F407591

General Info

Members Datasets Scaffolds Average Seq Length
324 224 648 223

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0003100|Ga0495619_0003100_7165_7947
Length 260
Sequence LKTARGPDSLRAVTSGRKAIAGWDGAFGGAPRRWKIGGPYYRPPRAMDYERLYSYRFRDIDQDARAAVWREIAPHVHGLMGSPRTVLDPAAGRGEFIGSVQAEERWAVDEVAYAEATLPAGVTAITSKIMDAELPFEHFDGVFVSNFLEHLKTQEAVADFLERMREVMRAGGRIAIMGPNYRYCAREYWDCADHYVALTHIAIAEHLFAAGFELQRIVPRYLPYSFRGILPPSQRLTRLYLRMPVAWGLLGKQFLVIGRK

Samples

Sample ID Description Type Environment
1 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
97 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 1.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 7.72
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 12.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495619_0003100 3300053085 Bacteria 10788
2 Ga0070683_100076339 3300005329 Bacteria 3132
3 Ga0070683_100237935 3300005329 Unclassified 1731
4 Ga0070683_100245366 3300005329 Bacteria 1703
5 Ga0070689_100194140 3300005340 Bacteria 1654
6 Ga0070661_100590457 3300005344 Unclassified 897
7 Ga0070692_10008250 3300005345 Bacteria 4639
8 Ga0070674_100000016 3300005356 Bacteria 91058
9 Ga0070688_100040247 3300005365 Bacteria 2863
10 Ga0070709_10247639 3300005434 Bacteria 1282
11 Ga0070709_10281322 3300005434 Unclassified 1209
12 Ga0070714_100005458 3300005435 Bacteria 9708
13 Ga0070714_100119295 3300005435 Bacteria 2344
14 Ga0070714_100195589 3300005435 Bacteria 1847
15 Ga0070713_100000055 3300005436 Bacteria 70759
16 Ga0070713_100004233 3300005436 Bacteria 9587
17 Ga0070713_100017570 3300005436 Bacteria 5413
18 Ga0070713_100091477 3300005436 Bacteria 2617
19 Ga0070713_100138306 3300005436 Bacteria 2155
20 Ga0070713_100176944 3300005436 Bacteria 1915
21 Ga0070713_100306761 3300005436 Bacteria 1463
22 Ga0070710_10000001 3300005437 Bacteria 552187
23 Ga0070711_100016243 3300005439 Bacteria 4724
24 Ga0070663_100235457 3300005455 Bacteria 1443
25 Ga0070678_100000713 3300005456 Bacteria 16488
26 Ga0070681_10046240 3300005458 Bacteria 4352
27 Ga0070685_10054496 3300005466 Bacteria 2320
28 Ga0070707_100288517 3300005468 Bacteria 1594
29 Ga0070698_100025122 3300005471 Bacteria 6209
30 Ga0070699_100309829 3300005518 Bacteria 1417
31 Ga0070679_100056753 3300005530 Bacteria 3902
32 Ga0070684_100135658 3300005535 Bacteria 2223
33 Ga0070684_100258881 3300005535 Bacteria 1591
34 Ga0070684_100283765 3300005535 Bacteria 1517
35 Ga0070672_100000036 3300005543 Bacteria 59645
36 Ga0070665_100075645 3300005548 Unclassified 3374
37 Ga0070665_100192545 3300005548 Bacteria 2040
38 Ga0070665_100553241 3300005548 Unclassified 1163
39 Ga0068857_100228388 3300005577 Bacteria 1702
40 Ga0068854_100317514 3300005578 Unclassified 1265
41 Ga0068856_100640391 3300005614 Unclassified 1084
42 Ga0068852_100427696 3300005616 Bacteria 1307
43 Ga0068864_100000035 3300005618 Bacteria 195218
44 Ga0068866_10000426 3300005718 Bacteria 19573
45 Ga0081455_10005106 3300005937 Bacteria 14474
46 Ga0081538_10013756 3300005981 Bacteria 6390
47 Ga0081540_1099303 3300005983 Bacteria 1258
48 Ga0081539_10000615 3300005985 Bacteria 72134
49 Ga0070717_10275718 3300006028 Bacteria 1490
50 Ga0070717_10354780 3300006028 Unclassified 1312
