F407348

General Info

Members Datasets Scaffolds Average Seq Length
324 231 322 286

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10208206|Ga0105242_102082062
Length 328
Sequence MVSAGKMRADWQLNHPTEFPVQVNCQTVLFRGTCDMSHLNTHLLPELLSLSPRAEWTRRDFVGCTLAAGFALAVQPVSAQTIVTDNTGLTAGEVRIPVRGGEIPGYRAMPAGGKDLPLVLVVQEIFGVHEHIRDVCRRLAKLGYIAVAPELFVRQGDVSKLSDMKEIFAIVEKVPDMQVMHDLDDTMSWARKNGANVTQVAITGFCWGGRIVWLYCEHNPMVAAGVAWYGRLEGQSNDLRPTFPIDIAPKLKVPVLGLYGGADTGISKESIEKMRLALKTAKSKSEIIVYPDAPHAFFADYRPSYRKEPAEDGWKKMRDWLENNLSRV

Samples

Sample ID Description Type Environment
1 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
2 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
181 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
182 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
183 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
184 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
185 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
186 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
187 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
188 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
201 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
202 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
203 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
204 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
205 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
206 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
207 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
208 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
209 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
210 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
211 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
212 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
213 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
218 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
219 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
220 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
221 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
222 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.31
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 0.62
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10120503 3300003323 Bacteria 4143
2 Ga0058860_10021805 3300004801 Unclassified 2173
3 Ga0070683_100003517 3300005329 Bacteria 12747
4 Ga0070690_100004455 3300005330 Bacteria 7778
5 Ga0070690_100043379 3300005330 Bacteria 2852
6 Ga0070670_100257696 3300005331 Bacteria 1520
7 Ga0068869_100007742 3300005334 Bacteria 6888
8 Ga0070666_10035694 3300005335 Bacteria 3298
9 Ga0070680_100067488 3300005336 Bacteria 2934
10 Ga0070682_100056676 3300005337 Bacteria 2465
11 Ga0070689_100003155 3300005340 Bacteria 10899
12 Ga0070689_100007585 3300005340 Bacteria 7599
13 Ga0070689_100020039 3300005340 Bacteria 4957
14 Ga0070692_10058972 3300005345 Bacteria 2017
15 Ga0070668_100021832 3300005347 Bacteria 4836
16 Ga0070669_100002717 3300005353 Bacteria 12765
17 Ga0070674_100007030 3300005356 Bacteria 6615
18 Ga0070674_100055973 3300005356 Bacteria 2734
19 Ga0070673_100003506 3300005364 Bacteria 9779
20 Ga0070688_100021789 3300005365 Bacteria 3747
21 Ga0070688_100025488 3300005365 Bacteria 3501
22 Ga0070659_100355166 3300005366 Bacteria 1230
23 Ga0070667_100027269 3300005367 Bacteria 4752
24 Ga0070667_100172304 3300005367 Bacteria 1911
25 Ga0070714_100028700 3300005435 Bacteria 4620
26 Ga0070701_10026886 3300005438 Bacteria 2812
27 Ga0070711_100214718 3300005439 Bacteria 1492
28 Ga0070700_100000870 3300005441 Bacteria 14867
29 Ga0070700_100004897 3300005441 Bacteria 7038
30 Ga0070700_100041961 3300005441 Bacteria 2807
31 Ga0070694_100166560 3300005444 Bacteria 1621
32 Ga0070708_100375475 3300005445 Bacteria 1340
33 Ga0070678_100003866 3300005456 Bacteria 8411
34 Ga0070678_100011722 3300005456 Bacteria 5420
35 Ga0070678_100077111 3300005456 Bacteria 2513
36 Ga0070662_100221655 3300005457 Bacteria 1509
37 Ga0070681_10000920 3300005458 Bacteria 24878
38 Ga0070681_10004353 3300005458 Bacteria 13464
39 Ga0068867_100002376 3300005459 Bacteria 13232
40 Ga0070685_10125511 3300005466 Bacteria 1598
41 Ga0070706_100001319 3300005467 Bacteria 26385
42 Ga0070706_100070657 3300005467 Bacteria 3229
43 Ga0070706_100110446 3300005467 Bacteria 2559
44 Ga0070707_100000005 3300005468 Bacteria 205406
45 Ga0070707_100010363 3300005468 Bacteria 8680
46 Ga0070698_100277939 3300005471 Bacteria 1606
47 Ga0070699_100284577 3300005518 Bacteria 1481
48 Ga0070672_100016868 3300005543 Bacteria 5239
49 Ga0070672_100047968 3300005543 Bacteria 3316
50 Ga0070672_100057258 3300005543 Bacteria 3059
51 Ga0070686_100001392 3300005544 Bacteria 13658
52 Ga0070686_100079125 3300005544 Bacteria 2172
53 Ga0070695_100029140 3300005545 Bacteria 3428
