F407145

General Info

Members Datasets Scaffolds Average Seq Length
323 235 646 321

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2511231003|2511251922
Length 350
Sequence TPTSAPAAAAPTTSAKTTAMSPLPLLHLPNDRWKPLEIIFWLLPVAAYFVFPDYLILISQIMIVGLFAISLDLILGYGGIVSLGHAAFFGLGAYTAGLLSAHGWGEPISGMLLGAIVAAAFGYIISFLVVRGNDLARLMVTLGIGLMLFEAANKAAFITGGVDGLSGMMVDKIFGVFEFDLNGKVAYIYSFVVLFILFAVLRRLVNSPFGLSLVGIREGGRRMPAIGVNVNQRLTVIFTISAAIAGVAGALLAQTTQFVGLDVLGFPRSAELLIILVLGGTGRLYGGLVGAAIFMLAQDYLSGLNPAYWQFWIGLLLIVIVLFARGGILGGLTLIWNSLRKSSGTKGERS

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
66 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
136 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
219 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
220 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
221 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
222 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
223 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
224 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
225 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
226 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
227 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
228 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
229 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
230 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
231 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
232 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
233 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
234 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
235 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.43
Metatranscriptomes 0
Isolates 5.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.72
Nodule 0
Rhizoplane 0
Rhizosphere 90.71
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000828 3300002704 Bacteria 4796
2 JGI25156J39149_1005365 3300002705 Bacteria 3709
3 JGI25154J39366_1001103 3300002738 Bacteria 10529
4 JGI25406J46586_10064295 3300003203 Bacteria 1173
5 rootL2_10143642 3300003322 Bacteria 2328
6 Ga0055538_1000038 3300003751 Bacteria 186588
7 Ga0055539_1000049 3300003752 Bacteria 186588
8 Ga0055533_1000060 3300003756 Bacteria 186588
9 Ga0055525_1000068 3300003759 Bacteria 186588
10 Ga0055541_1000036 3300003841 Bacteria 186588
11 Ga0070658_10300796 3300005327 Bacteria 1368
12 Ga0070658_10416626 3300005327 Bacteria 1155
13 Ga0070676_10056867 3300005328 Bacteria 2313
14 Ga0070690_100063017 3300005330 Bacteria 2391
15 Ga0068869_100026334 3300005334 Bacteria 4048
16 Ga0070680_100391172 3300005336 Bacteria 1184
17 Ga0070660_100281065 3300005339 Bacteria 1362
18 Ga0070689_100079746 3300005340 Bacteria 2568
19 Ga0070689_100084759 3300005340 Bacteria 2491
20 Ga0070687_100098602 3300005343 Bacteria 1631
21 Ga0070687_100105082 3300005343 Bacteria 1588
22 Ga0070687_100202797 3300005343 Bacteria 1203
23 Ga0070692_10015825 3300005345 Bacteria 3576
24 Ga0070668_100051186 3300005347 Bacteria 3182
25 Ga0070669_100026233 3300005353 Bacteria 4191
26 Ga0070675_100091375 3300005354 Bacteria 2550
27 Ga0070675_100367230 3300005354 Bacteria 1279
28 Ga0070673_100108794 3300005364 Bacteria 2296