51 Ga0070715_10011463 3300006163 Bacteria 3194
52 Ga0070716_100073766 3300006173 Bacteria 2014
53 Ga0070716_100348584 3300006173 Bacteria 1047
54 Ga0070712_100003951 3300006175 Bacteria 9120
55 Ga0070712_100019735 3300006175 Bacteria 4401
56 Ga0075428_100326977 3300006844 Bacteria 1647
57 Ga0075431_100055246 3300006847 Bacteria 4096
58 Ga0075433_10003003 3300006852 Bacteria 12960
59 Ga0075434_100839856 3300006871 Unclassified 934
60 Ga0075435_100414293 3300007076 Unclassified 1160
61 Ga0105240_10392856 3300009093 Unclassified 1564
62 Ga0105245_10000246 3300009098 Bacteria 51410
63 Ga0105243_10621502 3300009148 Bacteria 1043
64 Ga0105243_10709720 3300009148 Bacteria 981
65 Ga0105242_10000010 3300009176 Bacteria 151649
66 Ga0105242_10270896 3300009176 Bacteria 1538
67 Ga0105239_10521793 3300010375 Bacteria 1351
68 Ga0105246_10050640 3300011119 Bacteria 2849
69 Ga0157370_10101350 3300013104 Bacteria 2697
70 Ga0163162_10100894 3300013306 Bacteria 2978
71 Ga0157372_10483676 3300013307 Bacteria 1443
72 Ga0157380_10000096 3300014326 Bacteria 48405
73 Ga0157379_10385956 3300014968 Unclassified 1285
74 Ga0197907_10527334 3300020069 Unclassified 982
75 Ga0206356_11893029 3300020070 Unclassified 831
76 Ga0206354_10116891 3300020081 Bacteria 2071
77 Ga0206353_11452146 3300020082 Bacteria 2588
78 Ga0213876_10089002 3300021384 Bacteria 1635
79 Ga0213875_10002476 3300021388 Bacteria 11029
80 Ga0213875_10015994 3300021388 Bacteria 3644
81 Ga0224712_10156817 3300022467 Bacteria 1013
82 Ga0207692_10000007 3300025898 Bacteria 233250
83 Ga0207642_10000157 3300025899 Bacteria 19492
84 Ga0207647_10393176 3300025904 Bacteria 782
85 Ga0207685_10023527 3300025905 Bacteria 2098
86 Ga0207699_10012549 3300025906 Bacteria 4311
87 Ga0207705_10049185 3300025909 Bacteria 3035
88 Ga0207707_10002673 3300025912 Bacteria 15923
89 Ga0207695_10503846 3300025913 Unclassified 1093
90 Ga0207693_10004065 3300025915 Bacteria 12433
91 Ga0207693_10009612 3300025915 Bacteria 7874
92 Ga0207693_10456465 3300025915 Bacteria 998
93 Ga0207663_10112746 3300025916 Bacteria 1848
94 Ga0207663_10149258 3300025916 Unclassified 1638
95 Ga0207663_10427025 3300025916 Bacteria 1018
96 Ga0207657_10064863 3300025919 Bacteria 3115
97 Ga0207652_10081850 3300025921 Bacteria 2824
98 Ga0207687_10000325 3300025927 Bacteria 32487
99 Ga0207700_10000009 3300025928 Bacteria 314953
100 Ga0207700_10006239 3300025928 Bacteria 7188
101 Ga0207700_10007253 3300025928 Bacteria 6762
102 Ga0207700_10040410 3300025928 Bacteria 3404
103 Ga0207700_10064548 3300025928 Bacteria 2789
104 Ga0207700_10627340 3300025928 Bacteria 958
105 Ga0207664_10014067 3300025929 Bacteria 5770
106 Ga0207664_10173351 3300025929 Bacteria 1848
107 Ga0207664_10252017 3300025929 Bacteria 1541
108 Ga0207664_10409217 3300025929 Unclassified 1207
109 Ga0207686_10000107 3300025934 Bacteria 67766
110 Ga0207686_10169630 3300025934 Bacteria 1538
111 Ga0207709_10311750 3300025935 Bacteria 1174
112 Ga0207709_10398504 3300025935 Bacteria 1051
113 Ga0207670_10100216 3300025936 Bacteria 2068
114 Ga0207670_10173853 3300025936 Unclassified 1617
115 Ga0207669_10000037 3300025937 Bacteria 77494
116 Ga0207665_10022888 3300025939 Bacteria 4113
