F407435

General Info

Members Datasets Scaffolds Average Seq Length
324 169 648 118

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10001446|Ga0265327_100014469
Length 119
Sequence MKWLILIIGIASNASASVLVKMAMMPPRKFPALDDSIRSVICNWPFWLGLALYGAAFLLYAAALARLPLNVAHPILTSGAVASVALCSLLIFREPFHWTTIAGILLVVVGVGLITVRVS

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
23 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
24 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
25 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
26 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
27 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
28 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
41 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
42 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
43 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
44 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
45 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
46 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
47 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
48 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
49 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
50 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
51 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
52 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
53 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
54 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
55 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
56 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
57 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
58 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
59 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
60 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
61 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
62 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
63 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
64 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
65 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
66 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
67 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
68 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
69 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
70 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
71 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
72 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
73 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
77 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
78 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
87 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
101 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
115 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
116 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
136 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
139 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
140 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
146 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
147 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
148 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
149 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
150 2511231020 Pseudomonas sp. GM74 Isolate Nodule
151 2511231022 Pseudomonas sp. GM79 Isolate Nodule
152 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
153 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
154 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
155 2643221638 Duganella sp. Root336D2 Isolate Unclassified
156 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
157 2816332133 Acidovorax radicis 2721A Isolate Unclassified
158 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
159 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
160 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
161 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
162 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
163 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
164 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
165 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
166 639633007 Azoarcus olearius BH72 Isolate Unclassified
167 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
168 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
169 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.9
Metatranscriptomes 0
Isolates 7.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0
Endosphere 8.64
Nodule 0.62
Rhizoplane 3.4
Rhizosphere 69.75
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10001446 3300031251 Bacteria 29886
2 SwRhRL2b_contig_367081 2162886007 Bacteria 1865
3 JGI25156J39149_1010330 3300002705 Bacteria 2200
4 JGI25154J39366_1000190 3300002738 Bacteria 45605
5 Ga0055526_1002209 3300003771 Bacteria 13339
6 Ga0055537_1001860 3300003773 Bacteria 7614
7 Ga0055537_1007033 3300003773 Bacteria 2769
8 Ga0055537_1014059 3300003773 Bacteria 1470
9 Ga0055536_1000536 3300003781 Bacteria 26048
10 Ga0055528_1012818 3300003790 Bacteria 3226
11 Ga0055530_10000266 3300003791 Bacteria 47362
12 Ga0055530_10000283 3300003791 Bacteria 46150
13 Ga0055540_1000606 3300003792 Bacteria 25717
14 Ga0065714_10002559 3300005288 Bacteria 17358
15 Ga0065714_10003006 3300005288 Bacteria 10499
16 Ga0065704_10070851 3300005289 Bacteria 15396
17 Ga0105251_10000011 3300009011 Bacteria 180176
18 Ga0105251_10000284 3300009011 Bacteria 50987
19 Ga0105251_10000893 3300009011 Bacteria 26707
20 Ga0105251_10001164 3300009011 Bacteria 22818
21 Ga0105251_10009985 3300009011 Bacteria 5550
22 Ga0105251_10083751 3300009011 Bacteria 1472
23 Ga0105244_10068181 3300009036 Bacteria 1778
24 Ga0105244_10092142 3300009036 Bacteria 1490
25 Ga0105250_10000348 3300009092 Bacteria 35617
26 Ga0105246_10000232 3300011119 Bacteria 28535
27 Ga0157373_10000759 3300013100 Bacteria 25031
28 Ga0157371_10002469 3300013102 Bacteria 17608
29 Ga0157371_10031141 3300013102 Bacteria 3843
30 Ga0157370_10002586 3300013104 Bacteria 21745
31 Ga0157370_10003235 3300013104 Bacteria 19221
32 Ga0157370_10011642 3300013104 Bacteria 9183
33 Ga0157369_10004895 3300013105 Bacteria 15706
34 Ga0157369_11350415 3300013105 Bacteria 726
35 Ga0182008_10001249 3300014497 Bacteria 17458
36 Ga0182006_1000707 3300015261 Bacteria 23141
37 Ga0182006_1153658 3300015261 Bacteria 779
38 Ga0182007_10000296 3300015262 Bacteria 32264
39 Ga0182007_10089300 3300015262 Bacteria 1014
40 Ga0182005_1000014 3300015265 Bacteria 389763
41 Ga0182005_1000325 3300015265 Bacteria 28280
42 Ga0182005_1000529 3300015265 Bacteria 19383
43 Ga0182005_1163387 3300015265 Bacteria 654
44 Ga0163161_10540951 3300017792 Bacteria 953
45 Ga0209646_1000075 3300025246 Bacteria 221755
46 Ga0209759_1001109 3300025256 Bacteria 17383
47 Ga0209565_1000348 3300025263 Bacteria 40662
48 Ga0209565_1000439 3300025263 Bacteria 33341
49 Ga0209565_1001005 3300025263 Bacteria 14486
50 Ga0209565_1052016 3300025263 Unclassified 733