29 Ga0070673_100548754 3300005364 Bacteria 1050
30 Ga0070705_100010018 3300005440 Bacteria 4733
31 Ga0070700_100006368 3300005441 Bacteria 6305
32 Ga0070700_100056496 3300005441 Bacteria 2460
33 Ga0070694_100002163 3300005444 Bacteria 11644
34 Ga0070694_100019538 3300005444 Bacteria 4310
35 Ga0070662_100224624 3300005457 Bacteria 1500
36 Ga0070681_10007233 3300005458 Bacteria 10831
37 Ga0068867_100010543 3300005459 Bacteria 6521
38 Ga0070707_100365033 3300005468 Bacteria 1403
39 Ga0070679_100222622 3300005530 Bacteria 1848
40 Ga0070695_100078432 3300005545 Bacteria 2178
41 Ga0070695_100364030 3300005545 Bacteria 1087
42 Ga0070696_100003737 3300005546 Bacteria 10164
43 Ga0070696_100075025 3300005546 Bacteria 2385
44 Ga0070704_100018049 3300005549 Bacteria 4501
45 Ga0070704_100162437 3300005549 Bacteria 1768
46 Ga0068855_100000614 3300005563 Bacteria 43827
47 Ga0068855_100031454 3300005563 Bacteria 6337
48 Ga0068854_100016130 3300005578 Bacteria 4970
49 Ga0068856_100425964 3300005614 Bacteria 1347
50 Ga0070702_100246560 3300005615 Bacteria 1208
51 Ga0068859_100033426 3300005617 Bacteria 5164
52 Ga0068861_100013702 3300005719 Bacteria 5678
53 Ga0068870_10154978 3300005840 Bacteria 1353
54 Ga0068863_100276725 3300005841 Bacteria 1625
55 Ga0068858_100072953 3300005842 Bacteria 3186
56 Ga0068862_100020691 3300005844 Bacteria 5497
57 Ga0068862_100111446 3300005844 Bacteria 2402
58 Ga0075365_10062174 3300006038 Bacteria 2496
59 Ga0075365_10204788 3300006038 Bacteria 1383
60 Ga0075428_100094132 3300006844 Bacteria 3266
61 Ga0075430_100014857 3300006846 Bacteria 6630
62 Ga0075431_100254672 3300006847 Bacteria 1783
63 Ga0075433_10001929 3300006852 Bacteria 15609
64 Ga0075433_10446671 3300006852 Bacteria 1140
65 Ga0075434_100000254 3300006871 Bacteria 37644
66 Ga0075434_100000818 3300006871 Bacteria 24717
67 Ga0075434_100057100 3300006871 Bacteria 3879
68 Ga0075436_100000149 3300006914 Bacteria 43158
69 Ga0097620_100033426 3300006931 Bacteria 5164
70 Ga0075435_100001280 3300007076 Bacteria 16160
71 Ga0105240_10002032 3300009093 Bacteria 33348
72 Ga0111539_10008534 3300009094 Bacteria 13017
73 Ga0111539_10033868 3300009094 Bacteria 6198
74 Ga0111539_10595380 3300009094 Bacteria 1288
75 Ga0105245_10293449 3300009098 Bacteria 1593
76 Ga0114129_10107285 3300009147 Bacteria 3858
77 Ga0105243_10051239 3300009148 Bacteria 3264
78 Ga0105238_10016985 3300009551 Bacteria 7387
79 Ga0105249_10014485 3300009553 Bacteria 6971
80 Ga0157380_10064200 3300014326 Bacteria 2946
81 Ga0157377_10106346 3300014745 Bacteria 1680
82 Ga0182006_1003085 3300015261 Bacteria 8734
83 Ga0213872_10003817 3300021361 Bacteria 8210
84 Ga0209435_100067 3300025206 Bacteria 66388
85 Ga0209784_100021 3300025224 Bacteria 408534
86 Ga0209566_100039 3300025225 Bacteria 303368
87 Ga0209674_100036 3300025226 Bacteria 408534
88 Ga0209563_100040 3300025230 Bacteria 408534
89 Ga0209646_1000061 3300025246 Bacteria 255495
90 Ga0209026_1000754 3300025250 Bacteria 18343
91 Ga0209677_100023 3300025253 Bacteria 408534
92 Ga0209759_1000209 3300025256 Bacteria 90642
93 Ga0207645_10061549 3300025907 Bacteria 2398
94 Ga0207643_10142457 3300025908 Bacteria 1433
95 Ga0207705_10217336 3300025909 Bacteria 1451
96 Ga0207707_10003685 3300025912 Bacteria 13585