117 Ga0207665_10192476 3300025939 Unclassified 1482
118 Ga0207665_10318419 3300025939 Bacteria 1166
119 Ga0207691_10000323 3300025940 Bacteria 47571
120 Ga0207661_10016141 3300025944 Bacteria 5503
121 Ga0207661_10044362 3300025944 Bacteria 3514
122 Ga0207661_10062213 3300025944 Bacteria 3019
123 Ga0207640_10617504 3300025981 Unclassified 920
124 Ga0207677_10000605 3300026023 Bacteria 22116
125 Ga0207678_10138922 3300026067 Bacteria 2073
126 Ga0207676_10000026 3300026095 Bacteria 248593
127 Ga0207674_10023863 3300026116 Bacteria 6543
128 Ga0207674_10507976 3300026116 Unclassified 1164
129 Ga0207675_100161903 3300026118 Bacteria 2135
130 Ga0207683_10002711 3300026121 Bacteria 15470
131 Ga0268266_10000237 3300028379 Bacteria 93824
132 Ga0268266_10070347 3300028379 Unclassified 3032
133 Ga0268266_10258893 3300028379 Bacteria 1612
134 Ga0265337_1000041 3300028556 Bacteria 56264
135 Ga0265337_1000446 3300028556 Bacteria 21976
136 Ga0265326_10000015 3300028558 Bacteria 159279
137 Ga0265326_10001495 3300028558 Bacteria 8181
138 Ga0265319_1000384 3300028563 Bacteria 31990
139 Ga0265334_10004434 3300028573 Bacteria 6230
140 Ga0265318_10055159 3300028577 Unclassified 1488
141 Ga0265323_10012994 3300028653 Bacteria 3329
142 Ga0265322_10000003 3300028654 Bacteria 468671
143 Ga0265322_10004078 3300028654 Bacteria 4373
144 Ga0265336_10016230 3300028666 Bacteria 2437
145 Ga0265338_10015004 3300028800 Bacteria 8558
146 Ga0265324_10000453 3300029957 Bacteria 28979
147 Ga0265324_10004313 3300029957 Bacteria 6487
148 Ga0265332_10002628 3300031238 Bacteria 9052
149 Ga0265328_10000317 3300031239 Bacteria 22474
150 Ga0265320_10000001 3300031240 Bacteria 847191
151 Ga0265320_10046062 3300031240 Bacteria 2139
152 Ga0265325_10169033 3300031241 Bacteria 1024
153 Ga0265329_10007529 3300031242 Bacteria 4203
154 Ga0265340_10020956 3300031247 Bacteria 3352
155 Ga0265339_10090254 3300031249 Unclassified 1607
156 Ga0265331_10001650 3300031250 Bacteria 16210
157 Ga0265327_10000003 3300031251 Bacteria 852750
158 Ga0265316_10010836 3300031344 Bacteria 8281
159 Ga0265316_10357373 3300031344 Bacteria 1056
160 Ga0265314_10000356 3300031711 Bacteria 63799
161 Ga0265314_10105999 3300031711 Unclassified 1796
162 Ga0265342_10006705 3300031712 Bacteria 8532
163 Ga0307409_100274259 3300031995 Unclassified 1555
164 Ga0307416_100098779 3300032002 Bacteria 2533
165 Ga0307411_10099249 3300032005 Bacteria 2055
166 Ga0307415_100015319 3300032126 Bacteria 4536
167 Ga0316212_1012215 3300033547 Bacteria 1224
168 Ga0373934_0015931 3300035086 Unclassified 2855
169 Ga0373923_0038900 3300035111 Bacteria 1951
170 Ga0373953_0008331 3300035117 Bacteria 3517
171 Ga0373956_0026818 3300035119 Bacteria 2497
172 Ga0373957_0046266 3300035120 Bacteria 1651
173 Ga0373943_0100226 3300035170 Bacteria 1514
174 Ga0373955_0033573 3300035172 Bacteria 2703
175 Ga0373935_0138318 3300035692 Bacteria 1643
176 Ga0373933_0008506 3300035724 Bacteria 5598
177 Ga0373937_0065196 3300036401 Bacteria 3352
178 Ga0373937_0124338 3300036401 Bacteria 2405
179 Ga0372808_009277 3300036459 Bacteria 1373
180 Ga0373925_0000033 3300037068 Bacteria 144636
181 Ga0373925_0263495 3300037068 Bacteria 1385