51 Ga0209673_1002992 3300025273 Bacteria 10520
52 Ga0209676_1000255 3300025292 Bacteria 112911
53 Ga0209564_1001062 3300025295 Bacteria 33341
54 Ga0209050_1000271 3300025298 Bacteria 110802
55 Ga0209050_1000420 3300025298 Bacteria 78413
56 Ga0209256_1005349 3300025299 Bacteria 7437
57 Ga0209256_1047152 3300025299 Bacteria 1062
58 Ga0209256_1053443 3300025299 Bacteria 967
59 Ga0209051_1000250 3300025303 Bacteria 90973
60 Ga0207696_1000161 3300025711 Bacteria 109070
61 Ga0207655_1001579 3300025728 Bacteria 20452
62 Ga0207655_1021551 3300025728 Bacteria 3266
63 Ga0207713_1000073 3300025735 Bacteria 181519
64 Ga0207713_1000344 3300025735 Bacteria 50995
65 Ga0207713_1000614 3300025735 Bacteria 35058
66 Ga0207713_1069265 3300025735 Bacteria 1308
67 Ga0207713_1072723 3300025735 Bacteria 1264
68 Ga0307515_10089332 3300028794 Bacteria 3881
69 Ga0307408_100002453 3300031548 Bacteria 13008
70 Ga0307405_10217017 3300031731 Bacteria 1401
71 Ga0307412_10008850 3300031911 Bacteria 5764
72 Ga0373943_0427055 3300035170 Unclassified 767
73 Ga0373927_0069580 3300035695 Bacteria 2278
74 Ga0373925_0007192 3300037068 Bacteria 8136
75 Ga0395905_0003906 3300037471 Bacteria 15715
76 Ga0439438_017264 3300041405 Bacteria 2081
77 Ga0439447_006675 3300041407 Bacteria 3724
78 Ga0439463_000475 3300042016 Bacteria 11182
79 Ga0450911_031264 3300042115 Bacteria 690
80 Ga0439434_0214279 3300042435 Bacteria 652
81 Ga0451577_1576865 3300042876 Bacteria 579
82 Ga0453684_0000273 3300044712 Bacteria 222658
83 Ga0453684_0688804 3300044712 Bacteria 1112
84 Ga0495617_000086 3300046452 Bacteria 67731
85 Ga0495617_006438 3300046452 Bacteria 4115
86 Ga0495617_017982 3300046452 Bacteria 2390
87 Ga0495627_004515 3300046453 Bacteria 5804
88 Ga0495627_025228 3300046453 Bacteria 1929
89 Ga0495603_0000188 3300046455 Bacteria 32204
90 Ga0495590_0021055 3300046457 Bacteria 2314
91 Ga0495591_000430 3300046458 Bacteria 34469
92 Ga0495591_001294 3300046458 Bacteria 15879
93 Ga0495591_002361 3300046458 Bacteria 10614
94 Ga0495591_006365 3300046458 Bacteria 5235
95 Ga0495638_0000583 3300046460 Bacteria 41251
96 Ga0495638_0000868 3300046460 Bacteria 31437
97 Ga0495638_0045516 3300046460 Bacteria 2760
98 Ga0495653_0075623 3300046463 Bacteria 2506
99 Ga0495653_0346090 3300046463 Bacteria 957
100 Ga0495650_0000311 3300046471 Bacteria 87755
101 Ga0495650_0007927 3300046471 Bacteria 6294
102 Ga0495580_0038922 3300046472 Bacteria 3403
103 Ga0495580_0186016 3300046472 Bacteria 1434
104 Ga0495605_0000484 3300046474 Bacteria 34548
105 Ga0495605_0001027 3300046474 Bacteria 18778
106 Ga0495605_0009278 3300046474 Bacteria 5530
107 Ga0495605_0012955 3300046474 Bacteria 4611
108 Ga0495605_0053306 3300046474 Bacteria 1962
109 Ga0495639_0235254 3300046475 Bacteria 903
110 Ga0495664_0191145 3300046477 Bacteria 1241
111 Ga0495584_0017174 3300046491 Bacteria 3687
112 Ga0495584_0023971 3300046491 Bacteria 3093
113 Ga0495585_0000992 3300046492 Bacteria 23785
114 Ga0495585_0001976 3300046492 Bacteria 15273
115 Ga0495585_0004263 3300046492 Bacteria 9314
116 Ga0495585_0055829 3300046492 Bacteria 2182
117 Ga0495596_0000283 3300046500 Bacteria 33843
118 Ga0495607_0000882 3300046501 Bacteria 27974
119 Ga0495607_0002158 3300046501 Bacteria 16384
120 Ga0495607_0023687 3300046501 Bacteria 3839
121 Ga0495607_0063833 3300046501 Unclassified 2082
122 Ga0495607_0170070 3300046501 Bacteria 1101
123 Ga0495583_0000867 3300046506 Bacteria 36740
124 Ga0495583_0001402 3300046506 Bacteria 24561
125 Ga0495583_0002001 3300046506 Bacteria 18656
126 Ga0495606_0000722 3300046507 Bacteria 51115