54 Ga0070693_100063815 3300005547 Bacteria 2148
55 Ga0070693_100065291 3300005547 Bacteria 2127
56 Ga0070693_100188437 3300005547 Bacteria 1333
57 Ga0070665_100054808 3300005548 Bacteria 3998
58 Ga0070704_100038659 3300005549 Bacteria 3271
59 Ga0070704_100048973 3300005549 Bacteria 2961
60 Ga0070704_100056022 3300005549 Bacteria 2798
61 Ga0068855_100040426 3300005563 Bacteria 5535
62 Ga0070702_100005468 3300005615 Bacteria 5921
63 Ga0068859_100033166 3300005617 Bacteria 5186
64 Ga0068866_10001099 3300005718 Bacteria 11895
65 Ga0068866_10004776 3300005718 Bacteria 5561
66 Ga0068861_100003513 3300005719 Bacteria 10416
67 Ga0068861_100047830 3300005719 Bacteria 3231
68 Ga0068870_10134251 3300005840 Bacteria 1441
69 Ga0068858_100013381 3300005842 Bacteria 7742
70 Ga0068858_100031645 3300005842 Bacteria 4915
71 Ga0068858_100105639 3300005842 Bacteria 2628
72 Ga0068860_100075072 3300005843 Bacteria 3216
73 Ga0068860_100105545 3300005843 Bacteria 2690
74 Ga0068862_100077653 3300005844 Bacteria 2876
75 Ga0081540_1061451 3300005983 Bacteria 1790
76 Ga0070716_100112623 3300006173 Bacteria 1689
77 Ga0075367_10059880 3300006178 Bacteria 2268
78 Ga0097621_100007697 3300006237 Bacteria 7722
79 Ga0097621_100137521 3300006237 Bacteria 2085
80 Ga0097621_100292585 3300006237 Bacteria 1436
81 Ga0097621_100301209 3300006237 Bacteria 1416
82 Ga0068871_100003748 3300006358 Bacteria 10466
83 Ga0068871_100029930 3300006358 Bacteria 4282
84 Ga0068871_100603922 3300006358 Bacteria 998
85 Ga0075433_10273729 3300006852 Bacteria 1496
86 Ga0075433_10654986 3300006852 Bacteria 921
87 Ga0068865_100001597 3300006881 Bacteria 13268
88 Ga0068865_100028444 3300006881 Bacteria 3701
89 Ga0068865_100292350 3300006881 Bacteria 1301
90 Ga0097620_100033165 3300006931 Bacteria 5186
91 Ga0111539_10016463 3300009094 Bacteria 9168
92 Ga0105245_10012232 3300009098 Bacteria 7466
93 Ga0105247_10132606 3300009101 Bacteria 1625
94 Ga0114129_10246411 3300009147 Bacteria 2400
95 Ga0114129_10405500 3300009147 Bacteria 1796
96 Ga0114129_10603524 3300009147 Bacteria 1422
97 Ga0105243_10003069 3300009148 Bacteria 13755
98 Ga0105243_10177047 3300009148 Bacteria 1852
99 Ga0105242_10008714 3300009176 Bacteria 7782
100 Ga0105242_10208206 3300009176 Unclassified 1741
101 Ga0105242_10344938 3300009176 Bacteria 1373
102 Ga0105237_10092759 3300009545 Bacteria 3009
103 Ga0105238_10048867 3300009551 Bacteria 4262
104 Ga0105249_10079605 3300009553 Bacteria 3042
105 Ga0105249_10141238 3300009553 Bacteria 2310
106 Ga0105249_10357453 3300009553 Bacteria 1481
107 Ga0105239_10189036 3300010375 Bacteria 2305
108 Ga0157370_10055706 3300013104 Bacteria 3765
109 Ga0157378_10009224 3300013297 Bacteria 8593
110 Ga0157378_10081187 3300013297 Bacteria 2930
111 Ga0157378_10121575 3300013297 Bacteria 2407
112 Ga0157378_10261584 3300013297 Unclassified 1660
113 Ga0157372_10011401 3300013307 Bacteria 9455
114 Ga0157372_10675315 3300013307 Bacteria 1202
115 Ga0157375_10096237 3300013308 Bacteria 3033
116 Ga0157375_10161824 3300013308 Bacteria 2380
117 Ga0163163_10036834 3300014325 Bacteria 4754
118 Ga0163163_10125652 3300014325 Bacteria 2603
119 Ga0157380_10001123 3300014326 Bacteria 17254
120 Ga0157380_10091416 3300014326 Bacteria 2512
121 Ga0157379_10085497 3300014968 Bacteria 2827
122 Ga0157379_10114756 3300014968 Bacteria 2421
123 Ga0157376_10037034 3300014969 Bacteria 3956
124 Ga0157376_10037407 3300014969 Bacteria 3940
125 Ga0157376_10218419 3300014969 Bacteria 1764
126 Ga0213872_10003418 3300021361 Bacteria 8825
127 Ga0213872_10018393 3300021361 Bacteria 3224
128 Ga0213876_10051374 3300021384 Bacteria 2179
129 Ga0213876_10086025 3300021384 Bacteria 1663
130 Ga0213875_10000007 3300021388 Bacteria 562717
131 Ga0207642_10001084 3300025899 Bacteria 8434
132 Ga0207642_10004111 3300025899 Bacteria 4665
133 Ga0207680_10040651 3300025903 Bacteria 2708
134 Ga0207645_10002638 3300025907 Bacteria 13981
135 Ga0207643_10046341 3300025908 Bacteria 2457
136 Ga0207684_10072818 3300025910 Bacteria 2918
137 Ga0207684_10272103 3300025910 Bacteria 1461
138 Ga0207671_10060030 3300025914 Bacteria 2821
139 Ga0207663_10281781 3300025916 Bacteria 1235
140 Ga0207660_10028277 3300025917 Bacteria 3834
141 Ga0207660_10049582 3300025917 Bacteria 2978
142 Ga0207662_10119229 3300025918 Bacteria 1653
143 Ga0207652_10075830 3300025921 Bacteria 2931
144 Ga0207646_10039717 3300025922 Bacteria 4234
145 Ga0207646_10088930 3300025922 Bacteria 2764
146 Ga0207681_10019393 3300025923 Bacteria 4296
147 Ga0207687_10001556 3300025927 Bacteria 15756
148 Ga0207706_10051900 3300025933 Bacteria 3620
149 Ga0207686_10002350 3300025934 Bacteria 10343
150 Ga0207709_10001934 3300025935 Bacteria 13610
151 Ga0207709_10054068 3300025935 Bacteria 2474
152 Ga0207670_10001879 3300025936 Bacteria 10970
153 Ga0207670_10005278 3300025936 Bacteria 7074
