F407261

General Info

Members Datasets Scaffolds Average Seq Length
324 183 320 221

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100097537|Ga0070663_1000975372
Length 254
Sequence MPHIRTLAAAPRHGFATRRRRHDEGEVASGPVRLVIARCSVDYIGRLTAHLPMASRLLLVKADGSVSIHADDRAYKPLNWMSPPCTLKDELTDGAGTWTVTNKAGEQLIITIESVAHDSSHELGVDPGLQKDGVEAELQRLLALHVETFGAGWSLVRREYPTAIGPVDLLCRDAGGTTVAVEIKRRGEIDGVEQLTRYLELLNRDPLLAPVKGVFAAQEIKPQARVLAQDRGIDCVTVDYAVLKGTDDPSQRLF

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
74 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
92 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
93 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
110 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
111 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
112 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
179 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.94
Nodule 0
Rhizoplane 9.57
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10035258 3300005327 Bacteria 4030
2 Ga0070683_100015361 3300005329 Bacteria 6723
3 Ga0070680_100050582 3300005336 Bacteria 3390
4 Ga0070680_100069986 3300005336 Bacteria 2882
5 Ga0070680_100119817 3300005336 Bacteria 2196
6 Ga0070682_100150100 3300005337 Bacteria 1598
7 Ga0068868_100041578 3300005338 Bacteria 3582
8 Ga0070660_100084065 3300005339 Bacteria 2501
9 Ga0070660_100137398 3300005339 Bacteria 1959
10 Ga0070660_100268836 3300005339 Bacteria 1393
11 Ga0070692_10022271 3300005345 Bacteria 3093
12 Ga0070675_100949973 3300005354 Bacteria 789
13 Ga0070688_100233897 3300005365 Bacteria 1301
14 Ga0070659_100002036 3300005366 Bacteria 14461
15 Ga0070659_100002106 3300005366 Bacteria 14182
16 Ga0070659_100486539 3300005366 Bacteria 1050
17 Ga0070713_100688968 3300005436 Bacteria 975
18 Ga0070700_100103397 3300005441 Bacteria 1881
19 Ga0070663_100097537 3300005455 Bacteria 2188
20 Ga0070681_10053718 3300005458 Bacteria 4015
21 Ga0070681_10073850 3300005458 Bacteria 3372
22 Ga0070707_100187313 3300005468 Bacteria 2018
23 Ga0070679_100082411 3300005530 Bacteria 3206
24 Ga0070679_100163006 3300005530 Bacteria 2203
25 Ga0070679_100284431 3300005530 Bacteria 1606
26 Ga0070684_100299878 3300005535 Bacteria 1474
27 Ga0070695_100065402 3300005545 Bacteria 2368
28 Ga0070665_100346936 3300005548 Bacteria 1489
29 Ga0070664_100757236 3300005564 Bacteria 907
30 Ga0075365_10131669 3300006038 Bacteria 1731
31 Ga0075363_100075096 3300006048 Bacteria 1841
32 Ga0075364_10023685 3300006051 Bacteria 3889
33 Ga0075364_10083843 3300006051 Bacteria 2110
34 Ga0070716_100170363 3300006173 Bacteria 1420
35 Ga0075369_10006783 3300006186 Bacteria 4343
36 Ga0075369_10011343 3300006186 Bacteria 3505
37 Ga0075434_100249599 3300006871 Bacteria 1794
38 Ga0105240_10375149 3300009093 Bacteria 1607
39 Ga0111539_10154881 3300009094 Bacteria 2682
40 Ga0105245_10057916 3300009098 Bacteria 3486
41 Ga0105242_10136794 3300009176 Bacteria 2121
42 Ga0105242_10487463 3300009176 Bacteria 1170
43 Ga0105248_11365329 3300009177 Bacteria 802
44 Ga0105237_10359947 3300009545 Bacteria 1459
45 Ga0105249_10306061 3300009553 Bacteria 1596
46 Ga0157373_10092145 3300013100 Bacteria 2134
47 Ga0157369_10127600 3300013105 Bacteria 2696
48 Ga0157378_10333780 3300013297 Bacteria 1476
49 Ga0157378_10730395 3300013297 Bacteria 1012
50 Ga0163162_10576812 3300013306 Bacteria 1252
51 Ga0163162_11239771 3300013306 Bacteria 847
52 Ga0157375_10125288 3300013308 Bacteria 2683
53 Ga0157375_10371362 3300013308 Bacteria 1597
54 Ga0157380_11652685 3300014326 Bacteria 697
55 Ga0182008_10103405 3300014497 Bacteria 1409
56 Ga0157379_10829551 3300014968 Bacteria 874
57 Ga0209051_1000048 3300025303 Bacteria 292755
58 Ga0207688_10108627 3300025901 Bacteria 1609
59 Ga0207705_10178238 3300025909 Bacteria 1603
60 Ga0207707_10032752 3300025912 Bacteria 4549
61 Ga0207707_10051887 3300025912 Bacteria 3572
62 Ga0207695_10320524 3300025913 Bacteria 1439
63 Ga0207660_10042291 3300025917 Bacteria 3198
64 Ga0207660_10127600 3300025917 Bacteria 1933
65 Ga0207657_10044415 3300025919 Bacteria 3906
66 Ga0207657_10055002 3300025919 Bacteria 3439
67 Ga0207657_10199514 3300025919 Bacteria 1610
68 Ga0207652_10048550 3300025921 Bacteria 3629
69 Ga0207652_10093642 3300025921 Bacteria 2644
70 Ga0207652_10105555 3300025921 Bacteria 2493
71 Ga0207652_10823917 3300025921 Bacteria 823
72 Ga0207646_10226186 3300025922 Bacteria 1690
73 Ga0207687_10217481 3300025927 Bacteria 1502
74 Ga0207690_10000222 3300025932 Bacteria 42867
75 Ga0207690_10006421 3300025932 Bacteria 6968
76 Ga0207686_10480000 3300025934 Bacteria 961
77 Ga0207704_10341514 3300025938 Bacteria 1162
78 Ga0207704_10446067 3300025938 Bacteria 1032
79 Ga0207704_10452625 3300025938 Bacteria 1025
80 Ga0207661_10072267 3300025944 Bacteria 2822
81 Ga0207661_10082618 3300025944 Bacteria 2656
82 Ga0207677_10014982 3300026023 Bacteria 4545
83 Ga0207678_10069567 3300026067 Bacteria 3018
84 Ga0207683_10970332 3300026121 Bacteria 789
85 Ga0268266_10104444 3300028379 Bacteria 2502
86 Ga0265318_10036010 3300028577 Bacteria 1901
87 Ga0265338_10000913 3300028800 Bacteria 49782
88 Ga0265338_10079504 3300028800 Bacteria 2759
89 Ga0265332_10052479 3300031238 Bacteria 1751
