F407646

General Info

Members Datasets Scaffolds Average Seq Length
325 220 650 218

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10040094|Ga0055531_100400941
Length 251
Sequence MLDLPRPRKGPRLFPGYTQRPTSTFHRAGRDRMSFEISPVFSVPFAQDFLPDAAALNPQLRALILSRESEGMRYANPNPSLKQQPGVFESDFNLFAWQDACIQQLRQFCWATLGRTIRDLNGYSAEEMKQLQIFSHTWFHVTRQGGFTINHTHPMASWSGVYCVDPGTTPEDRPESGVLRFHNPHHYSNLFLDAGNARLRAPYHHGTWNIRFQAGQLVLFPSWLQHEVMPFYGDDERITIAFNCWFGMKNA

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
163 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
164 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
168 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
169 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
194 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
195 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
196 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
200 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
201 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
202 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
203 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
211 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
212 2643221559 Lysobacter sp. Root559 Isolate Unclassified
213 2643221573 Lysobacter sp. Root604 Isolate Unclassified
214 2643221586 Lysobacter sp. Root667 Isolate Unclassified
215 2643221612 Lysobacter sp. Root76 Isolate Unclassified
216 2643221695 Lysobacter sp. Root494 Isolate Unclassified
217 2643221720 Lysobacter sp. Root916 Isolate Unclassified
218 2643221727 Lysobacter sp. Root96 Isolate Unclassified
219 2643221728 Lysobacter sp. Root983 Isolate Unclassified
220 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.08
Nodule 0
Rhizoplane 3.38
Rhizosphere 81.23
Stem 0
Stem Tuber 0
Unclassified 19.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10040094 3300003794 Bacteria 1379
2 MBSR1b_contig_11054327 2162886012 Unclassified 2348
3 JGI24750J21931_1021598 3300002070 Bacteria 903
4 JGI25151J46595_10020460 3300003187 Bacteria 2789
5 rootH2_10097781 3300003320 Bacteria 3666
6 Ga0055524_1015367 3300003775 Bacteria 2794
7 Ga0055524_1025223 3300003775 Bacteria 1866
8 Ga0055536_1001866 3300003781 Bacteria 12286
9 Ga0055534_1007188 3300003784 Bacteria 2694
10 Ga0055530_10005031 3300003791 Bacteria 6505
11 Ga0055531_10015676 3300003794 Bacteria 3321
12 Ga0055531_10020582 3300003794 Bacteria 2602
13 Ga0055531_10029540 3300003794 Bacteria 1865
14 Ga0055531_10044392 3300003794 Bacteria 1246
15 Ga0055531_10045758 3300003794 Bacteria 1211
16 Ga0065714_10096898 3300005288 Unclassified 1749
17 Ga0065712_10075743 3300005290 Bacteria 3795
18 Ga0065715_10098994 3300005293 Bacteria 3471
19 Ga0070676_10059239 3300005328 Bacteria 2271
20 Ga0070690_100030709 3300005330 Bacteria 3342
21 Ga0070670_100004115 3300005331 Bacteria 12156
22 Ga0070670_100050264 3300005331 Unclassified 3583
23 Ga0068869_100002081 3300005334 Bacteria 12030
24 Ga0070666_10012427 3300005335 Bacteria 5371
25 Ga0070666_10543708 3300005335 Unclassified 844
26 Ga0070680_100168911 3300005336 Unclassified 1840