154 Ga0207670_10123305 3300025936 Bacteria 1887
155 Ga0207669_10006617 3300025937 Bacteria 5312
156 Ga0207669_10064535 3300025937 Bacteria 2266
157 Ga0207704_10000707 3300025938 Bacteria 14717
158 Ga0207704_10021003 3300025938 Bacteria 3468
159 Ga0207704_10136211 3300025938 Bacteria 1710
160 Ga0207665_10174095 3300025939 Bacteria 1556
161 Ga0207691_10007350 3300025940 Bacteria 10621
162 Ga0207691_10041660 3300025940 Bacteria 4238
163 Ga0207691_10057608 3300025940 Bacteria 3535
164 Ga0207689_10015309 3300025942 Bacteria 6493
165 Ga0207689_10209675 3300025942 Bacteria 1609
166 Ga0207667_10152292 3300025949 Bacteria 2380
167 Ga0207651_10002047 3300025960 Bacteria 9487
168 Ga0207668_10058905 3300025972 Bacteria 2687
169 Ga0207658_10078473 3300025986 Bacteria 2523
170 Ga0207658_10177075 3300025986 Bacteria 1762
171 Ga0207677_10172933 3300026023 Bacteria 1691
172 Ga0207703_10005185 3300026035 Bacteria 10529
173 Ga0207703_10349662 3300026035 Bacteria 1360
174 Ga0207708_10000049 3300026075 Bacteria 114743
175 Ga0207708_10000769 3300026075 Bacteria 24152
176 Ga0207708_10067428 3300026075 Bacteria 2737
177 Ga0207648_10002919 3300026089 Bacteria 18093
178 Ga0207648_10103668 3300026089 Bacteria 2494
179 Ga0207675_100001747 3300026118 Bacteria 21721
180 Ga0207675_100008777 3300026118 Bacteria 9490
181 Ga0207675_100062020 3300026118 Bacteria 3491
182 Ga0207683_10005487 3300026121 Bacteria 10865
183 Ga0207683_10013686 3300026121 Bacteria 6917
184 Ga0209969_1000168 3300027360 Bacteria 8700
185 Ga0209967_1001670 3300027364 Bacteria 2856
186 Ga0209981_1005592 3300027378 Bacteria 1670
187 Ga0209984_1007886 3300027424 Bacteria 1330
188 Ga0210000_1001128 3300027462 Bacteria 3742
189 Ga0209995_1001879 3300027471 Bacteria 3281
190 Ga0209999_1000745 3300027543 Bacteria 5311
191 Ga0209983_1001265 3300027665 Bacteria 5619
192 Ga0209974_10015579 3300027876 Bacteria 2524
193 Ga0268265_10009548 3300028380 Bacteria 6552
194 Ga0268264_10110492 3300028381 Bacteria 2407
195 Ga0265338_10025335 3300028800 Bacteria 6024
196 Ga0265325_10102908 3300031241 Bacteria 1396
197 Ga0265340_10038780 3300031247 Bacteria 2355
198 Ga0265339_10014477 3300031249 Bacteria 4752
199 Ga0265331_10000732 3300031250 Bacteria 27697
200 Ga0265331_10102935 3300031250 Bacteria 1313
201 Ga0265316_10131439 3300031344 Bacteria 1885
202 Ga0265313_10000838 3300031595 Bacteria 30978
203 Ga0265342_10023580 3300031712 Bacteria 3893
204 Ga0307405_10119592 3300031731 Bacteria 1800
205 Ga0307412_10017462 3300031911 Bacteria 4295
206 Ga0307409_100054059 3300031995 Bacteria 3090
207 Ga0307411_10092473 3300032005 Bacteria 2115
208 Ga0307415_100081893 3300032126 Bacteria 2307
209 Ga0373934_0112104 3300035086 Unclassified 1107
210 Ga0373936_0119140 3300035113 Bacteria 1126
211 Ga0373954_0088770 3300035118 Unclassified 1483
212 Ga0373943_0023107 3300035170 Bacteria 2888
213 Ga0373943_0138772 3300035170 Bacteria 1308
214 Ga0373946_0080361 3300035171 Bacteria 1426
215 Ga0373955_0048817 3300035172 Bacteria 2297
216 Ga0373955_0186204 3300035172 Bacteria 1233
217 Ga0373931_0086874 3300035691 Bacteria 1736
218 Ga0373935_0032097 3300035692 Bacteria 3263
219 Ga0373935_0253109 3300035692 Bacteria 1233
220 Ga0373927_0061290 3300035695 Unclassified 2434
221 Ga0373933_0024719 3300035724 Bacteria 3439
222 Ga0373947_0022000 3300035725 Bacteria 3695
223 Ga0373937_0024427 3300036401 Bacteria 5451
224 Ga0373937_0034226 3300036401 Bacteria 4621
225 Ga0373937_0174744 3300036401 Unclassified 2016
226 Ga0373925_0602049 3300037068 Bacteria 905
227 Ga0395899_0000866 3300037312 Bacteria 28838
228 Ga0395900_0045506 3300037418 Bacteria 4520
229 Ga0395905_0008795 3300037471 Bacteria 9924
230 Ga0436364_0309649 3300037853 Bacteria 36034
231 Ga0436364_1198826 3300037853 Bacteria 4821
232 Ga0395901_0211419 3300038443 Bacteria 2030
233 Ga0395901_0585333 3300038443 Bacteria 1127
234 Ga0436365_0432371 3300039437 Bacteria 4532
235 Ga0436365_1426553 3300039437 Bacteria 2348
236 Ga0436361_0302148 3300039447 Bacteria 5235
237 Ga0436361_0610767 3300039447 Bacteria 5199
238 Ga0436361_1000865 3300039447 Bacteria 21851
239 Ga0436361_1140646 3300039447 Bacteria 3581
240 Ga0436363_1655597 3300039450 Bacteria 867
241 Ga0436362_0431487 3300039453 Bacteria 2129
242 Ga0436362_0588139 3300039453 Bacteria 10541
243 Ga0436362_0690457 3300039453 Bacteria 991
244 Ga0451577_0017078 3300042876 Bacteria 6712
245 Ga0451577_0047055 3300042876 Bacteria 3857
246 Ga0466966_0096653 3300044684 Bacteria 1829
247 Ga0453684_0005486 3300044712 Bacteria 25079
248 Ga0466970_0181479 3300044765 Unclassified 1168
249 Ga0466957_0003906 3300044842 Bacteria 8241
250 Ga0451576_0289897 3300045051 Bacteria 1711
251 Ga0495592_0174381 3300046454 Bacteria 1470
252 Ga0495629_0152558 3300046459 Bacteria 1606
253 Ga0495651_0142101 3300046462 Bacteria 1739
254 Ga0495580_0075210 3300046472 Bacteria 2357