90 Ga0265325_10002553 3300031241 Bacteria 12246
91 Ga0265339_10001052 3300031249 Bacteria 20987
92 Ga0265327_10004595 3300031251 Bacteria 12142
93 Ga0265316_10035527 3300031344 Bacteria 4038
94 Ga0265316_10051281 3300031344 Bacteria 3242
95 Ga0307408_100094607 3300031548 Bacteria 2263
96 Ga0307408_100210719 3300031548 Bacteria 1579
97 Ga0265313_10000403 3300031595 Bacteria 46499
98 Ga0316575_10002265 3300031665 Bacteria 6428
99 Ga0316579_10008229 3300031691 Bacteria 4340
100 Ga0265314_10085951 3300031711 Bacteria 2061
101 Ga0265314_10091522 3300031711 Unclassified 1979
102 Ga0265342_10255754 3300031712 Bacteria 933
103 Ga0316576_10001166 3300031727 Bacteria 13782
104 Ga0316578_10000042 3300031728 Bacteria 25935
105 Ga0316578_10267999 3300031728 Bacteria 1023
106 Ga0307405_10165396 3300031731 Bacteria 1572
107 Ga0316577_10001922 3300031733 Bacteria 10062
108 Ga0316577_10165964 3300031733 Bacteria 1246
109 Ga0307413_10173924 3300031824 Bacteria 1527
110 Ga0307413_10254006 3300031824 Bacteria 1306
111 Ga0307413_10428158 3300031824 Bacteria 1044
112 Ga0307410_10006221 3300031852 Bacteria 6421
113 Ga0307410_10062980 3300031852 Bacteria 2543
114 Ga0307410_10144764 3300031852 Bacteria 1762
115 Ga0307406_10064815 3300031901 Bacteria 2372
116 Ga0307406_10101946 3300031901 Bacteria 1957
117 Ga0307406_10501325 3300031901 Bacteria 984
118 Ga0307407_10230233 3300031903 Bacteria 1258
119 Ga0307407_10409789 3300031903 Bacteria 974
120 Ga0307412_10449857 3300031911 Bacteria 1061
121 Ga0307409_100091238 3300031995 Bacteria 2496
122 Ga0307409_100094428 3300031995 Bacteria 2461
123 Ga0307409_100434353 3300031995 Bacteria 1263
124 Ga0307416_100054958 3300032002 Bacteria 3203
125 Ga0307416_100073248 3300032002 Bacteria 2855
126 Ga0307416_100220588 3300032002 Bacteria 1818
127 Ga0307416_100317347 3300032002 Bacteria 1558
128 Ga0307416_100868705 3300032002 Bacteria 1001
129 Ga0307416_100907231 3300032002 Bacteria 981
130 Ga0307414_10095570 3300032004 Bacteria 2221
131 Ga0307414_10155599 3300032004 Bacteria 1809
132 Ga0307411_10145844 3300032005 Bacteria 1752
133 Ga0307415_100016343 3300032126 Bacteria 4421
134 Ga0307415_100084883 3300032126 Bacteria 2273
135 Ga0307415_100463992 3300032126 Bacteria 1098
136 Ga0316583_10000290 3300032133 Bacteria 14071
137 Ga0316585_10004049 3300032137 Bacteria 4063
138 Ga0316580_10000815 3300032139 Bacteria 7628
139 Ga0373943_0082312 3300035170 Bacteria 1653
140 Ga0316574_0046002 3300035398 Bacteria 2704
141 Ga0373935_0127957 3300035692 Bacteria 1704
142 Ga0373927_0323097 3300035695 Bacteria 1016
143 Ga0373933_0106247 3300035724 Bacteria 1747
144 Ga0373925_0564508 3300037068 Bacteria 936
145 Ga0395899_0107509 3300037312 Bacteria 2008
146 Ga0395900_0071226 3300037418 Bacteria 3573
147 Ga0395900_0375840 3300037418 Bacteria 1390
148 Ga0395898_0209351 3300037466 Bacteria 1860
149 Ga0316581_0000003 3300037588 Bacteria 21847
150 Ga0395901_0274350 3300038443 Bacteria 1753
151 Ga0436365_1368124 3300039437 Bacteria 1187
152 Ga0436363_0951466 3300039450 Bacteria 825
153 Ga0439461_0051109 3300041410 Bacteria 917
154 Ga0439466_0042621 3300041411 Bacteria 1510
155 Ga0451793_1862904 3300041452 Bacteria 4203
156 Ga0451841_1025667 3300041498 Bacteria 963
157 Ga0439431_0014658 3300041997 Bacteria 1819
158 Ga0439442_001643 3300042002 Bacteria 4387
159 Ga0466965_0082425 3300044683 Bacteria 1627
160 Ga0466966_0084452 3300044684 Bacteria 1975
161 Ga0466961_0031447 3300044693 Bacteria 3412
162 Ga0466961_0032863 3300044693 Bacteria 3333
163 Ga0466961_0041350 3300044693 Bacteria 2955
164 Ga0466961_0123801 3300044693 Bacteria 1623
165 Ga0466963_0064807 3300044694 Bacteria 2449
166 Ga0466963_0184316 3300044694 Bacteria 1458
167 Ga0466963_0206830 3300044694 Bacteria 1373
168 Ga0466963_0383708 3300044694 Bacteria 990
169 Ga0466963_0480043 3300044694 Bacteria 877
170 Ga0466963_0606477 3300044694 Bacteria 773
171 Ga0466971_0038462 3300044719 Bacteria 2147
172 Ga0466968_0187452 3300044735 Bacteria 964
173 Ga0466970_0510658 3300044765 Bacteria 693
174 Ga0466957_0003764 3300044842 Bacteria 8383
175 Ga0466957_0006366 3300044842 Bacteria 6662
176 Ga0466957_0124905 3300044842 Bacteria 1643
177 Ga0466957_0145173 3300044842 Bacteria 1531
178 Ga0466957_0565246 3300044842 Bacteria 794
179 Ga0466960_0061812 3300044901 Bacteria 1839
180 Ga0466960_0102530 3300044901 Bacteria 1476
181 Ga0466960_0400710 3300044901 Bacteria 790
182 Ga0466958_0003634 3300045836 Bacteria 8044
183 Ga0466958_0029288 3300045836 Bacteria 3267
184 Ga0466958_0035581 3300045836 Bacteria 2975
185 Ga0466958_0113035 3300045836 Bacteria 1696
186 Ga0466958_0198270 3300045836 Bacteria 1277
187 Ga0466958_0277876 3300045836 Bacteria 1073
188 Ga0466958_0338261 3300045836 Bacteria 968
189 Ga0466958_0344541 3300045836 Bacteria 959
190 Ga0466967_0006570 3300045976 Bacteria 8252
191 Ga0466967_0008158 3300045976 Bacteria 7645
192 Ga0466967_0018715 3300045976 Bacteria 5546
193 Ga0466967_0056879 3300045976 Bacteria 3450
194 Ga0466967_0162360 3300045976 Bacteria 2098
195 Ga0466967_0172806 3300045976 Bacteria 2034
196 Ga0466967_0347365 3300045976 Bacteria 1435
197 Ga0466967_0653674 3300045976 Bacteria 1040
198 Ga0466967_0676770 3300045976 Bacteria 1021