97 Ga0207695_10086106 3300025913 Bacteria 3170
98 Ga0207660_10077007 3300025917 Bacteria 2440
99 Ga0207662_10015934 3300025918 Bacteria 4235
100 Ga0207662_10069531 3300025918 Bacteria 2127
101 Ga0207657_10172390 3300025919 Bacteria 1752
102 Ga0207652_10098403 3300025921 Bacteria 2580
103 Ga0207681_10028167 3300025923 Bacteria 3637
104 Ga0207694_10009304 3300025924 Bacteria 7414
105 Ga0207690_10239502 3300025932 Bacteria 1397
106 Ga0207709_10018926 3300025935 Bacteria 3863
107 Ga0207670_10044552 3300025936 Bacteria 2935
108 Ga0207670_10056824 3300025936 Bacteria 2652
109 Ga0207691_10328298 3300025940 Bacteria 1311
110 Ga0207689_10044124 3300025942 Bacteria 3686
111 Ga0207667_10000102 3300025949 Bacteria 137469
112 Ga0207667_10089762 3300025949 Bacteria 3176
113 Ga0207651_10070651 3300025960 Bacteria 2471
114 Ga0207712_10044465 3300025961 Bacteria 3070
115 Ga0207668_10068902 3300025972 Bacteria 2517
116 Ga0207703_10056292 3300026035 Bacteria 3202
117 Ga0207703_10138593 3300026035 Bacteria 2109
118 Ga0207708_10005018 3300026075 Bacteria 9757
119 Ga0207708_10119530 3300026075 Bacteria 2053
120 Ga0207641_10206250 3300026088 Bacteria 1815
121 Ga0207648_10011628 3300026089 Bacteria 8285
122 Ga0207676_10404634 3300026095 Bacteria 1276
123 Ga0207675_100035966 3300026118 Bacteria 4619
124 Ga0209981_1000685 3300027378 Bacteria 4283
125 Ga0210000_1003089 3300027462 Bacteria 2388
126 Ga0210000_1005842 3300027462 Bacteria 1789
127 Ga0207428_10030877 3300027907 Bacteria 4426
128 Ga0207428_10052191 3300027907 Bacteria 3267
129 Ga0207428_10192440 3300027907 Bacteria 1537
130 Ga0268265_10014606 3300028380 Bacteria 5353
131 Ga0268265_10092617 3300028380 Bacteria 2419
132 Ga0268264_10194714 3300028381 Bacteria 1850
133 Ga0265330_10051102 3300031235 Bacteria 1813
134 Ga0265331_10018382 3300031250 Bacteria 3627
135 Ga0307408_100343782 3300031548 Bacteria 1264
136 Ga0265314_10005849 3300031711 Bacteria 11012
137 Ga0307412_10066360 3300031911 Bacteria 2446
138 Ga0307412_10093157 3300031911 Bacteria 2113
139 Ga0307412_10201196 3300031911 Bacteria 1513
140 Ga0307416_100279443 3300032002 Bacteria 1645
141 Ga0373926_0003388 3300035083 Bacteria 5135
142 Ga0373944_0007923 3300035089 Bacteria 2861
143 Ga0373936_0012981 3300035113 Bacteria 3176
144 Ga0373936_0015393 3300035113 Bacteria 2931
145 Ga0373941_0000809 3300035115 Bacteria 6416
146 Ga0373945_0006857 3300035116 Bacteria 3681
147 Ga0373953_0045875 3300035117 Bacteria 1753
148 Ga0373954_0000066 3300035118 Bacteria 37077
149 Ga0373956_0031963 3300035119 Bacteria 2308
150 Ga0373943_0223903 3300035170 Bacteria 1048
151 Ga0373955_0082744 3300035172 Bacteria 1817
152 Ga0373924_0029007 3300035410 Bacteria 2209
153 Ga0373931_0191472 3300035691 Bacteria 1217
154 Ga0373935_0275948 3300035692 Bacteria 1182
155 Ga0373927_0113937 3300035695 Bacteria 1762
156 Ga0373933_0062670 3300035724 Bacteria 2246
157 Ga0373947_0039274 3300035725 Bacteria 2815
158 Ga0373937_0000884 3300036401 Bacteria 25679
159 Ga0373937_0023313 3300036401 Bacteria 5572
160 Ga0373925_0054172 3300037068 Bacteria 2999
161 Ga0395899_0040760 3300037312 Bacteria 3472
162 Ga0395899_0044255 3300037312 Bacteria 3318
163 Ga0395900_0011196 3300037418 Bacteria 9173