27 Ga0070689_100035492 3300005340 Unclassified 3810
28 Ga0070687_100001650 3300005343 Bacteria 7982
29 Ga0070661_100139667 3300005344 Bacteria 1825
30 Ga0070661_100344550 3300005344 Bacteria 1168
31 Ga0070668_100003603 3300005347 Bacteria 11431
32 Ga0070668_100019852 3300005347 Bacteria 5063
33 Ga0070669_100059871 3300005353 Bacteria 2796
34 Ga0070675_100002911 3300005354 Bacteria 12905
35 Ga0070671_100025507 3300005355 Bacteria 4851
36 Ga0070674_100616473 3300005356 Bacteria 919
37 Ga0070673_100106443 3300005364 Unclassified 2319
38 Ga0070667_100029333 3300005367 Bacteria 4583
39 Ga0070667_100146902 3300005367 Bacteria 2068
40 Ga0070714_100000395 3300005435 Bacteria 32294
41 Ga0070714_100021904 3300005435 Bacteria 5233
42 Ga0070713_100337133 3300005436 Unclassified 1396
43 Ga0070701_10054844 3300005438 Bacteria 2080
44 Ga0070711_100098734 3300005439 Bacteria 2120
45 Ga0070705_100060546 3300005440 Unclassified 2246
46 Ga0070694_100409684 3300005444 Bacteria 1063
47 Ga0070678_100087911 3300005456 Unclassified 2374
48 Ga0070678_100467941 3300005456 Unclassified 1107
49 Ga0070662_100016467 3300005457 Bacteria 4966
50 Ga0070662_100096680 3300005457 Unclassified 2228
51 Ga0070681_10427034 3300005458 Unclassified 1237
52 Ga0068867_100070402 3300005459 Unclassified 2615
53 Ga0070685_10158780 3300005466 Bacteria 1439
54 Ga0070679_100596594 3300005530 Unclassified 1048
55 Ga0070684_100016956 3300005535 Bacteria 5969
56 Ga0068853_100079908 3300005539 Bacteria 2860
57 Ga0070672_100172746 3300005543 Unclassified 1798
58 Ga0070686_100027234 3300005544 Bacteria 3458
59 Ga0070664_100002473 3300005564 Bacteria 14879
60 Ga0068857_100512738 3300005577 Bacteria 1126
61 Ga0068854_100189152 3300005578 Unclassified 1612
62 Ga0068856_100096589 3300005614 Bacteria 2943
63 Ga0070702_100003638 3300005615 Bacteria 6935
64 Ga0068852_100515317 3300005616 Bacteria 1193
65 Ga0068859_100014440 3300005617 Bacteria 7926
66 Ga0068859_100069245 3300005617 Bacteria 3563
67 Ga0068864_100004083 3300005618 Bacteria 11988
68 Ga0068864_100175036 3300005618 Bacteria 1959
69 Ga0068866_10336312 3300005718 Bacteria 955
70 Ga0068861_100001281 3300005719 Bacteria 15707
71 Ga0068861_100045077 3300005719 Unclassified 3319
72 Ga0068870_10067969 3300005840 Unclassified 1935
73 Ga0068863_100001465 3300005841 Bacteria 23413
74 Ga0068863_100013531 3300005841 Bacteria 7871
75 Ga0068858_100019915 3300005842 Bacteria 6272
76 Ga0068858_100202038 3300005842 Bacteria 1879
77 Ga0068860_100014496 3300005843 Bacteria 7715
78 Ga0068860_100018622 3300005843 Bacteria 6754
79 Ga0068862_100000444 3300005844 Bacteria 45032
80 Ga0068862_100006783 3300005844 Bacteria 9494
81 Ga0068862_100059066 3300005844 Unclassified 3292
82 Ga0068862_101012267 3300005844 Unclassified 822
83 Ga0097621_100226265 3300006237 Bacteria 1632
84 Ga0097621_100231224 3300006237 Unclassified 1614
85 Ga0068871_100066717 3300006358 Bacteria 2950
86 Ga0068871_100306052 3300006358 Unclassified 1396
87 Ga0075428_100000877 3300006844 Bacteria 31669
88 Ga0075428_100448016 3300006844 Bacteria 1383