127 Ga0495606_0001551 3300046507 Bacteria 30264
128 Ga0495606_0002756 3300046507 Bacteria 19703
129 Ga0495610_0022145 3300046512 Bacteria 3480
130 Ga0495610_0082471 3300046512 Bacteria 1473
131 Ga0495616_0022570 3300046513 Bacteria 3398
132 Ga0495616_0040686 3300046513 Bacteria 2373
133 Ga0495616_0042639 3300046513 Bacteria 2309
134 Ga0495620_0000025 3300046515 Bacteria 125369
135 Ga0495620_0006728 3300046515 Bacteria 6291
136 Ga0495620_0052334 3300046515 Bacteria 1734
137 Ga0495628_0203140 3300046516 Bacteria 1492
138 Ga0495630_0284182 3300046517 Bacteria 1264
139 Ga0495631_0000299 3300046518 Bacteria 34689
140 Ga0495631_0001870 3300046518 Bacteria 12427
141 Ga0495631_0013984 3300046518 Bacteria 3881
142 Ga0495632_0003475 3300046519 Bacteria 11144
143 Ga0495632_0013362 3300046519 Bacteria 4688
144 Ga0495637_0000064 3300046520 Bacteria 92793
145 Ga0495637_0001020 3300046520 Bacteria 17613
146 Ga0495637_0003599 3300046520 Bacteria 8206
147 Ga0495643_0000897 3300046522 Bacteria 31700
148 Ga0495644_0004951 3300046523 Bacteria 5227
149 Ga0495648_0000742 3300046524 Bacteria 34816
150 Ga0495648_0000821 3300046524 Bacteria 32785
151 Ga0495648_0035042 3300046524 Bacteria 3257
152 Ga0495648_0142708 3300046524 Bacteria 1258
153 Ga0495666_0010571 3300046526 Bacteria 4599
154 Ga0495666_0131295 3300046526 Bacteria 1170
155 Ga0495652_0019319 3300046529 Bacteria 6071
156 Ga0495652_0533802 3300046529 Bacteria 809
157 Ga0495654_0000487 3300046530 Bacteria 32718
158 Ga0495654_0001495 3300046530 Bacteria 15987
159 Ga0495654_0010939 3300046530 Bacteria 4930
160 Ga0495654_0015556 3300046530 Bacteria 4037
161 Ga0495587_0000318 3300046536 Bacteria 34260
162 Ga0495609_0000073 3300046538 Bacteria 124227
163 Ga0495609_0000161 3300046538 Bacteria 69842
164 Ga0495609_0000262 3300046538 Bacteria 49441
165 Ga0495597_0000305 3300046542 Bacteria 44060
166 Ga0495597_0074847 3300046542 Bacteria 1454
167 Ga0495597_0137994 3300046542 Bacteria 1007
168 Ga0495645_0968348 3300046543 Bacteria 502
169 Ga0495622_0124095 3300046557 Bacteria 1178
170 Ga0495633_0000078 3300046558 Bacteria 128668
171 Ga0495633_0001202 3300046558 Bacteria 20822
172 Ga0495668_0031295 3300046616 Bacteria 2999
173 Ga0495611_0000395 3300046648 Bacteria 27443
174 Ga0495611_0000562 3300046648 Bacteria 21465
175 Ga0495611_0015494 3300046648 Bacteria 3259
176 Ga0495625_0000194 3300046660 Bacteria 96964
177 Ga0495635_0000131 3300046663 Bacteria 45264
178 Ga0495661_0000087 3300046665 Bacteria 112658
179 Ga0495661_0000233 3300046665 Bacteria 64169
180 Ga0495661_0002189 3300046665 Bacteria 15270
181 Ga0495661_0536851 3300046665 Bacteria 554
182 Ga0495588_0209610 3300046674 Bacteria 1029
183 Ga0495623_0001154 3300046679 Bacteria 17868
184 Ga0495623_0146151 3300046679 Bacteria 1402
185 Ga0495646_0019612 3300046680 Bacteria 4277
186 Ga0495646_0096785 3300046680 Bacteria 1697
187 Ga0495613_0203457 3300046689 Bacteria 1395
188 Ga0495670_0000159 3300046691 Bacteria 29368
189 Ga0495670_0092751 3300046691 Bacteria 1547
190 Ga0495670_0126199 3300046691 Bacteria 1332
191 Ga0495670_0239121 3300046691 Bacteria 966
192 Ga0495670_0252611 3300046691 Bacteria 940
193 Ga0495671_0001364 3300046692 Bacteria 16559
194 Ga0495671_0082884 3300046692 Bacteria 1571
195 Ga0495671_0552707 3300046692 Bacteria 548
196 Ga0495649_0099044 3300046694 Bacteria 1550
197 Ga0495589_0000504 3300046794 Bacteria 27610
198 Ga0495589_0000525 3300046794 Bacteria 26868
199 Ga0495589_0000809 3300046794 Bacteria 19813
200 Ga0495600_0054414 3300046809 Bacteria 2614