199 Ga0466967_0698395 3300045976 Bacteria 1005
200 Ga0466967_0835897 3300045976 Bacteria 915
201 Ga0466967_0943800 3300045976 Bacteria 858
202 Ga0495592_0024030 3300046454 Bacteria 4635
203 Ga0495603_0338229 3300046455 Bacteria 864
204 Ga0495629_0126897 3300046459 Bacteria 1778
205 Ga0495582_0210313 3300046473 Bacteria 1112
206 Ga0495630_0044757 3300046517 Bacteria 3308
207 Ga0495586_0388611 3300046535 Bacteria 803
208 Ga0495668_0200366 3300046616 Bacteria 1093
209 Ga0495635_0072077 3300046663 Bacteria 2368
210 Ga0495581_0177734 3300047315 Bacteria 1244
211 Ga0495614_0156312 3300048089 Bacteria 1019
212 Ga0496104_0003242 3300048907 Bacteria 14017
213 Ga0496104_0051100 3300048907 Bacteria 3901
214 Ga0496104_0994904 3300048907 Bacteria 743
215 Ga0496105_0002753 3300048908 Bacteria 12835
216 Ga0496105_0175771 3300048908 Bacteria 1754
217 Ga0496105_0317393 3300048908 Bacteria 1250
218 Ga0496107_0019859 3300048910 Bacteria 4744
219 Ga0496107_0257084 3300048910 Bacteria 1300
220 Ga0496108_0008269 3300048911 Bacteria 8439
221 Ga0496108_0797836 3300048911 Bacteria 815
222 Ga0496109_0003813 3300048912 Bacteria 12587
223 Ga0496109_0029295 3300048912 Bacteria 4930
224 Ga0496109_0045349 3300048912 Bacteria 3989
225 Ga0496109_0487312 3300048912 Bacteria 1164
226 Ga0496109_0759852 3300048912 Bacteria 907
227 Ga0496110_0006899 3300048913 Bacteria 9029
228 Ga0496110_0054054 3300048913 Bacteria 3532
229 Ga0496110_0294858 3300048913 Bacteria 1477
230 Ga0496112_0002701 3300048915 Bacteria 14345
231 Ga0496112_0011134 3300048915 Bacteria 8200
232 Ga0496112_0197493 3300048915 Bacteria 1972
233 Ga0496112_0242389 3300048915 Bacteria 1755
234 Ga0496113_0023292 3300048916 Bacteria 4391
235 Ga0496113_0034145 3300048916 Bacteria 3709
236 Ga0496113_0272356 3300048916 Bacteria 1353
237 Ga0496114_0024755 3300048917 Bacteria 4900
238 Ga0496114_0107046 3300048917 Bacteria 2393
239 Ga0496114_0148606 3300048917 Bacteria 2032
240 Ga0496115_0002112 3300048918 Bacteria 14215
241 Ga0496115_0038759 3300048918 Bacteria 3783
242 Ga0496118_0000236 3300048921 Bacteria 97321
243 Ga0496126_0051567 3300048929 Bacteria 3744
244 Ga0501033_0460052 3300049570 Bacteria 883
245 Ga0501034_0011609 3300049571 Bacteria 9123
246 Ga0501034_0031217 3300049571 Bacteria 5413
247 Ga0501037_0032999 3300049573 Bacteria 3825
248 Ga0501039_0510157 3300049575 Bacteria 944
249 Ga0501041_0026540 3300049577 Bacteria 3485
250 Ga0501042_0011963 3300049578 Bacteria 5865
251 Ga0501042_0355918 3300049578 Bacteria 1059
252 Ga0501042_0372837 3300049578 Bacteria 1033
253 Ga0501046_0342722 3300049580 Bacteria 1086
254 Ga0501047_0009692 3300049581 Bacteria 9106
255 Ga0501047_0667238 3300049581 Bacteria 858
256 Ga0501048_0588288 3300049582 Bacteria 799
257 Ga0501067_0000737 3300049583 Bacteria 17597
258 Ga0501067_0004744 3300049583 Bacteria 7527
259 Ga0501070_0001088 3300049586 Bacteria 24414
260 Ga0501070_0003998 3300049586 Bacteria 12669
261 Ga0501070_0016388 3300049586 Bacteria 6225
262 Ga0501070_0034383 3300049586 Bacteria 4238
263 Ga0501070_0037009 3300049586 Bacteria 4074
264 Ga0501071_0079301 3300049587 Bacteria 2400
265 Ga0501072_0016849 3300049588 Bacteria 5614
266 Ga0501072_0049938 3300049588 Bacteria 3293
267 Ga0501072_0072728 3300049588 Bacteria 2718
268 Ga0501072_0196302 3300049588 Bacteria 1609
269 Ga0501073_0005155 3300049589 Bacteria 9803
270 Ga0501073_0007181 3300049589 Bacteria 8296
271 Ga0501073_0022381 3300049589 Bacteria 4552
272 Ga0501073_0084924 3300049589 Bacteria 2203
273 Ga0501074_0000190 3300049590 Bacteria 33389
274 Ga0501074_0003151 3300049590 Bacteria 11631
275 Ga0501074_0017766 3300049590 Bacteria 5167
276 Ga0501076_0057348 3300049592 Bacteria 3092
277 Ga0501076_0361926 3300049592 Bacteria 1192
278 Ga0501077_0010394 3300049593 Bacteria 5791
279 Ga0501077_0038904 3300049593 Bacteria 3029
280 Ga0501077_0108557 3300049593 Bacteria 1758
281 Ga0501079_0000252 3300049741 Bacteria 32565
282 Ga0501079_0048096 3300049741 Bacteria 3291
283 Ga0501079_0326764 3300049741 Bacteria 1201
284 Ga0501079_0445079 3300049741 Bacteria 1017
285 Ga0501080_0000900 3300049742 Bacteria 24352
286 Ga0501080_0008216 3300049742 Bacteria 9450
287 Ga0501080_0014552 3300049742 Bacteria 7247
288 Ga0501083_0008889 3300049744 Bacteria 7094
289 Ga0501083_0039036 3300049744 Bacteria 3225
290 Ga0501083_0529284 3300049744 Bacteria 767
291 Ga0501035_0001268 3300049822 Bacteria 26187
292 Ga0501035_0037808 3300049822 Bacteria 4369
293 Ga0501044_0001737 3300049823 Bacteria 25445
294 Ga0501045_0009609 3300049824 Bacteria 6770
295 Ga0501045_0503329 3300049824 Bacteria 900
296 nmdc:mga00v17_14769_c1 3300050491 Bacteria 4368
297 nmdc:mga00v17_64211_c1 3300050491 Bacteria 2262
298 nmdc:mga0yw44_28141_c1 3300050492 Bacteria 3230
299 nmdc:mga07m45_58001_c1 3300050496 Bacteria 2190
300 nmdc:mga07m45_7348_c1 3300050496 Bacteria 5624
301 nmdc:mga0n895_248767_c1 3300050512 Bacteria 1804
302 nmdc:mga0rr50_359943_c1 3300050513 Bacteria 1224
303 nmdc:mga0sz30_243052_c1 3300050516 Bacteria 801
304 nmdc:mga0sz30_70861_c1 3300050516 Bacteria 1500
305 Ga0495601_0270800 3300053077 Bacteria 1108
306 Ga0495601_0395335 3300053077 Bacteria 896