89 Ga0075430_100051178 3300006846 Bacteria 3481
90 Ga0075430_100097943 3300006846 Bacteria 2450
91 Ga0075431_100000544 3300006847 Bacteria 31685
92 Ga0075431_100094131 3300006847 Bacteria 3092
93 Ga0075431_100132305 3300006847 Unclassified 2573
94 Ga0075429_100020585 3300006880 Bacteria 5725
95 Ga0068865_100067756 3300006881 Unclassified 2522
96 Ga0097620_100014443 3300006931 Bacteria 7926
97 Ga0097620_100069245 3300006931 Bacteria 3563
98 Ga0111539_10007604 3300009094 Bacteria 13845
99 Ga0111539_10020533 3300009094 Bacteria 8135
100 Ga0111539_10025852 3300009094 Bacteria 7188
101 Ga0111539_10099765 3300009094 Unclassified 3410
102 Ga0105247_10150919 3300009101 Unclassified 1531
103 Ga0114129_10174006 3300009147 Unclassified 2933
104 Ga0114129_11464936 3300009147 Bacteria 840
105 Ga0105243_10020398 3300009148 Bacteria 5026
106 Ga0105248_10004291 3300009177 Bacteria 15775
107 Ga0105238_10532374 3300009551 Bacteria 1178
108 Ga0105249_10001844 3300009553 Bacteria 18422
109 Ga0105249_10009136 3300009553 Bacteria 8669
110 Ga0105239_10265502 3300010375 Bacteria 1930
111 Ga0105239_10315210 3300010375 Bacteria 1763
112 Ga0157316_1015265 3300012510 Bacteria 775
113 Ga0157374_10054875 3300013296 Unclassified 3718
114 Ga0163162_10058715 3300013306 Bacteria 3877
115 Ga0163162_10108093 3300013306 Unclassified 2877
116 Ga0163163_10002210 3300014325 Bacteria 16364
117 Ga0163163_10499037 3300014325 Bacteria 1279
118 Ga0163163_10952501 3300014325 Bacteria 922
119 Ga0157380_11111480 3300014326 Bacteria 830
120 Ga0157377_10004781 3300014745 Bacteria 6278
121 Ga0157377_10627412 3300014745 Bacteria 770
122 Ga0157379_10121093 3300014968 Bacteria 2353
123 Ga0157376_10097948 3300014969 Bacteria 2556
124 Ga0209675_1008212 3300025291 Bacteria 3874
125 Ga0209675_1033019 3300025291 Bacteria 1205
126 Ga0209676_1000853 3300025292 Bacteria 39341
127 Ga0209676_1001638 3300025292 Bacteria 19672
128 Ga0209676_1002245 3300025292 Bacteria 14279
129 Ga0209676_1005352 3300025292 Bacteria 6748
130 Ga0209676_1017075 3300025292 Bacteria 2585
131 Ga0209676_1029451 3300025292 Bacteria 1695
132 Ga0209025_1006156 3300025294 Bacteria 9439
133 Ga0209025_1022651 3300025294 Bacteria 3320
134 Ga0209025_1055602 3300025294 Bacteria 1528
135 Ga0209564_1014357 3300025295 Bacteria 3301
136 Ga0209758_1018388 3300025297 Bacteria 3426
137 Ga0209050_1000652 3300025298 Bacteria 53645
138 Ga0209050_1015492 3300025298 Bacteria 3196
139 Ga0209256_1004152 3300025299 Bacteria 9349
140 Ga0209256_1005109 3300025299 Bacteria 7778
141 Ga0209256_1011411 3300025299 Bacteria 3557
142 Ga0209051_1009836 3300025303 Bacteria 4892
143 Ga0209257_1000378 3300025304 Bacteria 88945
144 Ga0209257_1002057 3300025304 Bacteria 21312
145 Ga0209257_1005547 3300025304 Bacteria 8786
146 Ga0209257_1008474 3300025304 Bacteria 5832
147 Ga0207642_10146054 3300025899 Unclassified 1253
148 Ga0207642_10216534 3300025899 Unclassified 1068
149 Ga0207710_10094984 3300025900 Bacteria 1400
150 Ga0207688_10072305 3300025901 Unclassified 1959
151 Ga0207680_10074782 3300025903 Bacteria 2111
152 Ga0207680_10076497 3300025903 Unclassified 2090