255 Ga0495664_0043800 3300046477 Bacteria 2652
256 Ga0495594_0017887 3300046499 Bacteria 3750
257 Ga0495628_0526611 3300046516 Unclassified 851
258 Ga0495630_0016678 3300046517 Bacteria 5371
259 Ga0495586_0010827 3300046535 Bacteria 4849
260 Ga0495635_0156739 3300046663 Bacteria 1550
261 Ga0495669_0004822 3300046684 Bacteria 5597
262 Ga0495581_0164346 3300047315 Unclassified 1298
263 Ga0495674_0001423 3300047319 Bacteria 23423
264 Ga0495677_0074949 3300047445 Unclassified 1264
265 Ga0496108_0655026 3300048911 Bacteria 913
266 Ga0496114_0587755 3300048917 Bacteria 982
267 Ga0501291_000696 3300049514 Bacteria 3848
268 Ga0501292_000630 3300049515 Bacteria 4296
269 Ga0501293_000782 3300049516 Bacteria 2386
270 Ga0501295_004944 3300049518 Bacteria 1773
271 Ga0501297_000317 3300049520 Bacteria 4644
272 Ga0501298_007528 3300049521 Bacteria 1806
273 Ga0501299_002827 3300049522 Bacteria 2449
274 Ga0501300_000638 3300049523 Bacteria 5263
275 Ga0501301_000727 3300049524 Bacteria 2026
276 Ga0501038_0418144 3300049574 Bacteria 1035
277 Ga0501039_0023052 3300049575 Bacteria 4776
278 Ga0501043_0038587 3300049579 Bacteria 3755
279 Ga0501046_0010688 3300049580 Bacteria 7871
280 Ga0501047_0007378 3300049581 Bacteria 10342
281 Ga0501047_0155706 3300049581 Bacteria 2159
282 Ga0501048_0100341 3300049582 Bacteria 2042
283 Ga0501067_0005400 3300049583 Bacteria 7097
284 Ga0501069_0037331 3300049585 Bacteria 2681
285 Ga0501070_0000366 3300049586 Bacteria 41203
286 Ga0501073_0007234 3300049589 Bacteria 8265
287 Ga0501076_0261427 3300049592 Bacteria 1417
288 Ga0501198_001035 3300049649 Bacteria 3546
289 Ga0501206_001611 3300049653 Bacteria 2820
290 Ga0501207_004002 3300049654 Bacteria 1991
291 Ga0501217_009310 3300049661 Bacteria 2134
292 Ga0501227_030960 3300049665 Bacteria 1284
293 Ga0501230_002241 3300049667 Bacteria 2446
294 Ga0501233_000543 3300049668 Bacteria 6093
295 Ga0501235_001973 3300049669 Bacteria 4394
296 Ga0501236_001295 3300049670 Bacteria 2833
297 Ga0501259_008135 3300049688 Bacteria 1686
298 Ga0501221_004837 3300049704 Bacteria 2239
299 Ga0501225_0015466 3300049705 Bacteria 2123
300 Ga0501229_001097 3300049706 Bacteria 3122
301 Ga0501234_003449 3300049707 Bacteria 2485
302 Ga0501079_0051978 3300049741 Bacteria 3164
303 Ga0501079_0277977 3300049741 Bacteria 1309
304 Ga0501080_0325244 3300049742 Bacteria 1391
305 Ga0501081_0023053 3300049743 Bacteria 4170
306 Ga0501081_0034583 3300049743 Bacteria 3439
307 Ga0501262_005639 3300049759 Bacteria 1482
308 Ga0501268_008900 3300049765 Bacteria 1532
309 Ga0501271_000454 3300049768 Bacteria 3558
310 Ga0501279_000661 3300049775 Bacteria 4545
311 Ga0501204_001866 3300049850 Bacteria 2119
312 Ga0501226_006869 3300049853 Bacteria 1281
313 nmdc:mga03n38_303_c1 3300050490 Bacteria 11863
314 nmdc:mga06z11_1406_c1 3300050494 Bacteria 8943
315 nmdc:mga06z11_19975_c1 3300050494 Bacteria 3090
316 nmdc:mga05p37_591881_c1 3300050507 Bacteria 1254
317 nmdc:mga08y16_587603_c1 3300050511 Bacteria 1123
318 nmdc:mga0n895_274047_c1 3300050512 Bacteria 1711
319 nmdc:mga0a205_329941_c1 3300050515 Bacteria 1008
320 Ga0495601_0096596 3300053077 Bacteria 1906
321 Ga0495619_0014582 3300053085 Bacteria 4965
322 Ga0501082_0506670 3300060353 Bacteria 1055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0655026 Ga0496108_0655026_76_825 241
2 3300014325 Ga0163163_10036834 Ga0163163_100368344 249
3 3300035691 Ga0373931_0086874 Ga0373931_0086874_519_1268 249
4 3300039450 Ga0436363_1655597 Ga0436363_1655597_28_792 253
5 3300049574 Ga0501038_0418144 Ga0501038_0418144_234_1013 253
6 3300014326 Ga0157380_10091416 Ga0157380_100914163 254
7 3300049653 Ga0501206_001611 Ga0501206_001611_1169_1990 256
8 3300049665 Ga0501227_030960 Ga0501227_030960_10_831 256
9 3300049706 Ga0501229_001097 Ga0501229_001097_1234_2055 256
10 3300049765 Ga0501268_008900 Ga0501268_008900_77_898 256
11 3300049850 Ga0501204_001866 Ga0501204_001866_40_861 256
12 3300049853 Ga0501226_006869 Ga0501226_006869_44_865 256
13 3300050490 nmdc:mga03n38_303_c1 nmdc:mga03n38_303_c1_217_990 256
14 3300050494 nmdc:mga06z11_1406_c1 nmdc:mga06z11_1406_c1_2174_2947 256
15 3300031911 Ga0307412_10017462 Ga0307412_100174625 257
16 3300046516 Ga0495628_0526611 Ga0495628_0526611_65_841 258
17 3300035172 Ga0373955_0186204 Ga0373955_0186204_26_904 259
18 3300035692 Ga0373935_0032097 Ga0373935_0032097_1246_2124 259
19 3300035724 Ga0373933_0024719 Ga0373933_0024719_1881_2759 259
20 3300036401 Ga0373937_0024427 Ga0373937_0024427_3778_4656 259
21 3300046454 Ga0495592_0174381 Ga0495592_0174381_37_915 259
22 3300046462 Ga0495651_0142101 Ga0495651_0142101_588_1466 259
23 3300049522 Ga0501299_002827 Ga0501299_002827_252_1193 260
24 3300006178 Ga0075367_10059880 Ga0075367_100598802 261
25 3300050494 nmdc:mga06z11_19975_c1 nmdc:mga06z11_19975_c1_1150_2085 261
26 3300005547 Ga0070693_100188437 Ga0070693_1001884371 264
