Bacteria 541
254 Ga0373946_0252657 3300035171 Bacteria 860
255 Ga0373931_0128994 3300035691 Bacteria 1453
256 Ga0373937_0982029 3300036401 Bacteria 793
257 Ga0316584_1178113 3300036712 Unclassified 506
258 Ga0373925_0013296 3300037068 Bacteria 5958
259 Ga0395901_0202973 3300038443 Bacteria 2078
260 Ga0436361_0352795 3300039447 Bacteria 1707
261 Ga0439442_043567 3300042002 Bacteria 945
262 Ga0439440_0053605 3300042993 Bacteria 1014
263 Ga0466969_0017783 3300044656 Bacteria 3709
264 Ga0466966_0043485 3300044684 Bacteria 2879
265 Ga0466966_0488152 3300044684 Bacteria 741
266 Ga0453684_0549265 3300044712 Bacteria 1273
267 Ga0451576_0394157 3300045051 Bacteria 1451
268 Ga0451576_0550258 3300045051 Bacteria 1212
269 Ga0495580_0738742 3300046472 Bacteria 642
270 Ga0495654_0000198 3300046530 Bacteria 58451
271 Ga0495609_0396073 3300046538 Bacteria 553
272 Ga0495633_0001416 3300046558 Bacteria 18679
273 Ga0495588_0447472 3300046674 Bacteria 678
274 Ga0496102_0116703 3300048905 Bacteria 2491
275 Ga0496104_0094467 3300048907 Unclassified 2861
276 Ga0496104_0603468 3300048907 Bacteria 1008
277 Ga0496104_1047389 3300048907 Bacteria 720
278 Ga0496105_0522455 3300048908 Bacteria 930
279 Ga0496106_0256375 3300048909 Bacteria 1399
280 Ga0496108_0438345 3300048911 Bacteria 1141
281 Ga0496108_0456062 3300048911 Bacteria 1117
282 Ga0496113_0504990 3300048916 Bacteria 971
283 Ga0496115_0627807 3300048918 Bacteria 852
284 Ga0496116_0005022 3300048919 Bacteria 12461
285 Ga0496117_0062758 3300048920 Bacteria 2544
286 Ga0496118_0004248 3300048921 Bacteria 17157
287 Ga0496118_0046026 3300048921 Bacteria 3399
288 Ga0496119_0005821 3300048922 Bacteria 11652
289 Ga0496120_0001965 3300048923 Bacteria 22470
290 Ga0496121_0461551 3300048924 Bacteria 816
291 Ga0496121_0705382 3300048924 Bacteria 606
292 Ga0496123_0007834 3300048926 Bacteria 9941
293 Ga0496124_0227159 3300048927 Bacteria 1398
294 Ga0496125_0000241 3300048928 Bacteria 112044
295 Ga0501034_0042817 3300049571 Bacteria 4584
296 Ga0501040_0643821 3300049576 Bacteria 766
297 Ga0501047_0040308 3300049581 Bacteria 4517
298 Ga0501070_0879250 3300049586 Bacteria 700
299 Ga0501072_1089913 3300049588 Bacteria 621
300 Ga0501249_017460 3300049679 Bacteria 1546
301 Ga0501080_0486120 3300049742 Bacteria 1104
302 Ga0501081_1024069 3300049743 Bacteria 624
303 Ga0501269_000106 3300049766 Bacteria 26126
304 nmdc:mga05p37_16073_c1 3300050507 Bacteria 9008
305 nmdc:mga09592_262915_c1 3300050508 Bacteria 1497
306 nmdc:mga0qj67_478838_c1 3300050509 Bacteria 1002
307 nmdc:mga0qj67_8133_c1 3300050509 Bacteria 7767
308 nmdc:mga0qj67_95145_c1 3300050509 Bacteria 2397
309 nmdc:mga06r32_1073917_c1 3300050510 Bacteria 755
310 nmdc:mga06r32_13245_c1 3300050510 Bacteria 7470
311 nmdc:mga06r32_275291_c1 3300050510 Bacteria 1671
312 nmdc:mga08y16_389860_c1 3300050511 Bacteria 1427
313 nmdc:mga08y16_81596_c1 3300050511 Bacteria 3371
314 nmdc:mga0n895_414735_c1 3300050512 Bacteria 1361
315 nmdc:mga0rr50_1009036_c1 3300050513 Bacteria 709
316 nmdc:mga0rr50_453418_c1 3300050513 Bacteria 1087