182 Ga0395898_0517446 3300037466 Bacteria 1134
183 Ga0436364_0534780 3300037853 Bacteria 1768
184 Ga0436364_0567625 3300037853 Bacteria 21760
185 Ga0436364_1076043 3300037853 Bacteria 6996
186 Ga0436364_1440771 3300037853 Bacteria 12030
187 Ga0436365_1273787 3300039437 Bacteria 2954
188 Ga0436363_0358722 3300039450 Unclassified 1071
189 Ga0436363_1341402 3300039450 Bacteria 1253
190 Ga0436363_1678347 3300039450 Bacteria 1628
191 Ga0451807_1371897 3300041486 Bacteria 2133
192 Ga0466963_0008950 3300044694 Bacteria 6010
193 Ga0466963_0465605 3300044694 Bacteria 892
194 Ga0466957_0428406 3300044842 Unclassified 908
195 Ga0466967_0130805 3300045976 Bacteria 2330
196 Ga0466967_0186653 3300045976 Bacteria 1958
197 Ga0495592_0101956 3300046454 Bacteria 2044
198 Ga0495592_0146086 3300046454 Bacteria 1640
199 Ga0495603_0000022 3300046455 Bacteria 64108
200 Ga0495591_049473 3300046458 Bacteria 1155
201 Ga0495629_0000674 3300046459 Bacteria 27697
202 Ga0495641_0069921 3300046461 Unclassified 1577
203 Ga0495641_0090015 3300046461 Bacteria 1371
204 Ga0495651_0405754 3300046462 Bacteria 889
205 Ga0495653_0161723 3300046463 Bacteria 1553
206 Ga0495662_0026791 3300046476 Bacteria 2784
207 Ga0495662_0280832 3300046476 Bacteria 820
208 Ga0495664_0035038 3300046477 Bacteria 2954
209 Ga0495608_0000001 3300046511 Bacteria 411278
210 Ga0495608_0042260 3300046511 Bacteria 3048
211 Ga0495618_0384796 3300046514 Bacteria 860
212 Ga0495628_0031192 3300046516 Bacteria 4312
213 Ga0495628_0310277 3300046516 Bacteria 1166
214 Ga0495630_0000115 3300046517 Bacteria 63124
215 Ga0495630_0034529 3300046517 Bacteria 3777
216 Ga0495630_0098910 3300046517 Bacteria 2207
217 Ga0495644_0000299 3300046523 Bacteria 22897
218 Ga0495652_0004474 3300046529 Bacteria 13348
219 Ga0495652_0044888 3300046529 Bacteria 3803
220 Ga0495640_0102458 3300046533 Bacteria 1878
221 Ga0495587_0199332 3300046536 Bacteria 1132
222 Ga0495621_0000153 3300046539 Bacteria 15123
223 Ga0495645_0006622 3300046543 Bacteria 8047
224 Ga0495622_0000325 3300046557 Bacteria 35075
225 Ga0495667_0017790 3300046559 Bacteria 4801
226 Ga0495634_0000379 3300046642 Bacteria 43465
227 Ga0495625_0000154 3300046660 Bacteria 105083
228 Ga0495635_0009661 3300046663 Bacteria 6745
229 Ga0495657_0000002 3300046675 Bacteria 411958
230 Ga0495657_0024972 3300046675 Bacteria 4247
231 Ga0495599_0104835 3300046678 Bacteria 1761
232 Ga0495646_0023401 3300046680 Bacteria 3890
233 Ga0495647_0000006 3300046681 Bacteria 105867
234 Ga0495647_0000492 3300046681 Bacteria 11492
235 Ga0495658_0314014 3300046683 Bacteria 993
236 Ga0495613_0000003 3300046689 Bacteria 248826
237 Ga0495613_0000175 3300046689 Bacteria 62391
238 Ga0495624_0000149 3300046690 Bacteria 51112
239 Ga0495600_0021631 3300046809 Bacteria 4122
240 Ga0495604_0016390 3300047317 Bacteria 5923
241 Ga0495674_0123796 3300047319 Bacteria 2183
242 Ga0495672_0025321 3300047320 Bacteria 3801
243 Ga0495676_0001951 3300047321 Bacteria 18115
244 Ga0495676_0002845 3300047321 Bacteria 15595
245 Ga0495680_0023735 3300047322 Bacteria 5096
246 Ga0495680_0189775 3300047322 Bacteria 1479
247 Ga0495675_0000104 3300047444 Bacteria 60748
248 Ga0495679_014803 3300047446 Bacteria 2874