27 3300005563 Ga0068855_100040426 Ga0068855_1000404263 264
28 3300025949 Ga0207667_10152292 Ga0207667_101522923 264
29 3300049585 Ga0501069_0037331 Ga0501069_0037331_225_1112 264
30 3300049742 Ga0501080_0325244 Ga0501080_0325244_177_1064 264
31 3300031731 Ga0307405_10119592 Ga0307405_101195921 265
32 3300031995 Ga0307409_100054059 Ga0307409_1000540594 265
33 3300032005 Ga0307411_10092473 Ga0307411_100924731 265
34 3300032126 Ga0307415_100081893 Ga0307415_1000818931 265
35 3300037312 Ga0395899_0000866 Ga0395899_0000866_27629_28429 265
36 3300037418 Ga0395900_0045506 Ga0395900_0045506_436_1236 265
37 3300037471 Ga0395905_0008795 Ga0395905_0008795_9016_9816 265
38 3300038443 Ga0395901_0585333 Ga0395901_0585333_105_905 265
39 3300044684 Ga0466966_0096653 Ga0466966_0096653_397_1197 265
40 3300049514 Ga0501291_000696 Ga0501291_000696_626_1501 265
41 3300049515 Ga0501292_000630 Ga0501292_000630_2078_2953 265
42 3300049516 Ga0501293_000782 Ga0501293_000782_35_910 265
43 3300049518 Ga0501295_004944 Ga0501295_004944_761_1636 265
44 3300049520 Ga0501297_000317 Ga0501297_000317_1472_2347 265
45 3300049521 Ga0501298_007528 Ga0501298_007528_266_1141 265
46 3300049523 Ga0501300_000638 Ga0501300_000638_1032_1907 265
47 3300049524 Ga0501301_000727 Ga0501301_000727_1019_1894 265
48 3300049649 Ga0501198_001035 Ga0501198_001035_1444_2319 265
49 3300049654 Ga0501207_004002 Ga0501207_004002_960_1835 265
50 3300049661 Ga0501217_009310 Ga0501217_009310_965_1840 265
51 3300049667 Ga0501230_002241 Ga0501230_002241_759_1634 265
52 3300049668 Ga0501233_000543 Ga0501233_000543_4549_5424 265
53 3300049669 Ga0501235_001973 Ga0501235_001973_2046_2921 265
54 3300049670 Ga0501236_001295 Ga0501236_001295_1124_1999 265
55 3300049688 Ga0501259_008135 Ga0501259_008135_697_1572 265
56 3300049704 Ga0501221_004837 Ga0501221_004837_91_966 265
57 3300049705 Ga0501225_0015466 Ga0501225_0015466_23_898 265
58 3300049707 Ga0501234_003449 Ga0501234_003449_174_1049 265
59 3300049759 Ga0501262_005639 Ga0501262_005639_550_1425 265
60 3300049768 Ga0501271_000454 Ga0501271_000454_1486_2361 265
61 3300049775 Ga0501279_000661 Ga0501279_000661_2948_3823 265
62 3300005331 Ga0070670_100257696 Ga0070670_1002576961 267
63 3300049741 Ga0501079_0051978 Ga0501079_0051978_146_973 270
64 3300049743 Ga0501081_0034583 Ga0501081_0034583_1133_1960 270
65 3300009147 Ga0114129_10405500 Ga0114129_104055002 271
66 3300031344 Ga0265316_10131439 Ga0265316_101314392 271
67 3300050507 nmdc:mga05p37_591881_c1 nmdc:mga05p37_591881_c1_399_1244 271
68 iso_pu_bacteria 2617270889 2617916583 271
69 3300006881 Ga0068865_100292350 Ga0068865_1002923502 272
70 3300025938 Ga0207704_10136211 Ga0207704_101362112 272
71 3300005441 Ga0070700_100041961 Ga0070700_1000419613 273
72 3300005617 Ga0068859_100033166 Ga0068859_1000331666 273
73 3300005842 Ga0068858_100105639 Ga0068858_1001056392 273
74 3300006931 Ga0097620_100033165 Ga0097620_1000331652 273
75 3300009147 Ga0114129_10246411 Ga0114129_102464111 273
76 3300026035 Ga0207703_10349662 Ga0207703_103496622 273
77 3300026075 Ga0207708_10067428 Ga0207708_100674282 273
78 3300026118 Ga0207675_100062020 Ga0207675_1000620205 273
79 iso_pu_bacteria 2913939268 2913940134 273
80 3300009545 Ga0105237_10092759 Ga0105237_100927593 274
81 3300010375 Ga0105239_10189036 Ga0105239_101890363 274
82 3300025914 Ga0207671_10060030 Ga0207671_100600303 274
83 3300037068 Ga0373925_0602049 Ga0373925_0602049_23_847 274
84 3300048917 Ga0496114_0587755 Ga0496114_0587755_103_927 274
85 3300006173 Ga0070716_100112623 Ga0070716_1001126232 275
86 3300014969 Ga0157376_10037407 Ga0157376_100374072 275
87 3300025939 Ga0207665_10174095 Ga0207665_101740952 275
88 3300028800 Ga0265338_10025335 Ga0265338_100253354 275
89 3300031241 Ga0265325_10102908 Ga0265325_101029082 275
90 3300042876 Ga0451577_0017078 Ga0451577_0017078_80_940 275
91 3300021361 Ga0213872_10018393 Ga0213872_100183932 276
92 3300025942 Ga0207689_10209675 Ga0207689_102096752 276
93 3300039447 Ga0436361_0302148 Ga0436361_0302148_2294_3139 276
94 3300039447 Ga0436361_0610767 Ga0436361_0610767_2241_3086 276
95 3300009176 Ga0105242_10344938 Ga0105242_103449382 277
96 3300021361 Ga0213872_10003418 Ga0213872_100034184 277
97 3300039447 Ga0436361_1000865 Ga0436361_1000865_4604_5446 277
98 3300046684 Ga0495669_0004822 Ga0495669_0004822_4303_5187 277
99 3300047445 Ga0495677_0074949 Ga0495677_0074949_318_1202 277
100 3300021384 Ga0213876_10051374 Ga0213876_100513742 278
101 3300021388 Ga0213875_10000007 Ga0213875_10000007159 278
102 3300037853 Ga0436364_0309649 Ga0436364_0309649_16181_17050 278
103 3300037853 Ga0436364_1198826 Ga0436364_1198826_1905_2798 278
104 3300039437 Ga0436365_1426553 Ga0436365_1426553_132_1043 278
105 3300044842 Ga0466957_0003906 Ga0466957_0003906_846_1700 279
106 3300005329 Ga0070683_100003517 Ga0070683_10000351711 280