307 Ga0495612_0011773 3300053078 Bacteria 3525
308 Ga0495619_0368251 3300053085 Bacteria 993
309 Ga0500573_0029316 3300053140 Bacteria 3173
310 Ga0500636_0122700 3300053177 Bacteria 1456
311 Ga0501084_0123775 3300054114 Bacteria 2175
312 Ga0501084_0362294 3300054114 Bacteria 1225
313 Ga0501082_0006900 3300060353 Bacteria 9826
314 Ga0501082_0016296 3300060353 Bacteria 6398
315 Ga0501082_0051234 3300060353 Bacteria 3558
316 Ga0501082_0078005 3300060353 Bacteria 2857
317 Ga0501082_0352458 3300060353 Bacteria 1283
318 Ga0466962_0019826 3300061719 Bacteria 3231
319 Ga0530510_0034731 3300061734 Bacteria 3633
320 Ga0530510_0632350 3300061734 Bacteria 815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_11652685 Ga0157380_116526852 185
2 3300049570 Ga0501033_0460052 Ga0501033_0460052_10_588 192
3 3300045976 Ga0466967_0056879 Ga0466967_0056879_514_1140 198
4 3300048912 Ga0496109_0759852 Ga0496109_0759852_28_645 198
5 3300053177 Ga0500636_0122700 Ga0500636_0122700_658_1272 198
6 3300061734 Ga0530510_0632350 Ga0530510_0632350_173_799 198
7 3300048917 Ga0496114_0107046 Ga0496114_0107046_1227_1889 205
8 3300048929 Ga0496126_0051567 Ga0496126_0051567_397_1059 205
9 3300048907 Ga0496104_0994904 Ga0496104_0994904_102_725 207
10 3300045836 Ga0466958_0113035 Ga0466958_0113035_833_1495 208
11 3300045976 Ga0466967_0172806 Ga0466967_0172806_108_770 208
12 3300050491 nmdc:mga00v17_14769_c1 nmdc:mga00v17_14769_c1_927_1589 208
13 3300050496 nmdc:mga07m45_7348_c1 nmdc:mga07m45_7348_c1_3871_4533 208
14 3300050516 nmdc:mga0sz30_70861_c1 nmdc:mga0sz30_70861_c1_657_1319 208
15 3300006186 Ga0075369_10006783 Ga0075369_100067831 209
16 3300041410 Ga0439461_0051109 Ga0439461_0051109_30_701 209
17 3300041411 Ga0439466_0042621 Ga0439466_0042621_506_1177 209
18 3300041997 Ga0439431_0014658 Ga0439431_0014658_608_1279 209
19 3300042002 Ga0439442_001643 Ga0439442_001643_1375_2046 209
20 3300050516 nmdc:mga0sz30_243052_c1 nmdc:mga0sz30_243052_c1_49_720 209
21 3300005366 Ga0070659_100486539 Ga0070659_1004865392 210
22 3300046473 Ga0495582_0210313 Ga0495582_0210313_315_977 210
23 3300048089 Ga0495614_0156312 Ga0495614_0156312_199_843 210
24 3300053077 Ga0495601_0270800 Ga0495601_0270800_11_643 210
25 3300006048 Ga0075363_100075096 Ga0075363_1000750963 211
26 3300006051 Ga0075364_10023685 Ga0075364_100236854 211
27 3300006051 Ga0075364_10083843 Ga0075364_100838432 211
28 3300006186 Ga0075369_10011343 Ga0075369_100113434 211
29 3300048921 Ga0496118_0000236 Ga0496118_0000236_8099_8770 211
30 3300050491 nmdc:mga00v17_64211_c1 nmdc:mga00v17_64211_c1_422_1093 211
31 3300035170 Ga0373943_0082312 Ga0373943_0082312_698_1336 212
32 3300049589 Ga0501073_0084924 Ga0501073_0084924_710_1348 212
33 3300031712 Ga0265342_10255754 Ga0265342_102557542 214
34 3300048912 Ga0496109_0487312 Ga0496109_0487312_416_1060 214
35 3300025901 Ga0207688_10108627 Ga0207688_101086272 215
36 3300025938 Ga0207704_10341514 Ga0207704_103415141 215
37 iso_pu_bacteria 2515154155 2515854065 215
38 iso_pu_bacteria 2622736605 2623501253 215
39 iso_pu_bacteria 2738541264 2738668851 215
40 iso_pu_bacteria 2738541356 2739148043 215
41 3300005336 Ga0070680_100119817 Ga0070680_1001198171 216
42 3300005339 Ga0070660_100268836 Ga0070660_1002688361 216
43 3300005458 Ga0070681_10073850 Ga0070681_100738504 216
44 3300005530 Ga0070679_100163006 Ga0070679_1001630062 216
45 3300013306 Ga0163162_10576812 Ga0163162_105768122 216
46 3300025909 Ga0207705_10178238 Ga0207705_101782381 216
47 3300025912 Ga0207707_10051887 Ga0207707_100518874 216
48 3300025917 Ga0207660_10127600 Ga0207660_101276003 216
49 3300025919 Ga0207657_10199514 Ga0207657_101995141 216
50 3300025921 Ga0207652_10093642 Ga0207652_100936424 216
51 3300031344 Ga0265316_10051281 Ga0265316_100512812 216
52 3300048915 Ga0496112_0197493 Ga0496112_0197493_818_1468 216
53 3300009553 Ga0105249_10306061 Ga0105249_103060612 217
54 3300013308 Ga0157375_10371362 Ga0157375_103713622 217
55 3300031711 Ga0265314_10091522 Ga0265314_100915223 217
56 3300037588 Ga0316581_0000003 Ga0316581_0000003_12491_13159 217
57 3300041452 Ga0451793_1862904 Ga0451793_1862904_2087_2803 217
58 3300041498 Ga0451841_1025667 Ga0451841_1025667_25_741 217
59 3300044842 Ga0466957_0003764 Ga0466957_0003764_7706_8359 217
60 3300045836 Ga0466958_0338261 Ga0466958_0338261_280_933 217
61 3300045976 Ga0466967_0162360 Ga0466967_0162360_521_1174 217
62 3300047315 Ga0495581_0177734 Ga0495581_0177734_54_722 217
63 3300048917 Ga0496114_0148606 Ga0496114_0148606_788_1504 217
64 3300049571 Ga0501034_0011609 Ga0501034_0011609_1954_2637 217
65 3300049581 Ga0501047_0667238 Ga0501047_0667238_96_779 217
66 3300049583 Ga0501067_0000737 Ga0501067_0000737_12915_13598 217
67 3300049583 Ga0501067_0004744 Ga0501067_0004744_1090_1773 217
68 3300049586 Ga0501070_0003998 Ga0501070_0003998_7208_7891 217
69 3300049586 Ga0501070_0034383 Ga0501070_0034383_2488_3171 217
70 3300049586 Ga0501070_0037009 Ga0501070_0037009_648_1331 217
71 3300049587 Ga0501071_0079301 Ga0501071_0079301_1681_2364 217
72 3300049588 Ga0501072_0016849 Ga0501072_0016849_4312_4995 217
73 3300049588 Ga0501072_0049938 Ga0501072_0049938_1921_2604 217
74 3300049589 Ga0501073_0005155 Ga0501073_0005155_2847_3530 217