249 Ga0495684_0054514 3300047471 Bacteria 3049
250 Ga0495684_0103037 3300047471 Bacteria 2157
251 Ga0495593_0082177 3300047673 Unclassified 1665
252 Ga0495602_0000063 3300048088 Bacteria 104915
253 Ga0495602_0000988 3300048088 Bacteria 27558
254 Ga0495602_0016914 3300048088 Bacteria 7319
255 Ga0495602_0105683 3300048088 Bacteria 2300
256 Ga0495602_0434457 3300048088 Bacteria 929
257 Ga0496100_0000027 3300048903 Bacteria 115829
258 Ga0496101_0000012 3300048904 Bacteria 268127
259 Ga0496102_0004551 3300048905 Bacteria 11720
260 Ga0496102_0690808 3300048905 Bacteria 943
261 Ga0496103_0016294 3300048906 Bacteria 4435
262 Ga0496104_0000243 3300048907 Bacteria 48237
263 Ga0496105_0000622 3300048908 Bacteria 23722
264 Ga0496106_0000020 3300048909 Bacteria 169168
265 Ga0496107_0000014 3300048910 Bacteria 176738
266 Ga0496108_0105018 3300048911 Unclassified 2411
267 Ga0496109_0003049 3300048912 Bacteria 13964
268 Ga0496109_0006379 3300048912 Bacteria 9928
269 Ga0496109_0244916 3300048912 Bacteria 1688
270 Ga0496109_0300845 3300048912 Bacteria 1513
271 Ga0496110_0081647 3300048913 Bacteria 2882
272 Ga0496111_0090444 3300048914 Bacteria 2242
273 Ga0496112_0465591 3300048915 Bacteria 1201
274 Ga0496113_0007960 3300048916 Bacteria 6866
275 Ga0496113_0014131 3300048916 Bacteria 5436
276 Ga0496113_0394788 3300048916 Bacteria 1110
277 Ga0496114_0210087 3300048917 Bacteria 1707
278 Ga0496115_0000004 3300048918 Bacteria 319734
279 Ga0496115_0046559 3300048918 Bacteria 3467
280 Ga0496115_0127853 3300048918 Bacteria 2094
281 Ga0496116_0000500 3300048919 Bacteria 53809
282 Ga0496117_0001638 3300048920 Bacteria 31520
283 Ga0496117_0026078 3300048920 Bacteria 4580
284 Ga0496118_0001199 3300048921 Bacteria 39892
285 Ga0496118_0068004 3300048921 Bacteria 2589
286 Ga0496119_0001539 3300048922 Bacteria 27538
287 Ga0496119_0066636 3300048922 Bacteria 2126
288 Ga0496120_0000528 3300048923 Bacteria 59001
289 Ga0496126_0081665 3300048929 Unclassified 2857
290 Ga0496126_0220717 3300048929 Unclassified 1592
291 Ga0496126_0237169 3300048929 Bacteria 1526
292 Ga0496126_0718992 3300048929 Bacteria 774
293 Ga0501034_0272403 3300049571 Bacteria 1634
294 Ga0501039_0051623 3300049575 Bacteria 3182
295 Ga0501039_0118478 3300049575 Bacteria 2074
296 Ga0501042_0026570 3300049578 Bacteria 4067
297 Ga0501042_0183819 3300049578 Bacteria 1508
298 Ga0501047_0196133 3300049581 Bacteria 1881
299 Ga0501047_0362617 3300049581 Bacteria 1285
300 Ga0501067_0212207 3300049583 Bacteria 1078
301 Ga0501070_0003280 3300049586 Bacteria 14043
302 Ga0501071_0167196 3300049587 Bacteria 1646
303 Ga0501072_0781120 3300049588 Bacteria 749
304 Ga0501074_0088889 3300049590 Unclassified 2212
305 Ga0501080_0074268 3300049742 Bacteria 3163
306 Ga0501044_0026085 3300049823 Bacteria 6189
307 nmdc:mga06r32_42727_c1 3300050510 Bacteria 4311
308 nmdc:mga0n895_768570_c1 3300050512 Unclassified 955
309 nmdc:mga0a205_3066_c1 3300050515 Bacteria 14829
310 Ga0495601_0000041 3300053077 Bacteria 79353
311 Ga0495601_0004166 3300053077 Bacteria 8337
312 Ga0495601_0007659 3300053077 Bacteria 6345
313 Ga0495601_0038159 3300053077 Bacteria 3003
314 Ga0495601_0340030 3300053077 Unclassified 976
315 Ga0495612_0000808 3300053078 Bacteria 12758