107 3300005330 Ga0070690_100043379 Ga0070690_1000433791 280
108 3300005340 Ga0070689_100007585 Ga0070689_1000075855 280
109 3300005340 Ga0070689_100020039 Ga0070689_1000200393 280
110 3300005347 Ga0070668_100021832 Ga0070668_1000218323 280
111 3300005353 Ga0070669_100002717 Ga0070669_1000027178 280
112 3300005356 Ga0070674_100007030 Ga0070674_1000070304 280
113 3300005364 Ga0070673_100003506 Ga0070673_1000035063 280
114 3300005365 Ga0070688_100021789 Ga0070688_1000217892 280
115 3300005365 Ga0070688_100025488 Ga0070688_1000254883 280
116 3300005441 Ga0070700_100000870 Ga0070700_1000008709 280
117 3300005456 Ga0070678_100077111 Ga0070678_1000771112 280
118 3300005457 Ga0070662_100221655 Ga0070662_1002216552 280
119 3300005543 Ga0070672_100016868 Ga0070672_1000168682 280
120 3300005543 Ga0070672_100057258 Ga0070672_1000572582 280
121 3300005718 Ga0068866_10004776 Ga0068866_100047762 280
122 3300005719 Ga0068861_100047830 Ga0068861_1000478302 280
123 3300006881 Ga0068865_100028444 Ga0068865_1000284443 280
124 3300009148 Ga0105243_10177047 Ga0105243_101770472 280
125 3300013297 Ga0157378_10121575 Ga0157378_101215752 280
126 3300014325 Ga0163163_10125652 Ga0163163_101256522 280
127 3300021384 Ga0213876_10086025 Ga0213876_100860251 280
128 3300025899 Ga0207642_10004111 Ga0207642_100041113 280
129 3300025907 Ga0207645_10002638 Ga0207645_1000263810 280
130 3300025923 Ga0207681_10019393 Ga0207681_100193933 280
131 3300025933 Ga0207706_10051900 Ga0207706_100519003 280
132 3300025935 Ga0207709_10054068 Ga0207709_100540682 280
133 3300025936 Ga0207670_10005278 Ga0207670_100052786 280
134 3300025936 Ga0207670_10123305 Ga0207670_101233052 280
135 3300025937 Ga0207669_10064535 Ga0207669_100645352 280
136 3300025938 Ga0207704_10021003 Ga0207704_100210031 280
137 3300025940 Ga0207691_10007350 Ga0207691_100073503 280
138 3300025940 Ga0207691_10057608 Ga0207691_100576082 280
139 3300025960 Ga0207651_10002047 Ga0207651_100020474 280
140 3300025972 Ga0207668_10058905 Ga0207668_100589053 280
141 3300026075 Ga0207708_10000769 Ga0207708_1000076918 280
142 3300026118 Ga0207675_100008777 Ga0207675_1000087773 280
143 3300039437 Ga0436365_0432371 Ga0436365_0432371_1427_2338 280
144 3300005330 Ga0070690_100004455 Ga0070690_1000044552 281
145 3300005334 Ga0068869_100007742 Ga0068869_1000077426 281
146 3300005335 Ga0070666_10035694 Ga0070666_100356943 281
147 3300005336 Ga0070680_100067488 Ga0070680_1000674883 281
148 3300005340 Ga0070689_100003155 Ga0070689_1000031556 281
149 3300005345 Ga0070692_10058972 Ga0070692_100589722 281
150 3300005356 Ga0070674_100055973 Ga0070674_1000559732 281
151 3300005367 Ga0070667_100027269 Ga0070667_1000272693 281
152 3300005367 Ga0070667_100172304 Ga0070667_1001723042 281
153 3300005438 Ga0070701_10026886 Ga0070701_100268861 281
154 3300005441 Ga0070700_100004897 Ga0070700_1000048972 281
155 3300005444 Ga0070694_100166560 Ga0070694_1001665602 281
156 3300005456 Ga0070678_100003866 Ga0070678_1000038664 281
157 3300005456 Ga0070678_100011722 Ga0070678_1000117224 281
158 3300005458 Ga0070681_10004353 Ga0070681_1000435312 281
159 3300005459 Ga0068867_100002376 Ga0068867_1000023766 281
160 3300005466 Ga0070685_10125511 Ga0070685_101255112 281
161 3300005543 Ga0070672_100047968 Ga0070672_1000479683 281
162 3300005544 Ga0070686_100001392 Ga0070686_1000013926 281
163 3300005545 Ga0070695_100029140 Ga0070695_1000291404 281
164 3300005547 Ga0070693_100065291 Ga0070693_1000652914 281
165 3300005548 Ga0070665_100054808 Ga0070665_1000548083 281
166 3300005615 Ga0070702_100005468 Ga0070702_1000054685 281
167 3300005718 Ga0068866_10001099 Ga0068866_100010997 281
168 3300005719 Ga0068861_100003513 Ga0068861_1000035136 281
169 3300005840 Ga0068870_10134251 Ga0068870_101342512 281
170 3300005842 Ga0068858_100013381 Ga0068858_1000133816 281
171 3300005842 Ga0068858_100031645 Ga0068858_1000316453 281
172 3300005843 Ga0068860_100105545 Ga0068860_1001055453 281
173 3300005844 Ga0068862_100077653 Ga0068862_1000776532 281
174 3300006237 Ga0097621_100007697 Ga0097621_1000076974 281
175 3300006237 Ga0097621_100301209 Ga0097621_1003012092 281
176 3300006358 Ga0068871_100003748 Ga0068871_1000037485 281
177 3300006852 Ga0075433_10654986 Ga0075433_106549861 281
178 3300006881 Ga0068865_100001597 Ga0068865_1000015977 281
179 3300009098 Ga0105245_10012232 Ga0105245_100122326 281
180 3300009101 Ga0105247_10132606 Ga0105247_101326063 281
181 3300009147 Ga0114129_10603524 Ga0114129_106035242 281
182 3300009148 Ga0105243_10003069 Ga0105243_100030696 281
183 3300009176 Ga0105242_10008714 Ga0105242_100087146 281
184 3300009176 Ga0105242_10208206 Ga0105242_102082062 281
185 3300009553 Ga0105249_10141238 Ga0105249_101412382 281
186 3300013104 Ga0157370_10055706 Ga0157370_100557062 281
187 3300013297 Ga0157378_10009224 Ga0157378_100092244 281
188 3300013297 Ga0157378_10261584 Ga0157378_102615841 281