164 Ga0395900_0013168 3300037418 Bacteria 8453
165 Ga0395900_0106812 3300037418 Bacteria 2876
166 Ga0395900_0304840 3300037418 Bacteria 1578
167 Ga0395898_0002404 3300037466 Bacteria 22217
168 Ga0395898_0282775 3300037466 Bacteria 1582
169 Ga0395905_0000773 3300037471 Bacteria 42104
170 Ga0395905_0002341 3300037471 Bacteria 21134
171 Ga0395905_0007791 3300037471 Bacteria 10621
172 Ga0395905_0040741 3300037471 Bacteria 4357
173 Ga0395905_0083815 3300037471 Bacteria 2986
174 Ga0395901_0036015 3300038443 Bacteria 5113
175 Ga0395901_0186193 3300038443 Bacteria 2177
176 Ga0395901_0248294 3300038443 Bacteria 1854
177 Ga0395901_0262523 3300038443 Bacteria 1797
178 Ga0436361_0298239 3300039447 Bacteria 16541
179 Ga0439453_0011457 3300041408 Bacteria 1479
180 Ga0439435_0005412 3300042436 Bacteria 2806
181 Ga0439464_0011218 3300042439 Bacteria 2371
182 Ga0439460_0028903 3300042461 Bacteria 1566
183 Ga0439460_0036295 3300042461 Bacteria 1429
184 Ga0466965_0242488 3300044683 Bacteria 965
185 Ga0466966_0250100 3300044684 Bacteria 1068
186 Ga0466961_0024702 3300044693 Bacteria 3865
187 Ga0466959_0027356 3300045049 Bacteria 4231
188 Ga0451576_0135431 3300045051 Bacteria 2568
189 Ga0466967_0027039 3300045976 Bacteria 4765
190 Ga0495592_0010606 3300046454 Bacteria 6950
191 Ga0495641_0030543 3300046461 Bacteria 2583
192 Ga0495653_0191140 3300046463 Bacteria 1397
193 Ga0495580_0008507 3300046472 Bacteria 8157
194 Ga0495639_0012276 3300046475 Bacteria 3694
195 Ga0495662_0008367 3300046476 Bacteria 5088
196 Ga0495662_0120546 3300046476 Bacteria 1287
197 Ga0495608_0004898 3300046511 Bacteria 9586
198 Ga0495618_0120868 3300046514 Bacteria 1677
199 Ga0495628_0000915 3300046516 Bacteria 27087
200 Ga0495630_0007486 3300046517 Bacteria 7804
201 Ga0495666_0017934 3300046526 Bacteria 3525
202 Ga0495642_0070327 3300046528 Bacteria 1463
203 Ga0495652_0061068 3300046529 Bacteria 3183
204 Ga0495665_0022686 3300046531 Bacteria 3373
205 Ga0495640_0007049 3300046533 Bacteria 8847
206 Ga0495586_0000698 3300046535 Bacteria 19053
207 Ga0495586_0004411 3300046535 Bacteria 7512
208 Ga0495587_0017984 3300046536 Bacteria 4383
209 Ga0495621_0046716 3300046539 Bacteria 1537
210 Ga0495634_0003402 3300046642 Bacteria 12776
211 Ga0495634_0184101 3300046642 Bacteria 1306
212 Ga0495635_0018448 3300046663 Bacteria 4869
213 Ga0495635_0043710 3300046663 Bacteria 3091
214 Ga0495599_0026248 3300046678 Bacteria 3650
215 Ga0495647_0000575 3300046681 Bacteria 10842
216 Ga0495669_0001950 3300046684 Bacteria 8478
217 Ga0495613_0043171 3300046689 Bacteria 3335
218 Ga0495624_0075845 3300046690 Bacteria 2087
219 Ga0495600_0009440 3300046809 Bacteria 6027
220 Ga0495604_0005164 3300047317 Bacteria 10338
221 Ga0495674_0062097 3300047319 Bacteria 3254
222 Ga0495676_0141306 3300047321 Bacteria 1725
223 Ga0495680_0004292 3300047322 Bacteria 13673
224 Ga0495675_0079163 3300047444 Bacteria 2070
225 Ga0495684_0167287 3300047471 Bacteria 1637
226 Ga0496121_0035531 3300048924 Bacteria 4465
227 Ga0496126_0238672 3300048929 Unclassified 1520
228 Ga0501031_0218342 3300049568 Bacteria 1242
229 Ga0501032_0033536 3300049569 Bacteria 3517
230 Ga0501033_0133952 3300049570 Bacteria 1793
231 Ga0501034_0000439 3300049571 Bacteria 68932
232 Ga0501034_0000810 3300049571 Bacteria 46526