317 nmdc:mga0a205_313548_c1 3300050515 Bacteria 1440
318 nmdc:mga0a205_620710_c1 3300050515 Bacteria 933
319 Ga0500610_0000360 3300053079 Bacteria 13753
320 Ga0500627_0141911 3300053158 Bacteria 1085
321 2919495071 2919493220 Bacteria 4598500
322 2919546027 2919543075 Bacteria 4728703
323 2919706986 2919704043 Bacteria 5560311
324 nmdc:mga05p37_994496_c1
325 ARcpr5yngRDRAFT_c024108
326 JGI25157J39369_1000938
327 Ga0065714_10101447
328 Ga0065712_10076927
329 Ga0065715_10216980
330 Ga0070690_100015899
331 Ga0070670_100055472
332 Ga0070670_100063263
333 Ga0068869_100004112
334 Ga0068869_100020524
335 Ga0068869_100572450
336 Ga0070666_10000008
337 Ga0070666_10104158
338 Ga0070666_11519760
339 Ga0070682_100080791
340 Ga0068868_100026500
341 Ga0068868_100117879
342 Ga0068868_100723444
343 Ga0070660_100475247
344 Ga0070689_100001609
345 Ga0070689_100462196
346 Ga0070691_10580120
347 Ga0070687_100341335
348 Ga0070661_100026498
349 Ga0070692_10143948
350 Ga0070692_10290841
351 Ga0070668_100111749
352 Ga0070668_100608018
353 Ga0070669_100023949
354 Ga0070669_100052643
355 Ga0070675_100000934
356 Ga0070675_100097014
357 Ga0070675_100266208
358 Ga0070674_101926252
359 Ga0070673_100284004
360 Ga0070688_100233501
361 Ga0070688_100359398
362 Ga0070659_100010774
363 Ga0070667_100153157
364 Ga0070714_100083194
365 Ga0070713_100004662
366 Ga0070710_10448106
367 Ga0070701_10015634
368 Ga0070711_100092759
369 Ga0070711_100217764
370 Ga0070705_100005995
371 Ga0070700_100265908
372 Ga0070694_100015502
373 Ga0070694_100284728
374 Ga0070663_100075721
375 Ga0070678_100359123
376 Ga0070678_102246534
377 Ga0070678_102365167
378 Ga0070662_100116934
379 Ga0070685_10030138
380 Ga0070706_100039819
381 Ga0070707_100364157
382 Ga0070679_101956804
383 Ga0070684_100004485
384 Ga0068853_100229974
385 Ga0068853_100553445
386 Ga0070672_100013555
387 Ga0070672_100231630
388 Ga0070686_100004993
389 Ga0070686_101919937
390 Ga0070695_100499526
391 Ga0070693_100216791
392 Ga0070665_100156992
393 Ga0070664_100049332
394 Ga0068857_101195895
395 Ga0068854_102061564
396 Ga0068856_100003391
397 Ga0070702_100008624
398 Ga0070702_100289285
399 Ga0068852_102316939
400 Ga0068859_100032933
401 Ga0068859_100048820
402 Ga0068864_100022145
403 Ga0068864_101356650
404 Ga0068866_10160552
405 Ga0068861_100014100
406 Ga0068861_100055480
407 Ga0068861_100241025
408 Ga0068863_100144668
409 Ga0068858_100040312
410 Ga0068858_100106146
411 Ga0068860_100032207
412 Ga0068860_100033255
413 Ga0068860_100092724
414 Ga0068862_100002858
415 Ga0068862_100048049
416 Ga0075427_10114692
417 Ga0097621_102235925
418 Ga0068871_100079094
419 Ga0068871_102379656
420 Ga0075428_100193009
421 Ga0075428_100207896
422 Ga0075430_100018627
423 Ga0075430_100080136
424 Ga0075430_100692615
425 Ga0075431_100023046
426 Ga0075431_100477747
427 Ga0075433_10534622
428 Ga0075434_100475278
429 Ga0075429_100011953
430 Ga0075429_101551999
431 Ga0068865_100682616
432 Ga0068865_101758482
433 Ga0068865_101855161
434 Ga0097620_100032933
435 Ga0097620_100048820
436 Ga0105250_10154848