316 Ga0495655_0000012 3300053083 Bacteria 92485
317 Ga0495595_0000001 3300053084 Bacteria 495226
318 Ga0495595_0091934 3300053084 Unclassified 1456
319 Ga0495619_0000094 3300053085 Bacteria 67416
320 Ga0500566_0184557 3300053094 Bacteria 1067
321 Ga0500595_009012 3300053119 Bacteria 4053
322 Ga0500628_000014 3300053129 Bacteria 102838
323 Ga0500658_0080405 3300053134 Unclassified 1393
324 Ga0501082_0336583 3300060353 Bacteria 1315
325 Ga0495619_0003100
326 Ga0070683_100076339
327 Ga0070683_100237935
328 Ga0070683_100245366
329 Ga0070689_100194140
330 Ga0070661_100590457
331 Ga0070692_10008250
332 Ga0070674_100000016
333 Ga0070688_100040247
334 Ga0070709_10247639
335 Ga0070709_10281322
336 Ga0070714_100005458
337 Ga0070714_100119295
338 Ga0070714_100195589
339 Ga0070713_100000055
340 Ga0070713_100004233
341 Ga0070713_100017570
342 Ga0070713_100091477
343 Ga0070713_100138306
344 Ga0070713_100176944
345 Ga0070713_100306761
346 Ga0070710_10000001
347 Ga0070711_100016243
348 Ga0070663_100235457
349 Ga0070678_100000713
350 Ga0070681_10046240
351 Ga0070685_10054496
352 Ga0070707_100288517
353 Ga0070698_100025122
354 Ga0070699_100309829
355 Ga0070679_100056753
356 Ga0070684_100135658
357 Ga0070684_100258881
358 Ga0070684_100283765
359 Ga0070672_100000036
360 Ga0070665_100075645
361 Ga0070665_100192545
362 Ga0070665_100553241
363 Ga0068857_100228388
364 Ga0068854_100317514
365 Ga0068856_100640391
366 Ga0068852_100427696
367 Ga0068864_100000035
368 Ga0068866_10000426
369 Ga0081455_10005106
370 Ga0081538_10013756
371 Ga0081540_1099303
372 Ga0081539_10000615
373 Ga0070717_10275718
374 Ga0070717_10354780
375 Ga0070715_10011463
376 Ga0070716_100073766
377 Ga0070716_100348584
378 Ga0070712_100003951
379 Ga0070712_100019735
380 Ga0075428_100326977
381 Ga0075431_100055246
382 Ga0075433_10003003
383 Ga0075434_100839856
384 Ga0075435_100414293
385 Ga0105240_10392856
386 Ga0105245_10000246
387 Ga0105243_10621502
388 Ga0105243_10709720
389 Ga0105242_10000010
390 Ga0105242_10270896
391 Ga0105239_10521793
392 Ga0105246_10050640
393 Ga0157370_10101350
394 Ga0163162_10100894
395 Ga0157372_10483676
396 Ga0157380_10000096
397 Ga0157379_10385956
398 Ga0197907_10527334
399 Ga0206356_11893029
400 Ga0206354_10116891
401 Ga0206353_11452146
402 Ga0213876_10089002
403 Ga0213875_10002476
404 Ga0213875_10015994
405 Ga0224712_10156817
406 Ga0207692_10000007
407 Ga0207642_10000157
408 Ga0207647_10393176
409 Ga0207685_10023527
410 Ga0207699_10012549
411 Ga0207705_10049185
412 Ga0207707_10002673
413 Ga0207695_10503846
414 Ga0207693_10004065
415 Ga0207693_10009612
416 Ga0207693_10456465
417 Ga0207663_10112746
418 Ga0207663_10149258
419 Ga0207663_10427025
420 Ga0207657_10064863
421 Ga0207652_10081850
422 Ga0207687_10000325
423 Ga0207700_10000009
424 Ga0207700_10006239
425 Ga0207700_10007253
426 Ga0207700_10040410
427 Ga0207700_10064548
428 Ga0207700_10627340
429 Ga0207664_10014067
430 Ga0207664_10173351
431 Ga0207664_10252017
432 Ga0207664_10409217
433 Ga0207686_10000107
434 Ga0207686_10169630
435 Ga0207709_10311750
436 Ga0207709_10398504
437 Ga0207670_10100216
438 Ga0207670_10173853
439 Ga0207669_10000037
440 Ga0207665_10022888
441 Ga0207665_10192476