75 3300049589 Ga0501073_0007181 Ga0501073_0007181_2062_2745 217
76 3300049590 Ga0501074_0003151 Ga0501074_0003151_5322_6005 217
77 3300049590 Ga0501074_0017766 Ga0501074_0017766_3934_4617 217
78 3300049593 Ga0501077_0010394 Ga0501077_0010394_1923_2606 217
79 3300049593 Ga0501077_0108557 Ga0501077_0108557_1014_1697 217
80 3300049741 Ga0501079_0048096 Ga0501079_0048096_2383_3066 217
81 3300049742 Ga0501080_0008216 Ga0501080_0008216_5474_6157 217
82 3300049742 Ga0501080_0014552 Ga0501080_0014552_1834_2517 217
83 3300049744 Ga0501083_0008889 Ga0501083_0008889_5608_6291 217
84 3300049744 Ga0501083_0039036 Ga0501083_0039036_1959_2642 217
85 3300050496 nmdc:mga07m45_58001_c1 nmdc:mga07m45_58001_c1_1323_1991 217
86 3300054114 Ga0501084_0123775 Ga0501084_0123775_194_847 217
87 3300054114 Ga0501084_0362294 Ga0501084_0362294_377_1060 217
88 3300060353 Ga0501082_0016296 Ga0501082_0016296_2516_3199 217
89 3300060353 Ga0501082_0051234 Ga0501082_0051234_1028_1711 217
90 3300005336 Ga0070680_100069986 Ga0070680_1000699862 218
91 3300005530 Ga0070679_100284431 Ga0070679_1002844312 218
92 3300013100 Ga0157373_10092145 Ga0157373_100921452 218
93 3300025917 Ga0207660_10042291 Ga0207660_100422914 218
94 3300025921 Ga0207652_10048550 Ga0207652_100485503 218
95 3300039437 Ga0436365_1368124 Ga0436365_1368124_107_763 218
96 3300039450 Ga0436363_0951466 Ga0436363_0951466_56_712 218
97 3300049578 Ga0501042_0372837 Ga0501042_0372837_288_944 218
98 3300049588 Ga0501072_0072728 Ga0501072_0072728_171_827 218
99 3300049592 Ga0501076_0361926 Ga0501076_0361926_292_948 218
100 3300005327 Ga0070658_10035258 Ga0070658_100352582 219
101 3300005329 Ga0070683_100015361 Ga0070683_1000153612 219
102 3300005336 Ga0070680_100050582 Ga0070680_1000505822 219
103 3300005337 Ga0070682_100150100 Ga0070682_1001501002 219
104 3300005338 Ga0068868_100041578 Ga0068868_1000415784 219
105 3300005339 Ga0070660_100084065 Ga0070660_1000840653 219
106 3300005339 Ga0070660_100137398 Ga0070660_1001373981 219
107 3300005345 Ga0070692_10022271 Ga0070692_100222712 219
108 3300005354 Ga0070675_100949973 Ga0070675_1009499731 219
109 3300005365 Ga0070688_100233897 Ga0070688_1002338972 219
110 3300005366 Ga0070659_100002036 Ga0070659_10000203612 219
111 3300005366 Ga0070659_100002106 Ga0070659_10000210612 219
112 3300005436 Ga0070713_100688968 Ga0070713_1006889682 219
113 3300005441 Ga0070700_100103397 Ga0070700_1001033972 219
114 3300005455 Ga0070663_100097537 Ga0070663_1000975372 219
115 3300005458 Ga0070681_10053718 Ga0070681_100537182 219
116 3300005468 Ga0070707_100187313 Ga0070707_1001873132 219
117 3300005530 Ga0070679_100082411 Ga0070679_1000824112 219
118 3300005535 Ga0070684_100299878 Ga0070684_1002998782 219
119 3300005545 Ga0070695_100065402 Ga0070695_1000654022 219
120 3300005548 Ga0070665_100346936 Ga0070665_1003469362 219
121 3300005564 Ga0070664_100757236 Ga0070664_1007572361 219
122 3300006038 Ga0075365_10131669 Ga0075365_101316692 219
123 3300006173 Ga0070716_100170363 Ga0070716_1001703631 219
124 3300006871 Ga0075434_100249599 Ga0075434_1002495991 219
125 3300009093 Ga0105240_10375149 Ga0105240_103751492 219
126 3300009094 Ga0111539_10154881 Ga0111539_101548813 219
127 3300009098 Ga0105245_10057916 Ga0105245_100579162 219
128 3300009176 Ga0105242_10136794 Ga0105242_101367942 219
129 3300009176 Ga0105242_10487463 Ga0105242_104874632 219
130 3300009177 Ga0105248_11365329 Ga0105248_113653291 219
131 3300009545 Ga0105237_10359947 Ga0105237_103599472 219
132 3300013105 Ga0157369_10127600 Ga0157369_101276002 219
133 3300013297 Ga0157378_10333780 Ga0157378_103337802 219
134 3300013297 Ga0157378_10730395 Ga0157378_107303951 219
135 3300013306 Ga0163162_11239771 Ga0163162_112397712 219
136 3300013308 Ga0157375_10125288 Ga0157375_101252884 219
137 3300014497 Ga0182008_10103405 Ga0182008_101034052 219
138 3300014968 Ga0157379_10829551 Ga0157379_108295512 219
139 3300025303 Ga0209051_1000048 Ga0209051_1000048259 219
140 3300025912 Ga0207707_10032752 Ga0207707_100327522 219
141 3300025913 Ga0207695_10320524 Ga0207695_103205243 219
142 3300025919 Ga0207657_10044415 Ga0207657_100444152 219
143 3300025919 Ga0207657_10055002 Ga0207657_100550024 219
144 3300025921 Ga0207652_10105555 Ga0207652_101055552 219
145 3300025921 Ga0207652_10823917 Ga0207652_108239171 219
146 3300025922 Ga0207646_10226186 Ga0207646_102261862 219
147 3300025927 Ga0207687_10217481 Ga0207687_102174812 219
148 3300025932 Ga0207690_10000222 Ga0207690_1000022211 219
149 3300025932 Ga0207690_10006421 Ga0207690_100064217 219
150 3300025934 Ga0207686_10480000 Ga0207686_104800001 219
151 3300025938 Ga0207704_10446067 Ga0207704_104460672 219
152 3300025938 Ga0207704_10452625 Ga0207704_104526251 219
153 3300025944 Ga0207661_10072267 Ga0207661_100722672 219
154 3300025944 Ga0207661_10082618 Ga0207661_100826182 219
155 3300026023 Ga0207677_10014982 Ga0207677_100149824 219
156 3300026067 Ga0207678_10069567 Ga0207678_100695673 219
157 3300026121 Ga0207683_10970332 Ga0207683_109703321 219
158 3300028379 Ga0268266_10104444 Ga0268266_101044443 219
159 3300028577 Ga0265318_10036010 Ga0265318_100360102 219
160 3300028800 Ga0265338_10000913 Ga0265338_1000091325 219