201 Ga0495660_0000049 3300046810 Bacteria 142727
202 Ga0495660_0027232 3300046810 Bacteria 3234
203 Ga0495660_0027233 3300046810 Bacteria 3234
204 Ga0495581_0137593 3300047315 Bacteria 1424
205 Ga0495604_0065969 3300047317 Bacteria 2754
206 Ga0495674_0004354 3300047319 Bacteria 13608
207 Ga0495672_0033724 3300047320 Bacteria 3170
208 Ga0495672_0047521 3300047320 Bacteria 2551
209 Ga0495676_0000052 3300047321 Bacteria 97049
210 Ga0495676_0000157 3300047321 Bacteria 52412
211 Ga0495680_0000664 3300047322 Bacteria 38534
212 Ga0495683_0000320 3300047323 Bacteria 40260
213 Ga0495683_0000619 3300047323 Bacteria 26557
214 Ga0495683_0001295 3300047323 Bacteria 16901
215 Ga0495683_0001332 3300047323 Bacteria 16524
216 Ga0495683_0038988 3300047323 Bacteria 2402
217 Ga0495683_0157186 3300047323 Bacteria 1053
218 Ga0495675_0849548 3300047444 Bacteria 502
219 Ga0495679_000136 3300047446 Bacteria 65848
220 Ga0495679_000812 3300047446 Bacteria 19836
221 Ga0495679_001561 3300047446 Bacteria 12929
222 Ga0495673_0000903 3300047469 Bacteria 27211
223 Ga0495673_0007363 3300047469 Bacteria 6342
224 Ga0495673_0007586 3300047469 Bacteria 6210
225 Ga0495673_0017059 3300047469 Bacteria 3697
226 Ga0495673_0024956 3300047469 Bacteria 2877
227 Ga0495673_0026722 3300047469 Bacteria 2755
228 Ga0495681_0004449 3300047470 Bacteria 9560
229 Ga0495681_0004815 3300047470 Bacteria 9144
230 Ga0495681_0016909 3300047470 Bacteria 4068
231 Ga0495686_0019308 3300047472 Bacteria 4555
232 Ga0495593_0000168 3300047673 Bacteria 33647
233 Ga0495626_0000126 3300048091 Bacteria 99054
234 Ga0495626_0000621 3300048091 Bacteria 34549
235 Ga0496101_0199126 3300048904 Bacteria 1548
236 Ga0496102_0031590 3300048905 Bacteria 4751
237 Ga0496102_1098783 3300048905 Bacteria 715
238 Ga0496103_0408235 3300048906 Bacteria 872
239 Ga0496103_0803763 3300048906 Bacteria 593
240 Ga0496112_0361247 3300048915 Bacteria 1394
241 Ga0496112_0396637 3300048915 Bacteria 1320
242 Ga0496113_1169801 3300048916 Bacteria 601
243 Ga0496116_0001011 3300048919 Bacteria 34292
244 Ga0496116_0087458 3300048919 Bacteria 1907
245 Ga0496117_0001649 3300048920 Bacteria 31378
246 Ga0496117_0277763 3300048920 Bacteria 898
247 Ga0496118_0001738 3300048921 Bacteria 31643
248 Ga0496118_0001895 3300048921 Bacteria 29825
249 Ga0496118_0030613 3300048921 Bacteria 4486
250 Ga0496118_0036501 3300048921 Bacteria 3973
251 Ga0496118_0199235 3300048921 Bacteria 1188
252 Ga0496119_0001204 3300048922 Bacteria 32316
253 Ga0496119_0001356 3300048922 Bacteria 29915
254 Ga0496120_0001293 3300048923 Bacteria 31131
255 Ga0496120_0001399 3300048923 Bacteria 29187
256 Ga0496121_0001685 3300048924 Bacteria 36349
257 Ga0496121_0002045 3300048924 Bacteria 31934
258 Ga0496121_0004065 3300048924 Bacteria 20095
259 Ga0496121_0204290 3300048924 Bacteria 1405
260 Ga0496122_0000088 3300048925 Bacteria 207600
261 Ga0496122_0000434 3300048925 Bacteria 87536
262 Ga0496122_0000847 3300048925 Bacteria 57788
263 Ga0496122_0003546 3300048925 Bacteria 20414
264 Ga0496122_0017525 3300048925 Bacteria 6690
265 Ga0496122_0022901 3300048925 Bacteria 5530
266 Ga0496122_0040483 3300048925 Bacteria 3702
267 Ga0496122_0041179 3300048925 Bacteria 3657
268 Ga0496123_0000139 3300048926 Bacteria 151469
269 Ga0496123_0000318 3300048926 Bacteria 91911
270 Ga0496123_0000794 3300048926 Bacteria 50999
271 Ga0496123_0001770 3300048926 Bacteria 28492
272 Ga0496123_0013321 3300048926 Bacteria 6918
273 Ga0496123_0016191 3300048926 Bacteria 6070
274 Ga0496123_0022133 3300048926 Bacteria 4910