442 Ga0207665_10318419
443 Ga0207691_10000323
444 Ga0207661_10016141
445 Ga0207661_10044362
446 Ga0207661_10062213
447 Ga0207640_10617504
448 Ga0207677_10000605
449 Ga0207678_10138922
450 Ga0207676_10000026
451 Ga0207674_10023863
452 Ga0207674_10507976
453 Ga0207675_100161903
454 Ga0207683_10002711
455 Ga0268266_10000237
456 Ga0268266_10070347
457 Ga0268266_10258893
458 Ga0265337_1000041
459 Ga0265337_1000446
460 Ga0265326_10000015
461 Ga0265326_10001495
462 Ga0265319_1000384
463 Ga0265334_10004434
464 Ga0265318_10055159
465 Ga0265323_10012994
466 Ga0265322_10000003
467 Ga0265322_10004078
468 Ga0265336_10016230
469 Ga0265338_10015004
470 Ga0265324_10000453
471 Ga0265324_10004313
472 Ga0265332_10002628
473 Ga0265328_10000317
474 Ga0265320_10000001
475 Ga0265320_10046062
476 Ga0265325_10169033
477 Ga0265329_10007529
478 Ga0265340_10020956
479 Ga0265339_10090254
480 Ga0265331_10001650
481 Ga0265327_10000003
482 Ga0265316_10010836
483 Ga0265316_10357373
484 Ga0265314_10000356
485 Ga0265314_10105999
486 Ga0265342_10006705
487 Ga0307409_100274259
488 Ga0307416_100098779
489 Ga0307411_10099249
490 Ga0307415_100015319
491 Ga0316212_1012215
492 Ga0373934_0015931
493 Ga0373923_0038900
494 Ga0373953_0008331
495 Ga0373956_0026818
496 Ga0373957_0046266
497 Ga0373943_0100226
498 Ga0373955_0033573
499 Ga0373935_0138318
500 Ga0373933_0008506
501 Ga0373937_0065196
502 Ga0373937_0124338
503 Ga0372808_009277
504 Ga0373925_0000033
505 Ga0373925_0263495
506 Ga0395898_0517446
507 Ga0436364_0534780
508 Ga0436364_0567625
509 Ga0436364_1076043
510 Ga0436364_1440771
511 Ga0436365_1273787
512 Ga0436363_0358722
513 Ga0436363_1341402
514 Ga0436363_1678347
515 Ga0451807_1371897
516 Ga0466963_0008950
517 Ga0466963_0465605
518 Ga0466957_0428406
519 Ga0466967_0130805
520 Ga0466967_0186653
521 Ga0495592_0101956
522 Ga0495592_0146086
523 Ga0495603_0000022
524 Ga0495591_049473
525 Ga0495629_0000674
526 Ga0495641_0069921
527 Ga0495641_0090015
528 Ga0495651_0405754
529 Ga0495653_0161723
530 Ga0495662_0026791
531 Ga0495662_0280832
532 Ga0495664_0035038
533 Ga0495608_0000001
534 Ga0495608_0042260
535 Ga0495618_0384796
536 Ga0495628_0031192
537 Ga0495628_0310277
538 Ga0495630_0000115
539 Ga0495630_0034529
540 Ga0495630_0098910
541 Ga0495644_0000299
542 Ga0495652_0004474
543 Ga0495652_0044888
544 Ga0495640_0102458
545 Ga0495587_0199332
546 Ga0495621_0000153
547 Ga0495645_0006622
548 Ga0495622_0000325
549 Ga0495667_0017790
550 Ga0495634_0000379
551 Ga0495625_0000154
552 Ga0495635_0009661
553 Ga0495657_0000002
554 Ga0495657_0024972
555 Ga0495599_0104835
556 Ga0495646_0023401
557 Ga0495647_0000006
558 Ga0495647_0000492
559 Ga0495658_0314014
560 Ga0495613_0000003
561 Ga0495613_0000175
562 Ga0495624_0000149
563 Ga0495600_0021631
564 Ga0495604_0016390
565 Ga0495674_0123796
566 Ga0495672_0025321
567 Ga0495676_0001951
568 Ga0495676_0002845
569 Ga0495680_0023735
570 Ga0495680_0189775
571 Ga0495675_0000104
572 Ga0495679_014803
573 Ga0495684_0054514
574 Ga0495684_0103037
575 Ga0495593_0082177
576 Ga0495602_0000063
577 Ga0495602_0000988
578 Ga0495602_0016914
579 Ga0495602_0105683
580 Ga0495602_0434457
581 Ga0496100_0000027
582 Ga0496101_0000012
583 Ga0496102_0004551
584 Ga0496102_0690808