161 3300028800 Ga0265338_10079504 Ga0265338_100795043 219
162 3300031238 Ga0265332_10052479 Ga0265332_100524792 219
163 3300031241 Ga0265325_10002553 Ga0265325_1000255313 219
164 3300031249 Ga0265339_10001052 Ga0265339_1000105216 219
165 3300031251 Ga0265327_10004595 Ga0265327_1000459510 219
166 3300031344 Ga0265316_10035527 Ga0265316_100355273 219
167 3300031548 Ga0307408_100094607 Ga0307408_1000946073 219
168 3300031548 Ga0307408_100210719 Ga0307408_1002107191 219
169 3300031595 Ga0265313_10000403 Ga0265313_1000040325 219
170 3300031665 Ga0316575_10002265 Ga0316575_100022654 219
171 3300031691 Ga0316579_10008229 Ga0316579_100082296 219
172 3300031711 Ga0265314_10085951 Ga0265314_100859512 219
173 3300031727 Ga0316576_10001166 Ga0316576_1000116614 219
174 3300031728 Ga0316578_10000042 Ga0316578_1000004217 219
175 3300031728 Ga0316578_10267999 Ga0316578_102679991 219
176 3300031731 Ga0307405_10165396 Ga0307405_101653962 219
177 3300031733 Ga0316577_10001922 Ga0316577_100019222 219
178 3300031733 Ga0316577_10165964 Ga0316577_101659641 219
179 3300031824 Ga0307413_10173924 Ga0307413_101739241 219
180 3300031824 Ga0307413_10254006 Ga0307413_102540062 219
181 3300031824 Ga0307413_10428158 Ga0307413_104281581 219
182 3300031852 Ga0307410_10006221 Ga0307410_100062213 219
183 3300031852 Ga0307410_10062980 Ga0307410_100629803 219
184 3300031852 Ga0307410_10144764 Ga0307410_101447642 219
185 3300031901 Ga0307406_10064815 Ga0307406_100648153 219
186 3300031901 Ga0307406_10101946 Ga0307406_101019462 219
187 3300031901 Ga0307406_10501325 Ga0307406_105013251 219
188 3300031903 Ga0307407_10230233 Ga0307407_102302332 219
189 3300031903 Ga0307407_10409789 Ga0307407_104097892 219
190 3300031911 Ga0307412_10449857 Ga0307412_104498572 219
191 3300031995 Ga0307409_100091238 Ga0307409_1000912382 219
192 3300031995 Ga0307409_100094428 Ga0307409_1000944283 219
193 3300031995 Ga0307409_100434353 Ga0307409_1004343531 219
194 3300032002 Ga0307416_100054958 Ga0307416_1000549582 219
195 3300032002 Ga0307416_100073248 Ga0307416_1000732482 219
196 3300032002 Ga0307416_100220588 Ga0307416_1002205882 219
197 3300032002 Ga0307416_100317347 Ga0307416_1003173472 219
198 3300032002 Ga0307416_100868705 Ga0307416_1008687052 219
199 3300032002 Ga0307416_100907231 Ga0307416_1009072312 219
200 3300032004 Ga0307414_10095570 Ga0307414_100955702 219
201 3300032004 Ga0307414_10155599 Ga0307414_101555991 219
202 3300032005 Ga0307411_10145844 Ga0307411_101458442 219
203 3300032126 Ga0307415_100016343 Ga0307415_1000163435 219
204 3300032126 Ga0307415_100084883 Ga0307415_1000848833 219
205 3300032126 Ga0307415_100463992 Ga0307415_1004639921 219
206 3300032133 Ga0316583_10000290 Ga0316583_100002902 219
207 3300032137 Ga0316585_10004049 Ga0316585_100040496 219
208 3300032139 Ga0316580_10000815 Ga0316580_100008155 219
209 3300035398 Ga0316574_0046002 Ga0316574_0046002_1730_2401 219
210 3300035692 Ga0373935_0127957 Ga0373935_0127957_398_1057 219
211 3300035695 Ga0373927_0323097 Ga0373927_0323097_78_737 219
212 3300035724 Ga0373933_0106247 Ga0373933_0106247_388_1047 219
213 3300037068 Ga0373925_0564508 Ga0373925_0564508_34_693 219
214 3300037312 Ga0395899_0107509 Ga0395899_0107509_1031_1690 219
215 3300037418 Ga0395900_0071226 Ga0395900_0071226_1875_2546 219
216 3300037418 Ga0395900_0375840 Ga0395900_0375840_459_1130 219
217 3300037466 Ga0395898_0209351 Ga0395898_0209351_786_1457 219
218 3300038443 Ga0395901_0274350 Ga0395901_0274350_684_1355 219
219 3300044683 Ga0466965_0082425 Ga0466965_0082425_206_877 219
220 3300044684 Ga0466966_0084452 Ga0466966_0084452_449_1111 219
221 3300044693 Ga0466961_0031447 Ga0466961_0031447_2608_3267 219
222 3300044693 Ga0466961_0032863 Ga0466961_0032863_219_878 219
223 3300044693 Ga0466961_0041350 Ga0466961_0041350_2125_2808 219
224 3300044693 Ga0466961_0123801 Ga0466961_0123801_152_823 219
225 3300044694 Ga0466963_0064807 Ga0466963_0064807_1424_2095 219
226 3300044694 Ga0466963_0184316 Ga0466963_0184316_54_713 219
227 3300044694 Ga0466963_0206830 Ga0466963_0206830_14_685 219
228 3300044694 Ga0466963_0383708 Ga0466963_0383708_208_879 219
229 3300044694 Ga0466963_0480043 Ga0466963_0480043_81_752 219
230 3300044694 Ga0466963_0606477 Ga0466963_0606477_49_720 219
231 3300044719 Ga0466971_0038462 Ga0466971_0038462_494_1153 219
232 3300044735 Ga0466968_0187452 Ga0466968_0187452_225_884 219
233 3300044765 Ga0466970_0510658 Ga0466970_0510658_12_683 219
234 3300044842 Ga0466957_0006366 Ga0466957_0006366_2120_2779 219
235 3300044842 Ga0466957_0124905 Ga0466957_0124905_820_1491 219
236 3300044842 Ga0466957_0145173 Ga0466957_0145173_559_1230 219
237 3300044842 Ga0466957_0565246 Ga0466957_0565246_46_717 219
238 3300044901 Ga0466960_0061812 Ga0466960_0061812_53_724 219
239 3300044901 Ga0466960_0102530 Ga0466960_0102530_785_1456 219
240 3300044901 Ga0466960_0400710 Ga0466960_0400710_25_696 219
241 3300045836 Ga0466958_0003634 Ga0466958_0003634_2115_2774 219
242 3300045836 Ga0466958_0029288 Ga0466958_0029288_2425_3096 219
243 3300045836 Ga0466958_0035581 Ga0466958_0035581_323_994 219
244 3300045836 Ga0466958_0198270 Ga0466958_0198270_37_708 219
245 3300045836 Ga0466958_0277876 Ga0466958_0277876_129_800 219