189 3300013308 Ga0157375_10161824 Ga0157375_101618242 281
190 3300014326 Ga0157380_10001123 Ga0157380_1000112311 281
191 3300014968 Ga0157379_10085497 Ga0157379_100854973 281
192 3300014969 Ga0157376_10037034 Ga0157376_100370342 281
193 3300025899 Ga0207642_10001084 Ga0207642_100010842 281
194 3300025903 Ga0207680_10040651 Ga0207680_100406512 281
195 3300025908 Ga0207643_10046341 Ga0207643_100463412 281
196 3300025917 Ga0207660_10028277 Ga0207660_100282772 281
197 3300025917 Ga0207660_10049582 Ga0207660_100495822 281
198 3300025927 Ga0207687_10001556 Ga0207687_1000155612 281
199 3300025934 Ga0207686_10002350 Ga0207686_100023505 281
200 3300025935 Ga0207709_10001934 Ga0207709_1000193413 281
201 3300025936 Ga0207670_10001879 Ga0207670_100018797 281
202 3300025937 Ga0207669_10006617 Ga0207669_100066173 281
203 3300025938 Ga0207704_10000707 Ga0207704_100007079 281
204 3300025940 Ga0207691_10041660 Ga0207691_100416604 281
205 3300025942 Ga0207689_10015309 Ga0207689_100153096 281
206 3300025986 Ga0207658_10078473 Ga0207658_100784732 281
207 3300025986 Ga0207658_10177075 Ga0207658_101770752 281
208 3300026023 Ga0207677_10172933 Ga0207677_101729332 281
209 3300026035 Ga0207703_10005185 Ga0207703_100051857 281
210 3300026075 Ga0207708_10000049 Ga0207708_10000049109 281
211 3300026089 Ga0207648_10002919 Ga0207648_100029196 281
212 3300026089 Ga0207648_10103668 Ga0207648_101036683 281
213 3300026118 Ga0207675_100001747 Ga0207675_10000174715 281
214 3300026121 Ga0207683_10005487 Ga0207683_1000548710 281
215 3300026121 Ga0207683_10013686 Ga0207683_100136863 281
216 3300028380 Ga0268265_10009548 Ga0268265_100095483 281
217 3300035113 Ga0373936_0119140 Ga0373936_0119140_241_1116 281
218 3300035170 Ga0373943_0023107 Ga0373943_0023107_810_1673 281
219 3300035171 Ga0373946_0080361 Ga0373946_0080361_119_994 281
220 3300035172 Ga0373955_0048817 Ga0373955_0048817_1254_2105 281
221 3300035725 Ga0373947_0022000 Ga0373947_0022000_1476_2339 281
222 3300039447 Ga0436361_1140646 Ga0436361_1140646_993_1886 281
223 3300039453 Ga0436362_0690457 Ga0436362_0690457_75_929 281
224 3300044765 Ga0466970_0181479 Ga0466970_0181479_183_1085 281
225 3300046477 Ga0495664_0043800 Ga0495664_0043800_887_1762 281
226 3300046517 Ga0495630_0016678 Ga0495630_0016678_3429_4304 281
227 3300046535 Ga0495586_0010827 Ga0495586_0010827_2007_2882 281
228 3300047319 Ga0495674_0001423 Ga0495674_0001423_21133_22008 281
229 3300049581 Ga0501047_0155706 Ga0501047_0155706_73_948 281
230 3300049583 Ga0501067_0005400 Ga0501067_0005400_591_1457 281
231 3300049589 Ga0501073_0007234 Ga0501073_0007234_411_1277 281
232 3300050511 nmdc:mga08y16_587603_c1 nmdc:mga08y16_587603_c1_49_918 281
233 3300050515 nmdc:mga0a205_329941_c1 nmdc:mga0a205_329941_c1_105_974 281
234 3300053077 Ga0495601_0096596 Ga0495601_0096596_223_1098 281
235 3300005439 Ga0070711_100214718 Ga0070711_1002147181 282
236 3300005458 Ga0070681_10000920 Ga0070681_1000092012 282
237 3300005467 Ga0070706_100070657 Ga0070706_1000706573 282
238 3300005467 Ga0070706_100110446 Ga0070706_1001104462 282
239 3300005468 Ga0070707_100000005 Ga0070707_10000000579 282
240 3300005468 Ga0070707_100010363 Ga0070707_1000103634 282
241 3300005518 Ga0070699_100284577 Ga0070699_1002845771 282
242 3300005547 Ga0070693_100063815 Ga0070693_1000638152 282
243 3300005549 Ga0070704_100048973 Ga0070704_1000489733 282
244 3300005983 Ga0081540_1061451 Ga0081540_10614514 282
245 3300006237 Ga0097621_100137521 Ga0097621_1001375212 282
246 3300006237 Ga0097621_100292585 Ga0097621_1002925852 282
247 3300006358 Ga0068871_100029930 Ga0068871_1000299303 282
248 3300006358 Ga0068871_100603922 Ga0068871_1006039221 282
249 3300006852 Ga0075433_10273729 Ga0075433_102737293 282
250 3300009094 Ga0111539_10016463 Ga0111539_100164636 282
251 3300009551 Ga0105238_10048867 Ga0105238_100488673 282
252 3300013297 Ga0157378_10081187 Ga0157378_100811872 282
253 3300013307 Ga0157372_10011401 Ga0157372_100114013 282
254 3300013308 Ga0157375_10096237 Ga0157375_100962372 282
255 3300014968 Ga0157379_10114756 Ga0157379_101147563 282
256 3300014969 Ga0157376_10218419 Ga0157376_102184192 282
257 3300025910 Ga0207684_10072818 Ga0207684_100728182 282
258 3300025910 Ga0207684_10272103 Ga0207684_102721031 282
259 3300025916 Ga0207663_10281781 Ga0207663_102817811 282
260 3300025921 Ga0207652_10075830 Ga0207652_100758302 282
261 3300025922 Ga0207646_10039717 Ga0207646_100397173 282
262 3300035170 Ga0373943_0138772 Ga0373943_0138772_220_1089 282
263 3300035692 Ga0373935_0253109 Ga0373935_0253109_263_1135 282
264 3300035695 Ga0373927_0061290 Ga0373927_0061290_462_1379 282
265 3300036401 Ga0373937_0174744 Ga0373937_0174744_1076_1993 282
266 3300038443 Ga0395901_0211419 Ga0395901_0211419_156_1034 282
267 3300039453 Ga0436362_0431487 Ga0436362_0431487_1197_2051 282
268 3300046472 Ga0495580_0075210 Ga0495580_0075210_540_1409 282