585 Ga0496103_0016294
586 Ga0496104_0000243
587 Ga0496105_0000622
588 Ga0496106_0000020
589 Ga0496107_0000014
590 Ga0496108_0105018
591 Ga0496109_0003049
592 Ga0496109_0006379
593 Ga0496109_0244916
594 Ga0496109_0300845
595 Ga0496110_0081647
596 Ga0496111_0090444
597 Ga0496112_0465591
598 Ga0496113_0007960
599 Ga0496113_0014131
600 Ga0496113_0394788
601 Ga0496114_0210087
602 Ga0496115_0000004
603 Ga0496115_0046559
604 Ga0496115_0127853
605 Ga0496116_0000500
606 Ga0496117_0001638
607 Ga0496117_0026078
608 Ga0496118_0001199
609 Ga0496118_0068004
610 Ga0496119_0001539
611 Ga0496119_0066636
612 Ga0496120_0000528
613 Ga0496126_0081665
614 Ga0496126_0220717
615 Ga0496126_0237169
616 Ga0496126_0718992
617 Ga0501034_0272403
618 Ga0501039_0051623
619 Ga0501039_0118478
620 Ga0501042_0026570
621 Ga0501042_0183819
622 Ga0501047_0196133
623 Ga0501047_0362617
624 Ga0501067_0212207
625 Ga0501070_0003280
626 Ga0501071_0167196
627 Ga0501072_0781120
628 Ga0501074_0088889
629 Ga0501080_0074268
630 Ga0501044_0026085
631 nmdc:mga06r32_42727_c1
632 nmdc:mga0n895_768570_c1
633 nmdc:mga0a205_3066_c1
634 Ga0495601_0000041
635 Ga0495601_0004166
636 Ga0495601_0007659
637 Ga0495601_0038159
638 Ga0495601_0340030
639 Ga0495612_0000808
640 Ga0495655_0000012
641 Ga0495595_0000001
642 Ga0495595_0091934
643 Ga0495619_0000094
644 Ga0500566_0184557
645 Ga0500595_009012
646 Ga0500628_000014
647 Ga0500658_0080405
648 Ga0501082_0336583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

87

176

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ofk-assembly2.cif.gz_B crystal structure of n-methyltransferase nods from bradyrhizobium japonicum wm9 in complex with s-adenosyl-l-homocysteine (sah) 0.7697 29 213
3dlc-assembly1.cif.gz_A crystal structure of a putative s-adenosyl-l-methionine-dependent methyltransferase (mmp1179) from methanococcus maripaludis at 1.15 a resolution 0.7693 8 136
3cjt-assembly7.cif.gz_M ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.7681 26 214
2nxn-assembly1.cif.gz_A t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 0.7595 39 214
5cm2-assembly1.cif.gz_Z structure of y. lipolytica trm9-trm112 complex, a methyltransferase modifying u34 in the anticodon loop of some trnas 0.7576 38 212
ID Description Score Start End Superfamily
af_Q8IJC4_363_592_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8715 30 135 3.40.50.150
af_Q18489_32_205_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8457 28 132 3.40.50.150
1xtpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8438 22 134 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8288 28 130 3.40.50.150
af_A0A1D6NEM6_1_118_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8201 59 130 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2M6X3D3-F1-model_v4 Methyltransferase type 11 0.976 1 213 GO:0008757
GO:0032259
AF-A0A536PUT0-F1-model_v4 Methyltransferase domain-containing protein 0.9695 94 213 GO:0008757
GO:0032259
AF-A0A3D0IB79-F1-model_v4 Class I SAM-dependent methyltransferase 0.9677 1 213
AF-A0A2M6X3D3-F1-model_v4 Methyltransferase type 11 0.9671 1 213 GO:0008757
GO:0032259
AF-A0A2G4I2H4-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9658 81 213

Map