246 3300045836 Ga0466958_0344541 Ga0466958_0344541_107_778 219
247 3300045976 Ga0466967_0006570 Ga0466967_0006570_6677_7348 219
248 3300045976 Ga0466967_0008158 Ga0466967_0008158_3045_3716 219
249 3300045976 Ga0466967_0018715 Ga0466967_0018715_1503_2162 219
250 3300045976 Ga0466967_0347365 Ga0466967_0347365_658_1329 219
251 3300045976 Ga0466967_0653674 Ga0466967_0653674_363_1022 219
252 3300045976 Ga0466967_0676770 Ga0466967_0676770_286_957 219
253 3300045976 Ga0466967_0698395 Ga0466967_0698395_29_688 219
254 3300045976 Ga0466967_0835897 Ga0466967_0835897_106_765 219
255 3300045976 Ga0466967_0943800 Ga0466967_0943800_51_710 219
256 3300046454 Ga0495592_0024030 Ga0495592_0024030_1364_2047 219
257 3300046455 Ga0495603_0338229 Ga0495603_0338229_57_716 219
258 3300046459 Ga0495629_0126897 Ga0495629_0126897_1064_1723 219
259 3300046517 Ga0495630_0044757 Ga0495630_0044757_2433_3092 219
260 3300046535 Ga0495586_0388611 Ga0495586_0388611_34_693 219
261 3300046616 Ga0495668_0200366 Ga0495668_0200366_61_732 219
262 3300046663 Ga0495635_0072077 Ga0495635_0072077_1369_2028 219
263 3300048907 Ga0496104_0003242 Ga0496104_0003242_4916_5605 219
264 3300048907 Ga0496104_0051100 Ga0496104_0051100_1970_2629 219
265 3300048908 Ga0496105_0002753 Ga0496105_0002753_3479_4168 219
266 3300048908 Ga0496105_0175771 Ga0496105_0175771_739_1398 219
267 3300048908 Ga0496105_0317393 Ga0496105_0317393_16_675 219
268 3300048910 Ga0496107_0019859 Ga0496107_0019859_3904_4593 219
269 3300048910 Ga0496107_0257084 Ga0496107_0257084_564_1253 219
270 3300048911 Ga0496108_0008269 Ga0496108_0008269_5440_6099 219
271 3300048911 Ga0496108_0797836 Ga0496108_0797836_57_716 219
272 3300048912 Ga0496109_0003813 Ga0496109_0003813_1988_2647 219
273 3300048912 Ga0496109_0029295 Ga0496109_0029295_2255_2944 219
274 3300048912 Ga0496109_0045349 Ga0496109_0045349_2791_3450 219
275 3300048913 Ga0496110_0006899 Ga0496110_0006899_3449_4108 219
276 3300048913 Ga0496110_0054054 Ga0496110_0054054_650_1309 219
277 3300048913 Ga0496110_0294858 Ga0496110_0294858_149_838 219
278 3300048915 Ga0496112_0002701 Ga0496112_0002701_7956_8615 219
279 3300048915 Ga0496112_0011134 Ga0496112_0011134_4296_4955 219
280 3300048915 Ga0496112_0242389 Ga0496112_0242389_485_1144 219
281 3300048916 Ga0496113_0023292 Ga0496113_0023292_82_741 219
282 3300048916 Ga0496113_0034145 Ga0496113_0034145_316_1029 219
283 3300048916 Ga0496113_0272356 Ga0496113_0272356_210_869 219
284 3300048917 Ga0496114_0024755 Ga0496114_0024755_3381_4070 219
285 3300048918 Ga0496115_0002112 Ga0496115_0002112_13071_13760 219
286 3300048918 Ga0496115_0038759 Ga0496115_0038759_2722_3381 219
287 3300049571 Ga0501034_0031217 Ga0501034_0031217_462_1133 219
288 3300049573 Ga0501037_0032999 Ga0501037_0032999_2883_3542 219
289 3300049575 Ga0501039_0510157 Ga0501039_0510157_37_708 219
290 3300049577 Ga0501041_0026540 Ga0501041_0026540_382_1041 219
291 3300049578 Ga0501042_0011963 Ga0501042_0011963_144_803 219
292 3300049578 Ga0501042_0355918 Ga0501042_0355918_159_830 219
293 3300049580 Ga0501046_0342722 Ga0501046_0342722_278_1042 219
294 3300049581 Ga0501047_0009692 Ga0501047_0009692_4998_5669 219
295 3300049582 Ga0501048_0588288 Ga0501048_0588288_58_729 219
296 3300049586 Ga0501070_0001088 Ga0501070_0001088_6000_6659 219
297 3300049586 Ga0501070_0016388 Ga0501070_0016388_3852_4511 219
298 3300049588 Ga0501072_0196302 Ga0501072_0196302_165_824 219
299 3300049589 Ga0501073_0022381 Ga0501073_0022381_1072_1731 219
300 3300049590 Ga0501074_0000190 Ga0501074_0000190_9425_10084 219
301 3300049592 Ga0501076_0057348 Ga0501076_0057348_2343_3002 219
302 3300049593 Ga0501077_0038904 Ga0501077_0038904_113_772 219
303 3300049741 Ga0501079_0000252 Ga0501079_0000252_17500_18159 219
304 3300049741 Ga0501079_0326764 Ga0501079_0326764_51_710 219
305 3300049741 Ga0501079_0445079 Ga0501079_0445079_304_978 219
306 3300049742 Ga0501080_0000900 Ga0501080_0000900_8213_8872 219
307 3300049744 Ga0501083_0529284 Ga0501083_0529284_22_681 219
308 3300049822 Ga0501035_0001268 Ga0501035_0001268_5223_5894 219
309 3300049822 Ga0501035_0037808 Ga0501035_0037808_1357_2016 219
310 3300049823 Ga0501044_0001737 Ga0501044_0001737_4536_5207 219
311 3300049824 Ga0501045_0009609 Ga0501045_0009609_1491_2150 219
312 3300049824 Ga0501045_0503329 Ga0501045_0503329_202_876 219
313 3300050492 nmdc:mga0yw44_28141_c1 nmdc:mga0yw44_28141_c1_1977_2666 219
314 3300050512 nmdc:mga0n895_248767_c1 nmdc:mga0n895_248767_c1_1047_1706 219
315 3300050513 nmdc:mga0rr50_359943_c1 nmdc:mga0rr50_359943_c1_335_994 219
316 3300053077 Ga0495601_0395335 Ga0495601_0395335_202_873 219
317 3300053078 Ga0495612_0011773 Ga0495612_0011773_698_1369 219
318 3300053085 Ga0495619_0368251 Ga0495619_0368251_122_781 219
319 3300053140 Ga0500573_0029316 Ga0500573_0029316_657_1331 219
320 3300060353 Ga0501082_0006900 Ga0501082_0006900_1787_2446 219
321 3300060353 Ga0501082_0078005 Ga0501082_0078005_1317_1976 219
322 3300060353 Ga0501082_0352458 Ga0501082_0352458_486_1145 219
323 3300061719 Ga0466962_0019826 Ga0466962_0019826_1724_2395 219
324 3300061734 Ga0530510_0034731 Ga0530510_0034731_420_1079 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21003