153 Ga0207645_10076703 3300025907 Unclassified 2141
154 Ga0207643_10033475 3300025908 Unclassified 2875
155 Ga0207654_10448286 3300025911 Bacteria 904
156 Ga0207654_10511994 3300025911 Unclassified 849
157 Ga0207671_10006504 3300025914 Bacteria 10390
158 Ga0207663_10075147 3300025916 Bacteria 2192
159 Ga0207662_10003875 3300025918 Bacteria 7783
160 Ga0207649_10020395 3300025920 Bacteria 3801
161 Ga0207652_10503072 3300025921 Unclassified 1091
162 Ga0207681_10020707 3300025923 Bacteria 4172
163 Ga0207694_10328648 3300025924 Bacteria 1263
164 Ga0207650_10008769 3300025925 Bacteria 6910
165 Ga0207650_10113649 3300025925 Unclassified 2100
166 Ga0207659_10038569 3300025926 Bacteria 3324
167 Ga0207664_10005638 3300025929 Bacteria 8557
168 Ga0207644_10036242 3300025931 Bacteria 3462
169 Ga0207706_10007163 3300025933 Bacteria 10314
170 Ga0207706_10125423 3300025933 Unclassified 2258
171 Ga0207670_10032220 3300025936 Unclassified 3368
172 Ga0207669_10009668 3300025937 Bacteria 4609
173 Ga0207669_10490161 3300025937 Bacteria 981
174 Ga0207704_10032306 3300025938 Unclassified 2960
175 Ga0207711_10007133 3300025941 Bacteria 9363
176 Ga0207689_10004165 3300025942 Bacteria 13147
177 Ga0207679_10022794 3300025945 Bacteria 4269
178 Ga0207667_10224913 3300025949 Unclassified 1922
179 Ga0207651_10005488 3300025960 Bacteria 6520
180 Ga0207712_10010651 3300025961 Bacteria 5839
181 Ga0207712_10413777 3300025961 Bacteria 1136
182 Ga0207712_10786435 3300025961 Unclassified 836
183 Ga0207668_10094337 3300025972 Unclassified 2206
184 Ga0207640_10584906 3300025981 Bacteria 943
185 Ga0207658_10162345 3300025986 Unclassified 1832
186 Ga0207658_10195892 3300025986 Bacteria 1683
187 Ga0207703_10000802 3300026035 Bacteria 30959
188 Ga0207703_10949566 3300026035 Bacteria 824
189 Ga0207639_10087521 3300026041 Unclassified 2483
190 Ga0207678_10207179 3300026067 Bacteria 1677
191 Ga0207708_10005652 3300026075 Bacteria 9235
192 Ga0207702_10033079 3300026078 Bacteria 4316
193 Ga0207641_10001349 3300026088 Bacteria 24338
194 Ga0207641_10006148 3300026088 Bacteria 10158
195 Ga0207641_10720217 3300026088 Bacteria 983
196 Ga0207648_10053692 3300026089 Unclassified 3522
197 Ga0207676_10004261 3300026095 Bacteria 10110
198 Ga0207676_10056008 3300026095 Bacteria 3098
199 Ga0207674_10023976 3300026116 Bacteria 6526
200 Ga0207674_10067681 3300026116 Unclassified 3595
201 Ga0207675_100006523 3300026118 Bacteria 11047
202 Ga0207675_100019811 3300026118 Bacteria 6278
203 Ga0207683_10054487 3300026121 Bacteria 3507
204 Ga0207683_10401306 3300026121 Unclassified 1261
205 Ga0207698_10695402 3300026142 Bacteria 1011
206 Ga0207428_10001433 3300027907 Bacteria 25077
207 Ga0207428_10080117 3300027907 Bacteria 2552
208 Ga0207428_10267061 3300027907 Bacteria 1273
209 Ga0268266_10061492 3300028379 Bacteria 3239
210 Ga0268265_10001375 3300028380 Bacteria 20664
211 Ga0268265_10080520 3300028380 Bacteria 2568
212 Ga0268265_10214351 3300028380 Bacteria 1680
213 Ga0268264_10000293 3300028381 Bacteria 83870
214 Ga0268264_10046118 3300028381 Bacteria 3620