275 Ga0496123_0033459 3300048926 Bacteria 3699
276 Ga0496124_0000699 3300048927 Bacteria 54987
277 Ga0496124_0003860 3300048927 Bacteria 17927
278 Ga0496124_0007001 3300048927 Bacteria 12086
279 Ga0496124_0011728 3300048927 Bacteria 8743
280 Ga0496124_0121447 3300048927 Bacteria 2087
281 Ga0496125_0000714 3300048928 Bacteria 54950
282 Ga0496125_0006871 3300048928 Bacteria 12192
283 Ga0496125_0128989 3300048928 Bacteria 1785
284 Ga0495678_000073 3300049459 Bacteria 126095
285 Ga0495682_0000080 3300049460 Bacteria 84736
286 Ga0495682_0000466 3300049460 Bacteria 27939
287 Ga0495682_0000723 3300049460 Bacteria 21436
288 Ga0495682_0114968 3300049460 Bacteria 964
289 Ga0495682_0125491 3300049460 Bacteria 918
290 Ga0501047_0240537 3300049581 Bacteria 1661
291 Ga0501227_021572 3300049665 Unclassified 1486
292 Ga0501249_000818 3300049679 Bacteria 6926
293 Ga0501241_000477 3300049758 Bacteria 8685
294 Ga0501035_0356641 3300049822 Bacteria 1223
295 Ga0501044_0034034 3300049823 Bacteria 5348
296 nmdc:mga00v17_367_c1 3300050491 Bacteria 25605
297 nmdc:mga00v17_613214_c1 3300050491 Bacteria 701
298 Ga0500618_002755 3300053125 Bacteria 6391
299 Ga0500618_002927 3300053125 Bacteria 6110
300 Ga0500621_000036 3300053126 Bacteria 25015
301 Ga0500600_0192677 3300053149 Bacteria 969
302 2510281212 2510065053 Bacteria 5005518
303 2510294508 2510065055 Bacteria 5037935
304 2510309360 2510065058 Bacteria 5005894
305 2511349714 2511231020 Bacteria 6115223
306 2511362939 2511231022 Bacteria 6719296
307 2600217818 2599185356 Bacteria 6843884
308 2601777985 2600255313 Bacteria 6842543
309 2609909858 2609459761 Bacteria 5513740
310 2644216682 2643221638 Bacteria 6579467
311 2774131769 2773857672 Bacteria 4993178
312 2816475876 2816332133 Bacteria 7249298
313 2885083336 2885080285 Bacteria 6355622
314 2901305518 2901300506 Bacteria 8463898
315 2917834785 2917832318 Bacteria 5346010
316 2919128908 2919125081 Bacteria 5385106
317 2919388039 2919385768 Bacteria 5897293
318 2974300882 2974298342 Bacteria 4840922
319 2984503354 2984499530 Bacteria 5020881
320 2984508169 2984504281 Bacteria 5262371
321 639788756 639633007 Bacteria 4376040
322 8054352028 8054347763 Bacteria 5901107
323 8056155070 8056155041 Bacteria 6486948
324 8057805173 8057798959 Bacteria 6713499
325 Ga0265327_10001446
326 SwRhRL2b_contig_367081
327 JGI25156J39149_1010330
328 JGI25154J39366_1000190
329 Ga0055526_1002209
330 Ga0055537_1001860
331 Ga0055537_1007033
332 Ga0055537_1014059
333 Ga0055536_1000536
334 Ga0055528_1012818
335 Ga0055530_10000266
336 Ga0055530_10000283
337 Ga0055540_1000606
338 Ga0065714_10002559
339 Ga0065714_10003006
340 Ga0065704_10070851
341 Ga0105251_10000011
342 Ga0105251_10000284
343 Ga0105251_10000893
344 Ga0105251_10001164
345 Ga0105251_10009985
346 Ga0105251_10083751
347 Ga0105244_10068181
348 Ga0105244_10092142
349 Ga0105250_10000348
350 Ga0105246_10000232
351 Ga0157373_10000759
352 Ga0157371_10002469
353 Ga0157371_10031141
354 Ga0157370_10002586
355 Ga0157370_10003235
356 Ga0157370_10011642
357 Ga0157369_10004895
358 Ga0157369_11350415
359 Ga0182008_10001249
360 Ga0182006_1000707
361 Ga0182006_1153658
362 Ga0182007_10000296
363 Ga0182007_10089300
364 Ga0182005_1000014
365 Ga0182005_1000325
366 Ga0182005_1000529
367 Ga0182005_1163387
368 Ga0163161_10540951
369 Ga0209646_1000075
370 Ga0209759_1001109
371 Ga0209565_1000348
372 Ga0209565_1000439
373 Ga0209565_1001005
374 Ga0209565_1052016
375 Ga0209673_1002992
376 Ga0209676_1000255
377 Ga0209564_1001062
378 Ga0209050_1000271
379 Ga0209050_1000420
380 Ga0209256_1005349