233 Ga0501034_0009890 3300049571 Bacteria 9969
234 Ga0501034_0014998 3300049571 Bacteria 7971
235 Ga0501034_0108903 3300049571 Bacteria 2761
236 Ga0501036_0005548 3300049572 Bacteria 10230
237 Ga0501036_0022930 3300049572 Bacteria 5256
238 Ga0501036_0108297 3300049572 Bacteria 2349
239 Ga0501036_0144889 3300049572 Bacteria 2004
240 Ga0501036_0175814 3300049572 Bacteria 1802
241 Ga0501036_0181435 3300049572 Bacteria 1772
242 Ga0501037_0022946 3300049573 Bacteria 4615
243 Ga0501037_0085999 3300049573 Bacteria 2276
244 Ga0501038_0027804 3300049574 Bacteria 5027
245 Ga0501038_0232411 3300049574 Bacteria 1467
246 Ga0501039_0035845 3300049575 Bacteria 3829
247 Ga0501039_0098338 3300049575 Bacteria 2283
248 Ga0501040_0052604 3300049576 Bacteria 2788
249 Ga0501043_0010261 3300049579 Bacteria 7339
250 Ga0501043_0018721 3300049579 Bacteria 5433
251 Ga0501043_0065668 3300049579 Bacteria 2849
252 Ga0501046_0162457 3300049580 Bacteria 1679
253 Ga0501046_0242769 3300049580 Bacteria 1328
254 Ga0501047_0000073 3300049581 Bacteria 125990
255 Ga0501047_0043720 3300049581 Bacteria 4327
256 Ga0501047_0201759 3300049581 Bacteria 1850
257 Ga0501048_0000391 3300049582 Bacteria 30448
258 Ga0501048_0058404 3300049582 Bacteria 2734
259 Ga0501048_0130919 3300049582 Bacteria 1774
260 Ga0501067_0036636 3300049583 Bacteria 2723
261 Ga0501068_0001678 3300049584 Bacteria 11821
262 Ga0501068_0020275 3300049584 Bacteria 3870
263 Ga0501069_0012179 3300049585 Bacteria 4569
264 Ga0501070_0027966 3300049586 Bacteria 4730
265 Ga0501070_0201533 3300049586 Bacteria 1634
266 Ga0501071_0133585 3300049587 Bacteria 1845
267 Ga0501072_0021667 3300049588 Bacteria 4984
268 Ga0501072_0052606 3300049588 Bacteria 3207
269 Ga0501072_0169012 3300049588 Bacteria 1745
270 Ga0501072_0259798 3300049588 Bacteria 1382
271 Ga0501073_0023388 3300049589 Bacteria 4436
272 Ga0501074_0009466 3300049590 Bacteria 7074
273 Ga0501074_0010930 3300049590 Bacteria 6589
274 Ga0501074_0011237 3300049590 Bacteria 6506
275 Ga0501079_0058113 3300049741 Bacteria 2984
276 Ga0501079_0105137 3300049741 Bacteria 2190
277 Ga0501080_0006835 3300049742 Bacteria 10289
278 Ga0501080_0026831 3300049742 Bacteria 5355
279 Ga0501080_0108670 3300049742 Bacteria 2570
280 Ga0501080_0109812 3300049742 Bacteria 2556
281 Ga0501080_0281391 3300049742 Bacteria 1512
282 Ga0501081_0155502 3300049743 Bacteria 1645
283 Ga0501083_0000139 3300049744 Bacteria 49384
284 Ga0501083_0072683 3300049744 Bacteria 2286
285 Ga0501035_0014862 3300049822 Bacteria 7185
286 Ga0501035_0126715 3300049822 Bacteria 2229
287 Ga0501035_0218656 3300049822 Bacteria 1627
288 Ga0501044_0026255 3300049823 Bacteria 6167
289 Ga0501044_0044266 3300049823 Bacteria 4620
290 Ga0501044_0289555 3300049823 Bacteria 1569
291 nmdc:mga09592_227467_c1 3300050508 Bacteria 1616
292 nmdc:mga0qj67_136848_c1 3300050509 Bacteria 1985
293 nmdc:mga0qj67_236376_c1 3300050509 Bacteria 1483
294 nmdc:mga06r32_200354_c1 3300050510 Bacteria 1984
295 nmdc:mga06r32_361380_c1 3300050510 Bacteria 1436
296 nmdc:mga08y16_11098_c1 3300050511 Bacteria 9459
297 nmdc:mga08y16_191590_c1 3300050511 Bacteria 2121
298 nmdc:mga0n895_6296_c1 3300050512 Bacteria 10064
299 nmdc:mga0rr50_35947_c1 3300050513 Bacteria 3563