215 Ga0265334_10000009 3300028573 Bacteria 194312
216 Ga0265334_10028966 3300028573 Unclassified 2221
217 Ga0265338_10058804 3300028800 Unclassified 3390
218 Ga0316182_1287656 3300030745 Bacteria 1580
219 Ga0307408_100033286 3300031548 Bacteria 3600
220 Ga0307408_100035659 3300031548 Bacteria 3492
221 Ga0307408_100057493 3300031548 Bacteria 2824
222 Ga0307408_100096448 3300031548 Bacteria 2244
223 Ga0265313_10000764 3300031595 Bacteria 32746
224 Ga0265313_10091646 3300031595 Bacteria 1363
225 Ga0316576_10177414 3300031727 Unclassified 1607
226 Ga0307405_10226450 3300031731 Bacteria 1375
227 Ga0307405_10345401 3300031731 Bacteria 1146
228 Ga0307406_10133809 3300031901 Bacteria 1744
229 Ga0307406_10365953 3300031901 Bacteria 1132
230 Ga0307412_10109501 3300031911 Bacteria 1969
231 Ga0307412_10123716 3300031911 Bacteria 1867
232 Ga0307409_100683247 3300031995 Unclassified 1024
233 Ga0307416_100465322 3300032002 Bacteria 1321
234 Ga0307414_10124782 3300032004 Bacteria 1987
235 Ga0307414_10166975 3300032004 Bacteria 1755
236 Ga0307414_10213784 3300032004 Bacteria 1578
237 Ga0307411_10034399 3300032005 Bacteria 3153
238 Ga0307411_10059894 3300032005 Bacteria 2526
239 Ga0307415_100738819 3300032126 Bacteria 892
240 Ga0373958_0012852 3300034819 Unclassified 1439
241 Ga0316574_0039268 3300035398 Bacteria 2910
242 Ga0316574_0058675 3300035398 Bacteria 2411
243 Ga0316574_0145935 3300035398 Unclassified 1525
244 Ga0373927_0000003 3300035695 Bacteria 480348
245 Ga0395899_0225912 3300037312 Bacteria 1295
246 Ga0395900_0110441 3300037418 Bacteria 2825
247 Ga0395898_0111340 3300037466 Bacteria 2624
248 Ga0439436_0016819 3300041404 Bacteria 2192
249 Ga0439436_0025197 3300041404 Bacteria 1749
250 Ga0439436_0037472 3300041404 Bacteria 1396
251 Ga0439465_0000775 3300041413 Bacteria 9956
252 Ga0439465_0001959 3300041413 Bacteria 6750
253 Ga0439465_0026696 3300041413 Bacteria 1827
254 Ga0451787_162886 3300041441 Bacteria 2086
255 Ga0451789_0831714 3300041443 Bacteria 1855
256 Ga0451791_0059521 3300041451 Bacteria 5861
257 Ga0451795_0506400 3300041456 Bacteria 904
258 Ga0451802_1944768 3300041460 Bacteria 3601
259 Ga0451833_0081663 3300041491 Bacteria 3248
260 Ga0451837_1530162 3300041494 Bacteria 4895
261 Ga0439433_0025579 3300041999 Bacteria 1334
262 Ga0439448_0055773 3300042005 Bacteria 1300
263 Ga0439432_006881 3300042006 Bacteria 4049
264 Ga0439432_023316 3300042006 Bacteria 2039
265 Ga0439449_0001471 3300042007 Bacteria 9227
266 Ga0439449_0002945 3300042007 Bacteria 6624
267 Ga0439449_0005956 3300042007 Bacteria 4657
268 Ga0439449_0006265 3300042007 Bacteria 4549
269 Ga0439449_0006813 3300042007 Bacteria 4359
270 Ga0439454_042818 3300042011 Bacteria 745
271 Ga0439462_0011271 3300042015 Bacteria 2275
272 Ga0451577_0027725 3300042876 Bacteria 5126
273 Ga0466963_0087294 3300044694 Unclassified 2121
274 Ga0451576_0010878 3300045051 Bacteria 10410
275 Ga0495582_0303902 3300046473 Unclassified 917
276 Ga0495632_0012104 3300046519 Unclassified 4992
277 Ga0495656_0002875 3300046615 Bacteria 5768
278 Ga0495670_0173739 3300046691 Bacteria 1135
279 Ga0495636_0000118 3300047318 Bacteria 32623