381 Ga0209256_1047152
382 Ga0209256_1053443
383 Ga0209051_1000250
384 Ga0207696_1000161
385 Ga0207655_1001579
386 Ga0207655_1021551
387 Ga0207713_1000073
388 Ga0207713_1000344
389 Ga0207713_1000614
390 Ga0207713_1069265
391 Ga0207713_1072723
392 Ga0307515_10089332
393 Ga0307408_100002453
394 Ga0307405_10217017
395 Ga0307412_10008850
396 Ga0373943_0427055
397 Ga0373927_0069580
398 Ga0373925_0007192
399 Ga0395905_0003906
400 Ga0439438_017264
401 Ga0439447_006675
402 Ga0439463_000475
403 Ga0450911_031264
404 Ga0439434_0214279
405 Ga0451577_1576865
406 Ga0453684_0000273
407 Ga0453684_0688804
408 Ga0495617_000086
409 Ga0495617_006438
410 Ga0495617_017982
411 Ga0495627_004515
412 Ga0495627_025228
413 Ga0495603_0000188
414 Ga0495590_0021055
415 Ga0495591_000430
416 Ga0495591_001294
417 Ga0495591_002361
418 Ga0495591_006365
419 Ga0495638_0000583
420 Ga0495638_0000868
421 Ga0495638_0045516
422 Ga0495653_0075623
423 Ga0495653_0346090
424 Ga0495650_0000311
425 Ga0495650_0007927
426 Ga0495580_0038922
427 Ga0495580_0186016
428 Ga0495605_0000484
429 Ga0495605_0001027
430 Ga0495605_0009278
431 Ga0495605_0012955
432 Ga0495605_0053306
433 Ga0495639_0235254
434 Ga0495664_0191145
435 Ga0495584_0017174
436 Ga0495584_0023971
437 Ga0495585_0000992
438 Ga0495585_0001976
439 Ga0495585_0004263
440 Ga0495585_0055829
441 Ga0495596_0000283
442 Ga0495607_0000882
443 Ga0495607_0002158
444 Ga0495607_0023687
445 Ga0495607_0063833
446 Ga0495607_0170070
447 Ga0495583_0000867
448 Ga0495583_0001402
449 Ga0495583_0002001
450 Ga0495606_0000722
451 Ga0495606_0001551
452 Ga0495606_0002756
453 Ga0495610_0022145
454 Ga0495610_0082471
455 Ga0495616_0022570
456 Ga0495616_0040686
457 Ga0495616_0042639
458 Ga0495620_0000025
459 Ga0495620_0006728
460 Ga0495620_0052334
461 Ga0495628_0203140
462 Ga0495630_0284182
463 Ga0495631_0000299
464 Ga0495631_0001870
465 Ga0495631_0013984
466 Ga0495632_0003475
467 Ga0495632_0013362
468 Ga0495637_0000064
469 Ga0495637_0001020
470 Ga0495637_0003599
471 Ga0495643_0000897
472 Ga0495644_0004951
473 Ga0495648_0000742
474 Ga0495648_0000821
475 Ga0495648_0035042
476 Ga0495648_0142708
477 Ga0495666_0010571
478 Ga0495666_0131295
479 Ga0495652_0019319
480 Ga0495652_0533802
481 Ga0495654_0000487
482 Ga0495654_0001495
483 Ga0495654_0010939
484 Ga0495654_0015556
485 Ga0495587_0000318
486 Ga0495609_0000073
487 Ga0495609_0000161
488 Ga0495609_0000262
489 Ga0495597_0000305
490 Ga0495597_0074847
491 Ga0495597_0137994
492 Ga0495645_0968348
493 Ga0495622_0124095
494 Ga0495633_0000078
495 Ga0495633_0001202
496 Ga0495668_0031295
497 Ga0495611_0000395
498 Ga0495611_0000562
499 Ga0495611_0015494
500 Ga0495625_0000194
501 Ga0495635_0000131
502 Ga0495661_0000087
503 Ga0495661_0000233
504 Ga0495661_0002189
505 Ga0495661_0536851
506 Ga0495588_0209610
507 Ga0495623_0001154
508 Ga0495623_0146151
509 Ga0495646_0019612
510 Ga0495646_0096785
511 Ga0495613_0203457
512 Ga0495670_0000159
513 Ga0495670_0092751
514 Ga0495670_0126199
515 Ga0495670_0239121
516 Ga0495670_0252611
517 Ga0495671_0001364
518 Ga0495671_0082884
519 Ga0495671_0552707
520 Ga0495649_0099044
521 Ga0495589_0000504
522 Ga0495589_0000525
523 Ga0495589_0000809
524 Ga0495600_0054414
525 Ga0495660_0000049
526 Ga0495660_0027232
527 Ga0495660_0027233
528 Ga0495581_0137593
529 Ga0495604_0065969
530 Ga0495674_0004354
531 Ga0495672_0033724
532 Ga0495672_0047521
533 Ga0495676_0000052
534 Ga0495676_0000157
535 Ga0495680_0000664
536 Ga0495683_0000320
537 Ga0495683_0000619
538 Ga0495683_0001295
539 Ga0495683_0001332
540 Ga0495683_0038988
541 Ga0495683_0157186