NucS_N

Endonuclease NucS N-terminal PH-like domain

30

128

0.95

PF01939

NucS_C

Endonuclease NucS C-terminal domain

134

254

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5z-assembly1.cif.gz_Bl structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9217 178 203
4v6u-assembly1.cif.gz_BL promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes 0.893 177 203
5umd-assembly1.cif.gz_O structure of the plasmodium falciparum 80s ribosome bound to the antimalarial drug mefloquine 0.8754 177 204
8cg8-assembly1.cif.gz_M translocation intermediate 3 (ti-3) of 80s s. cerevisiae ribosome with ligands and eef2 in the presence of sordarin 0.8604 176 204
5t5h-assembly1.cif.gz_b structure and assembly model for the trypanosoma cruzi 60s ribosomal subunit 0.8529 177 204
ID Description Score Start End Superfamily
af_P9WIY5_101_213_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9765 94 206 3.40.1350.10
af_P9WIY5_101_213_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.968 94 206 3.40.1350.10
af_Q4E4Q8_58_145_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9196 178 204 3.100.10.10
af_P9WIY5_1_96_2.70.180.20 Mainly Beta;Distorted Sandwich;Protein Yojf; Chain: A;; 0.9061 2 89 2.70.180.20
2vldB02 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.868 96 205 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A1V3XH57-F1-model_v4 Endonuclease NucS C-terminal domain-containing protein 0.9942 95 211 GO:0003677
GO:0004519
AF-A0A6J6R3V0-F1-model_v4 Unannotated protein 0.9891 100 211 GO:0003677
GO:0004519
AF-X8F319-F1-model_v4 deleted 0.9879 100 201
AF-X8F319-F1-model_v4 deleted 0.9689 100 201
AF-A0A6G3XA65-F1-model_v4 DUF91 domain-containing protein 0.9655 130 217 GO:0003677
GO:0004519

Feature Viewer

pLDDT pTM Quality
90.1 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map