300 nmdc:mga08x19_18374_c1 3300050514 Bacteria 4285
301 nmdc:mga0a205_3271_c1 3300050515 Bacteria 14414
302 Ga0495595_0064475 3300053084 Bacteria 1722
303 Ga0495619_0206163 3300053085 Bacteria 1361
304 Ga0501084_0180798 3300054114 Bacteria 1780
305 Ga0501082_0203879 3300060353 Bacteria 1721
306 2511251922 2511231003 Bacteria 5606035
307 2521559935 2521172590 Bacteria 5047645
308 2553006916 2551306416 Bacteria 6152985
309 2808982712 2808606386 Bacteria 4471946
310 2809130213 2808606415 Bacteria 4576710
311 2809150310 2808606419 Bacteria 4576925
312 2819618174 2818991449 Bacteria 5518009
313 2852621467 2852618963 Bacteria 4577824
314 2895513596 2895511927 Bacteria 6802080
315 2904444509 2904439833 Bacteria 5931679
316 2904535662 2904530477 Bacteria 5876334
317 2904588233 2904584206 Bacteria 6028872
318 2904594878 2904589729 Bacteria 6113573
319 2904606181 2904601388 Bacteria 5884906
320 2919049157 2919046199 Bacteria 5567169
321 2919084379 2919079590 Bacteria 5946433
322 2923513725 2923510766 Bacteria 5926163
323 2928134415 2928130867 Bacteria 5467269
324 JGI25155J39150_1000828
325 JGI25156J39149_1005365
326 JGI25154J39366_1001103
327 JGI25406J46586_10064295
328 rootL2_10143642
329 Ga0055538_1000038
330 Ga0055539_1000049
331 Ga0055533_1000060
332 Ga0055525_1000068
333 Ga0055541_1000036
334 Ga0070658_10300796
335 Ga0070658_10416626
336 Ga0070676_10056867
337 Ga0070690_100063017
338 Ga0068869_100026334
339 Ga0070680_100391172
340 Ga0070660_100281065
341 Ga0070689_100079746
342 Ga0070689_100084759
343 Ga0070687_100098602
344 Ga0070687_100105082
345 Ga0070687_100202797
346 Ga0070692_10015825
347 Ga0070668_100051186
348 Ga0070669_100026233
349 Ga0070675_100091375
350 Ga0070675_100367230
351 Ga0070673_100108794
352 Ga0070673_100548754
353 Ga0070705_100010018
354 Ga0070700_100006368
355 Ga0070700_100056496
356 Ga0070694_100002163
357 Ga0070694_100019538
358 Ga0070662_100224624
359 Ga0070681_10007233
360 Ga0068867_100010543
361 Ga0070707_100365033
362 Ga0070679_100222622
363 Ga0070695_100078432
364 Ga0070695_100364030
365 Ga0070696_100003737
366 Ga0070696_100075025
367 Ga0070704_100018049
368 Ga0070704_100162437
369 Ga0068855_100000614
370 Ga0068855_100031454
371 Ga0068854_100016130
372 Ga0068856_100425964
373 Ga0070702_100246560
374 Ga0068859_100033426
375 Ga0068861_100013702
376 Ga0068870_10154978
377 Ga0068863_100276725
378 Ga0068858_100072953
379 Ga0068862_100020691
380 Ga0068862_100111446
381 Ga0075365_10062174
382 Ga0075365_10204788
383 Ga0075428_100094132
384 Ga0075430_100014857
385 Ga0075431_100254672
386 Ga0075433_10001929
387 Ga0075433_10446671
388 Ga0075434_100000254
389 Ga0075434_100000818
390 Ga0075434_100057100
391 Ga0075436_100000149
392 Ga0097620_100033426
393 Ga0075435_100001280
394 Ga0105240_10002032
395 Ga0111539_10008534
396 Ga0111539_10033868
397 Ga0111539_10595380
398 Ga0105245_10293449
399 Ga0114129_10107285
400 Ga0105243_10051239
401 Ga0105238_10016985
402 Ga0105249_10014485
403 Ga0157380_10064200
404 Ga0157377_10106346
405 Ga0182006_1003085
406 Ga0213872_10003817
407 Ga0209435_100067
408 Ga0209784_100021
409 Ga0209566_100039
410 Ga0209674_100036
411 Ga0209563_100040
412 Ga0209646_1000061
413 Ga0209026_1000754
414 Ga0209677_100023