269 3300050512 nmdc:mga0n895_274047_c1 nmdc:mga0n895_274047_c1_629_1498 282
270 3300004801 Ga0058860_10021805 Ga0058860_100218052 283
271 3300005366 Ga0070659_100355166 Ga0070659_1003551662 283
272 3300005435 Ga0070714_100028700 Ga0070714_1000287001 283
273 3300005445 Ga0070708_100375475 Ga0070708_1003754752 283
274 3300005467 Ga0070706_100001319 Ga0070706_10000131918 283
275 3300005471 Ga0070698_100277939 Ga0070698_1002779393 283
276 3300005544 Ga0070686_100079125 Ga0070686_1000791252 283
277 3300005549 Ga0070704_100038659 Ga0070704_1000386593 283
278 3300005549 Ga0070704_100056022 Ga0070704_1000560222 283
279 3300005843 Ga0068860_100075072 Ga0068860_1000750726 283
280 3300009553 Ga0105249_10079605 Ga0105249_100796052 283
281 3300009553 Ga0105249_10357453 Ga0105249_103574532 283
282 3300013307 Ga0157372_10675315 Ga0157372_106753151 283
283 3300025918 Ga0207662_10119229 Ga0207662_101192292 283
284 3300025922 Ga0207646_10088930 Ga0207646_100889302 283
285 3300027360 Ga0209969_1000168 Ga0209969_10001686 283
286 3300027364 Ga0209967_1001670 Ga0209967_10016704 283
287 3300027378 Ga0209981_1005592 Ga0209981_10055921 283
288 3300027424 Ga0209984_1007886 Ga0209984_10078862 283
289 3300027462 Ga0210000_1001128 Ga0210000_10011282 283
290 3300027471 Ga0209995_1001879 Ga0209995_10018793 283
291 3300027543 Ga0209999_1000745 Ga0209999_10007454 283
292 3300027665 Ga0209983_1001265 Ga0209983_10012655 283
293 3300027876 Ga0209974_10015579 Ga0209974_100155792 283
294 3300028381 Ga0268264_10110492 Ga0268264_101104922 283
295 3300031247 Ga0265340_10038780 Ga0265340_100387803 283
296 3300031249 Ga0265339_10014477 Ga0265339_100144774 283
297 3300031250 Ga0265331_10000732 Ga0265331_1000073227 283
298 3300031250 Ga0265331_10102935 Ga0265331_101029352 283
299 3300031595 Ga0265313_10000838 Ga0265313_100008387 283
300 3300031712 Ga0265342_10023580 Ga0265342_100235804 283
301 3300035086 Ga0373934_0112104 Ga0373934_0112104_180_1070 283
302 3300035118 Ga0373954_0088770 Ga0373954_0088770_150_1031 283
303 3300036401 Ga0373937_0034226 Ga0373937_0034226_1858_2739 283
304 3300039453 Ga0436362_0588139 Ga0436362_0588139_5343_6206 283
305 3300046459 Ga0495629_0152558 Ga0495629_0152558_626_1507 283
306 3300046499 Ga0495594_0017887 Ga0495594_0017887_2401_3282 283
307 3300046663 Ga0495635_0156739 Ga0495635_0156739_46_927 283
308 3300047315 Ga0495581_0164346 Ga0495581_0164346_248_1129 283
309 3300049575 Ga0501039_0023052 Ga0501039_0023052_1284_2156 283
310 3300049579 Ga0501043_0038587 Ga0501043_0038587_1718_2581 283
311 3300049580 Ga0501046_0010688 Ga0501046_0010688_6724_7587 283
312 3300049581 Ga0501047_0007378 Ga0501047_0007378_8578_9441 283
313 3300049582 Ga0501048_0100341 Ga0501048_0100341_32_895 283
314 3300049586 Ga0501070_0000366 Ga0501070_0000366_32874_33737 283
315 3300049592 Ga0501076_0261427 Ga0501076_0261427_90_962 283
316 3300049741 Ga0501079_0277977 Ga0501079_0277977_152_1024 283
317 3300049743 Ga0501081_0023053 Ga0501081_0023053_1710_2582 283
318 3300053085 Ga0495619_0014582 Ga0495619_0014582_3510_4391 283
319 3300060353 Ga0501082_0506670 Ga0501082_0506670_79_945 283
320 3300042876 Ga0451577_0047055 Ga0451577_0047055_746_1621 284
321 3300044712 Ga0453684_0005486 Ga0453684_0005486_20184_21059 284
322 3300045051 Ga0451576_0289897 Ga0451576_0289897_351_1226 284
323 3300003323 rootH1_10120503 rootH1_101205033 288
324 3300005337 Ga0070682_100056676 Ga0070682_1000566763 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

103

325

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9823 43 283
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9621 43 283
1zi8-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a 0.8755 48 286
1ziy-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant (c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.9 a 0.8747 48 286
1zi9-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (e36d, c123s) mutant- 1.5 a 0.8742 48 286
ID Description Score Start End Superfamily
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9817 43 283 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9613 43 283 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8742 48 286 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.866 46 282 3.40.50.1820
af_Q8R1G2_23_244_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8566 46 284 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A447MD11-F1-model_v4 deleted 0.989 57 226
AF-A0A080NMG0-F1-model_v4 deleted 0.9874 34 287
AF-A0A0C3N1V8-F1-model_v4 Prolyl oligopeptidase family protein 0.9859 36 286 GO:0016787
AF-A0A259PF19-F1-model_v4 Carboxymethylenebutenolidase 0.9858 89 288 GO:0016787
AF-A0A225M4T6-F1-model_v4 Carboxymethylenebutenolidase 0.9857 32 285 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.07 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map