437 Ga0105240_10001334
438 Ga0105240_10480048
439 Ga0105240_10834641
440 Ga0111539_10153743
441 Ga0111539_10881511
442 Ga0111539_12872708
443 Ga0105245_10393550
444 Ga0105245_10423357
445 Ga0105247_10025956
446 Ga0105247_10364896
447 Ga0105247_11627568
448 Ga0114129_10011568
449 Ga0114129_10603221
450 Ga0105243_10021344
451 Ga0105241_10500890
452 Ga0105242_10267372
453 Ga0105242_10438473
454 Ga0105248_10019723
455 Ga0105248_10290319
456 Ga0105248_10403251
457 Ga0105237_10062232
458 Ga0105237_10305069
459 Ga0105238_10000576
460 Ga0105238_10349572
461 Ga0105238_10895977
462 Ga0105249_10015667
463 Ga0105249_11084539
464 Ga0105239_10010078
465 Ga0105239_10894965
466 Ga0157371_11397350
467 Ga0157370_10023824
468 Ga0157370_10101637
469 Ga0157370_11859006
470 Ga0157369_10811432
471 Ga0157374_10066426
472 Ga0157378_10242192
473 Ga0163162_10002160
474 Ga0163162_10017958
475 Ga0163162_12658773
476 Ga0157375_10046838
477 Ga0157375_10213723
478 Ga0157375_10835317
479 Ga0163163_10000787
480 Ga0163163_10450212
481 Ga0163163_12151032
482 Ga0182008_10017459
483 Ga0157377_10000749
484 Ga0157379_10519736
485 Ga0157376_10163892
486 Ga0157376_10504704
487 Ga0157376_10816483
488 Ga0182007_10006487
489 Ga0163161_10037712
490 Ga0163161_10875537
491 Ga0209674_101759
492 Ga0209258_104774
493 Ga0209026_1000113
494 Ga0209759_1010624
495 Ga0207692_10084687
496 Ga0207642_10229310
497 Ga0207710_10203700
498 Ga0207680_10000005
499 Ga0207680_10093726
500 Ga0207684_10136720
501 Ga0207654_10295762
502 Ga0207695_10003395
503 Ga0207695_10225427
504 Ga0207693_11273194
505 Ga0207663_10256200
506 Ga0207660_10297109
507 Ga0207662_10012621
508 Ga0207662_10030051
509 Ga0207657_10555889
510 Ga0207649_10037489
511 Ga0207649_11209409
512 Ga0207681_10300260
513 Ga0207694_10122079
514 Ga0207650_10015205
515 Ga0207650_10785487
516 Ga0207659_10125826
517 Ga0207659_10151167
518 Ga0207700_10012298
519 Ga0207690_10018142
520 Ga0207706_10117157
521 Ga0207709_10160702
522 Ga0207670_10037558
523 Ga0207670_10580535
524 Ga0207670_11422142
525 Ga0207669_10609526
526 Ga0207704_10014004
527 Ga0207691_10015433
528 Ga0207711_10005371
529 Ga0207711_10077845
530 Ga0207711_10279668
531 Ga0207689_10030153
532 Ga0207679_10056910
533 Ga0207651_10024204
534 Ga0207712_10002562
535 Ga0207668_10017734
536 Ga0207668_10075919
537 Ga0207640_11898566
538 Ga0207658_10328190
539 Ga0207677_10125814
540 Ga0207677_10491349
541 Ga0207703_10028523
542 Ga0207703_10088214
543 Ga0207639_10071629
544 Ga0207639_10225093
545 Ga0207678_10475733
546 Ga0207678_10476715
547 Ga0207708_10038243
548 Ga0207702_10519409
549 Ga0207641_10065008
550 Ga0207648_10007695
551 Ga0207676_10038607
552 Ga0207674_10019603
553 Ga0207674_10436319
554 Ga0207675_100029635
555 Ga0207675_100885636
556 Ga0207675_101657914
557 Ga0207683_10522940
558 Ga0207683_10550847
559 Ga0207683_12167365
560 Ga0268266_11139736
561 Ga0268265_10006042
562 Ga0268265_10008291
563 Ga0268264_10019237
564 Ga0268264_10131421
565 Ga0316182_1251408
566 Ga0307408_100003879
567 Ga0307408_100004186
568 Ga0307405_10316618
569 Ga0307405_10974900