542 Ga0495675_0849548
543 Ga0495679_000136
544 Ga0495679_000812
545 Ga0495679_001561
546 Ga0495673_0000903
547 Ga0495673_0007363
548 Ga0495673_0007586
549 Ga0495673_0017059
550 Ga0495673_0024956
551 Ga0495673_0026722
552 Ga0495681_0004449
553 Ga0495681_0004815
554 Ga0495681_0016909
555 Ga0495686_0019308
556 Ga0495593_0000168
557 Ga0495626_0000126
558 Ga0495626_0000621
559 Ga0496101_0199126
560 Ga0496102_0031590
561 Ga0496102_1098783
562 Ga0496103_0408235
563 Ga0496103_0803763
564 Ga0496112_0361247
565 Ga0496112_0396637
566 Ga0496113_1169801
567 Ga0496116_0001011
568 Ga0496116_0087458
569 Ga0496117_0001649
570 Ga0496117_0277763
571 Ga0496118_0001738
572 Ga0496118_0001895
573 Ga0496118_0030613
574 Ga0496118_0036501
575 Ga0496118_0199235
576 Ga0496119_0001204
577 Ga0496119_0001356
578 Ga0496120_0001293
579 Ga0496120_0001399
580 Ga0496121_0001685
581 Ga0496121_0002045
582 Ga0496121_0004065
583 Ga0496121_0204290
584 Ga0496122_0000088
585 Ga0496122_0000434
586 Ga0496122_0000847
587 Ga0496122_0003546
588 Ga0496122_0017525
589 Ga0496122_0022901
590 Ga0496122_0040483
591 Ga0496122_0041179
592 Ga0496123_0000139
593 Ga0496123_0000318
594 Ga0496123_0000794
595 Ga0496123_0001770
596 Ga0496123_0013321
597 Ga0496123_0016191
598 Ga0496123_0022133
599 Ga0496123_0033459
600 Ga0496124_0000699
601 Ga0496124_0003860
602 Ga0496124_0007001
603 Ga0496124_0011728
604 Ga0496124_0121447
605 Ga0496125_0000714
606 Ga0496125_0006871
607 Ga0496125_0128989
608 Ga0495678_000073
609 Ga0495682_0000080
610 Ga0495682_0000466
611 Ga0495682_0000723
612 Ga0495682_0114968
613 Ga0495682_0125491
614 Ga0501047_0240537
615 Ga0501227_021572
616 Ga0501249_000818
617 Ga0501241_000477
618 Ga0501035_0356641
619 Ga0501044_0034034
620 nmdc:mga00v17_367_c1
621 nmdc:mga00v17_613214_c1
622 Ga0500618_002755
623 Ga0500618_002927
624 Ga0500621_000036
625 Ga0500600_0192677
626 2510281212
627 2510294508
628 2510309360
629 2511349714
630 2511362939
631 2600217818
632 2601777985
633 2609909858
634 2644216682
635 2774131769
636 2816475876
637 2885083336
638 2901305518
639 2917834785
640 2919128908
641 2919388039
642 2974300882
643 2984503354
644 2984508169
645 639788756
646 8054352028
647 8056155070
648 8057805173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10639

TMEM234

Putative transmembrane family 234

21

115

0.94

PF00892

EamA

EamA-like transporter family

10

116

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.8191 3 118
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.8052 3 118
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.7876 3 118
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7875 4 115
7mgx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.7781 4 115
ID Description Score Start End Superfamily
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.896 3 117 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8912 5 120 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8754 5 120 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8705 2 115 1.10.3730.20
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8682 3 118 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A7T1IAB8-F1-model_v4 Multidrug transporter 0.9621 3 117 GO:0005886
GO:0022857
AF-A0A7T1IAB8-F1-model_v4 Multidrug transporter 0.9306 3 117 GO:0005886
GO:0022857
AF-A0A6G7H4J6-F1-model_v4 deleted 0.9302 2 118
AF-A0A0R1NQL4-F1-model_v4 Small multidrug resistance protein 0.9281 2 118 GO:0005886
GO:0022857
AF-A0A7X6I2D0-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9265 3 118 GO:0005886
GO:0022857

Map