415 Ga0209759_1000209
416 Ga0207645_10061549
417 Ga0207643_10142457
418 Ga0207705_10217336
419 Ga0207707_10003685
420 Ga0207695_10086106
421 Ga0207660_10077007
422 Ga0207662_10015934
423 Ga0207662_10069531
424 Ga0207657_10172390
425 Ga0207652_10098403
426 Ga0207681_10028167
427 Ga0207694_10009304
428 Ga0207690_10239502
429 Ga0207709_10018926
430 Ga0207670_10044552
431 Ga0207670_10056824
432 Ga0207691_10328298
433 Ga0207689_10044124
434 Ga0207667_10000102
435 Ga0207667_10089762
436 Ga0207651_10070651
437 Ga0207712_10044465
438 Ga0207668_10068902
439 Ga0207703_10056292
440 Ga0207703_10138593
441 Ga0207708_10005018
442 Ga0207708_10119530
443 Ga0207641_10206250
444 Ga0207648_10011628
445 Ga0207676_10404634
446 Ga0207675_100035966
447 Ga0209981_1000685
448 Ga0210000_1003089
449 Ga0210000_1005842
450 Ga0207428_10030877
451 Ga0207428_10052191
452 Ga0207428_10192440
453 Ga0268265_10014606
454 Ga0268265_10092617
455 Ga0268264_10194714
456 Ga0265330_10051102
457 Ga0265331_10018382
458 Ga0307408_100343782
459 Ga0265314_10005849
460 Ga0307412_10066360
461 Ga0307412_10093157
462 Ga0307412_10201196
463 Ga0307416_100279443
464 Ga0373926_0003388
465 Ga0373944_0007923
466 Ga0373936_0012981
467 Ga0373936_0015393
468 Ga0373941_0000809
469 Ga0373945_0006857
470 Ga0373953_0045875
471 Ga0373954_0000066
472 Ga0373956_0031963
473 Ga0373943_0223903
474 Ga0373955_0082744
475 Ga0373924_0029007
476 Ga0373931_0191472
477 Ga0373935_0275948
478 Ga0373927_0113937
479 Ga0373933_0062670
480 Ga0373947_0039274
481 Ga0373937_0000884
482 Ga0373937_0023313
483 Ga0373925_0054172
484 Ga0395899_0040760
485 Ga0395899_0044255
486 Ga0395900_0011196
487 Ga0395900_0013168
488 Ga0395900_0106812
489 Ga0395900_0304840
490 Ga0395898_0002404
491 Ga0395898_0282775
492 Ga0395905_0000773
493 Ga0395905_0002341
494 Ga0395905_0007791
495 Ga0395905_0040741
496 Ga0395905_0083815
497 Ga0395901_0036015
498 Ga0395901_0186193
499 Ga0395901_0248294
500 Ga0395901_0262523
501 Ga0436361_0298239
502 Ga0439453_0011457
503 Ga0439435_0005412
504 Ga0439464_0011218
505 Ga0439460_0028903
506 Ga0439460_0036295
507 Ga0466965_0242488
508 Ga0466966_0250100
509 Ga0466961_0024702
510 Ga0466959_0027356
511 Ga0451576_0135431
512 Ga0466967_0027039
513 Ga0495592_0010606
514 Ga0495641_0030543
515 Ga0495653_0191140
516 Ga0495580_0008507
517 Ga0495639_0012276
518 Ga0495662_0008367
519 Ga0495662_0120546
520 Ga0495608_0004898
521 Ga0495618_0120868
522 Ga0495628_0000915
523 Ga0495630_0007486
524 Ga0495666_0017934
525 Ga0495642_0070327
526 Ga0495652_0061068
527 Ga0495665_0022686
528 Ga0495640_0007049
529 Ga0495586_0000698
530 Ga0495586_0004411
531 Ga0495587_0017984
532 Ga0495621_0046716
533 Ga0495634_0003402
534 Ga0495634_0184101
535 Ga0495635_0018448
536 Ga0495635_0043710
537 Ga0495599_0026248
538 Ga0495647_0000575
539 Ga0495669_0001950
540 Ga0495613_0043171
541 Ga0495624_0075845
542 Ga0495600_0009440
543 Ga0495604_0005164
544 Ga0495674_0062097
545 Ga0495676_0141306
546 Ga0495680_0004292
547 Ga0495675_0079163
548 Ga0495684_0167287
549 Ga0496121_0035531
550 Ga0496126_0238672
551 Ga0501031_0218342
552 Ga0501032_0033536
553 Ga0501033_0133952
554 Ga0501034_0000439
555 Ga0501034_0000810
556 Ga0501034_0009890
557 Ga0501034_0014998
558 Ga0501034_0108903
559 Ga0501036_0005548