570 Ga0307413_10477187
571 Ga0307406_10384914
572 Ga0307406_10559708
573 Ga0307416_100029934
574 Ga0307415_100451815
575 Ga0307510_10000038
576 Ga0373932_0382623
577 Ga0373946_0252657
578 Ga0373931_0128994
579 Ga0373937_0982029
580 Ga0316584_1178113
581 Ga0373925_0013296
582 Ga0395901_0202973
583 Ga0436361_0352795
584 Ga0439442_043567
585 Ga0439440_0053605
586 Ga0466969_0017783
587 Ga0466966_0043485
588 Ga0466966_0488152
589 Ga0453684_0549265
590 Ga0451576_0394157
591 Ga0451576_0550258
592 Ga0495580_0738742
593 Ga0495654_0000198
594 Ga0495609_0396073
595 Ga0495633_0001416
596 Ga0495588_0447472
597 Ga0496102_0116703
598 Ga0496104_0094467
599 Ga0496104_0603468
600 Ga0496104_1047389
601 Ga0496105_0522455
602 Ga0496106_0256375
603 Ga0496108_0438345
604 Ga0496108_0456062
605 Ga0496113_0504990
606 Ga0496115_0627807
607 Ga0496116_0005022
608 Ga0496117_0062758
609 Ga0496118_0004248
610 Ga0496118_0046026
611 Ga0496119_0005821
612 Ga0496120_0001965
613 Ga0496121_0461551
614 Ga0496121_0705382
615 Ga0496123_0007834
616 Ga0496124_0227159
617 Ga0496125_0000241
618 Ga0501034_0042817
619 Ga0501040_0643821
620 Ga0501047_0040308
621 Ga0501070_0879250
622 Ga0501072_1089913
623 Ga0501249_017460
624 Ga0501080_0486120
625 Ga0501081_1024069
626 Ga0501269_000106
627 nmdc:mga05p37_16073_c1
628 nmdc:mga09592_262915_c1
629 nmdc:mga0qj67_478838_c1
630 nmdc:mga0qj67_8133_c1
631 nmdc:mga0qj67_95145_c1
632 nmdc:mga06r32_1073917_c1
633 nmdc:mga06r32_13245_c1
634 nmdc:mga06r32_275291_c1
635 nmdc:mga08y16_389860_c1
636 nmdc:mga08y16_81596_c1
637 nmdc:mga0n895_414735_c1
638 nmdc:mga0rr50_1009036_c1
639 nmdc:mga0rr50_453418_c1
640 nmdc:mga0a205_313548_c1
641 nmdc:mga0a205_620710_c1
642 Ga0500610_0000360
643 Ga0500627_0141911
644 2919495071
645 2919546027
646 2919706986

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i45-assembly5.cif.gz_J crystal structure of protein nmb1881 from neisseria meningitidis 0.8716 28 107
2i45-assembly1.cif.gz_B crystal structure of protein nmb1881 from neisseria meningitidis 0.8668 28 107
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.8585 26 106
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.8558 26 106
4b29-assembly1.cif.gz_A crystal structures of dmsp lyases rddddp and rndddqii 0.855 26 106
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8597 28 106 2.60.120.10
af_O94603_133_414_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.856 38 105 2.60.120.650
4b29A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.855 26 106 2.60.120.10
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8538 26 106 2.60.120.10
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8496 26 106 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A8B6KSK9-F1-model_v4 deleted 0.997 42 107
AF-A0A0R0MLI8-F1-model_v4 DHCW motif cupin fold protein 0.9893 1 107
AF-F4MYE7-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9871 14 107
AF-A0A081CRH5-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9865 1 107
AF-A0A1I1EC65-F1-model_v4 DHCW motif cupin fold protein 0.985 1 107

Map