560 Ga0501036_0022930
561 Ga0501036_0108297
562 Ga0501036_0144889
563 Ga0501036_0175814
564 Ga0501036_0181435
565 Ga0501037_0022946
566 Ga0501037_0085999
567 Ga0501038_0027804
568 Ga0501038_0232411
569 Ga0501039_0035845
570 Ga0501039_0098338
571 Ga0501040_0052604
572 Ga0501043_0010261
573 Ga0501043_0018721
574 Ga0501043_0065668
575 Ga0501046_0162457
576 Ga0501046_0242769
577 Ga0501047_0000073
578 Ga0501047_0043720
579 Ga0501047_0201759
580 Ga0501048_0000391
581 Ga0501048_0058404
582 Ga0501048_0130919
583 Ga0501067_0036636
584 Ga0501068_0001678
585 Ga0501068_0020275
586 Ga0501069_0012179
587 Ga0501070_0027966
588 Ga0501070_0201533
589 Ga0501071_0133585
590 Ga0501072_0021667
591 Ga0501072_0052606
592 Ga0501072_0169012
593 Ga0501072_0259798
594 Ga0501073_0023388
595 Ga0501074_0009466
596 Ga0501074_0010930
597 Ga0501074_0011237
598 Ga0501079_0058113
599 Ga0501079_0105137
600 Ga0501080_0006835
601 Ga0501080_0026831
602 Ga0501080_0108670
603 Ga0501080_0109812
604 Ga0501080_0281391
605 Ga0501081_0155502
606 Ga0501083_0000139
607 Ga0501083_0072683
608 Ga0501035_0014862
609 Ga0501035_0126715
610 Ga0501035_0218656
611 Ga0501044_0026255
612 Ga0501044_0044266
613 Ga0501044_0289555
614 nmdc:mga09592_227467_c1
615 nmdc:mga0qj67_136848_c1
616 nmdc:mga0qj67_236376_c1
617 nmdc:mga06r32_200354_c1
618 nmdc:mga06r32_361380_c1
619 nmdc:mga08y16_11098_c1
620 nmdc:mga08y16_191590_c1
621 nmdc:mga0n895_6296_c1
622 nmdc:mga0rr50_35947_c1
623 nmdc:mga08x19_18374_c1
624 nmdc:mga0a205_3271_c1
625 Ga0495595_0064475
626 Ga0495619_0206163
627 Ga0501084_0180798
628 Ga0501082_0203879
629 2511251922
630 2521559935
631 2553006916
632 2808982712
633 2809130213
634 2809150310
635 2819618174
636 2852621467
637 2895513596
638 2904444509
639 2904535662
640 2904588233
641 2904594878
642 2904606181
643 2919049157
644 2919084379
645 2923513725
646 2928134415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

54

321

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b57-assembly1.cif.gz_A inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.5305 43 286
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5302 43 314
5b58-assembly1.cif.gz_B inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.5254 43 325
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5188 43 314
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4929 17 327
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8589 45 309 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8071 43 309 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8007 44 309 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7918 41 309 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7896 44 309 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A536T171-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9907 13 283 GO:0005886
GO:0015658
AF-A0A4Q3JE45-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9873 20 289 GO:0005886
GO:0015658
AF-A0A536T171-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9835 13 283 GO:0005886
GO:0015658
AF-A0A4Q3LMC0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9819 20 313 GO:0005886
GO:0015658
AF-A0A0Q7AE76-F1-model_v4 ABC transporter permease 0.9808 20 313 GO:0005886
GO:0015658

Map