280 Ga0495636_0020261 3300047318 Bacteria 2679
281 Ga0495636_0020456 3300047318 Bacteria 2667
282 Ga0495687_097723 3300047443 Bacteria 1109
283 Ga0496102_0003801 3300048905 Bacteria 12766
284 Ga0496103_0043747 3300048906 Bacteria 2758
285 Ga0496104_0055561 3300048907 Bacteria 3744
286 Ga0496106_0014465 3300048909 Bacteria 5830
287 Ga0496108_0586775 3300048911 Bacteria 971
288 Ga0496111_0054771 3300048914 Bacteria 2884
289 Ga0496118_0031529 3300048921 Bacteria 4392
290 Ga0496125_0000813 3300048928 Bacteria 50736
291 Ga0496126_0098327 3300048929 Bacteria 2564
292 Ga0501290_001700 3300049513 Bacteria 2947
293 Ga0501299_005296 3300049522 Unclassified 1976
294 Ga0501300_000697 3300049523 Bacteria 5033
295 Ga0501303_016604 3300049526 Bacteria 747
296 Ga0501043_0063870 3300049579 Bacteria 2891
297 Ga0501068_0141116 3300049584 Bacteria 1510
298 Ga0501202_052408 3300049652 Bacteria 906
299 Ga0501249_011580 3300049679 Bacteria 1853
300 Ga0501265_000684 3300049762 Bacteria 3700
301 Ga0501266_002893 3300049763 Unclassified 2141
302 Ga0501275_000043 3300049772 Bacteria 12657
303 nmdc:mga05p37_148607_c1 3300050507 Unclassified 2868
304 nmdc:mga09592_3846_c1 3300050508 Bacteria 12087
305 nmdc:mga0qj67_48925_c1 3300050509 Bacteria 3341
306 nmdc:mga0qj67_79920_c1 3300050509 Bacteria 2619
307 nmdc:mga06r32_236551_c1 3300050510 Unclassified 1814
308 nmdc:mga06r32_391754_c1 3300050510 Bacteria 1372
309 nmdc:mga06r32_8_c1 3300050510 Bacteria 120971
310 nmdc:mga08y16_10318_c1 3300050511 Bacteria 9804
311 nmdc:mga08y16_1386_c1 3300050511 Bacteria 24240
312 nmdc:mga08y16_61850_c1 3300050511 Bacteria 3910
313 nmdc:mga08y16_99779_c1 3300050511 Unclassified 3023
314 nmdc:mga0n895_685581_c1 3300050512 Bacteria 1021
315 Ga0500597_139169 3300053120 Bacteria 1047
316 2572254675 2571042365 Bacteria 3289345
317 2643816644 2643221559 Bacteria 4424915
318 2643880991 2643221573 Bacteria 4784121
319 2643938676 2643221586 Bacteria 4446529
320 2644077580 2643221612 Bacteria 4361984
321 2644530399 2643221695 Bacteria 3441323
322 2644661560 2643221720 Bacteria 4694283
323 2644694105 2643221727 Bacteria 4415595
324 2644699641 2643221728 Bacteria 4797149
325 8003016809 8003014200 Bacteria 4059994
326 Ga0055531_10040094
327 MBSR1b_contig_11054327
328 JGI24750J21931_1021598
329 JGI25151J46595_10020460
330 rootH2_10097781
331 Ga0055524_1015367
332 Ga0055524_1025223
333 Ga0055536_1001866
334 Ga0055534_1007188
335 Ga0055530_10005031
336 Ga0055531_10015676
337 Ga0055531_10020582
338 Ga0055531_10029540
339 Ga0055531_10044392
340 Ga0055531_10045758
341 Ga0065714_10096898
342 Ga0065712_10075743
343 Ga0065715_10098994
344 Ga0070676_10059239
345 Ga0070690_100030709
346 Ga0070670_100004115
347 Ga0070670_100050264
348 Ga0068869_100002081
349 Ga0070666_10012427
350 Ga0070666_10543708
351 Ga0070680_100168911
352 Ga0070689_100035492
353 Ga0070687_100001650
354 Ga0070661_100139667
355 Ga0070661_100344550
356 Ga0070668_100003603
357 Ga0070668_100019852
358 Ga0070669_100059871
359 Ga0070675_100002911
360 Ga0070671_100025507
361 Ga0070674_100616473
362 Ga0070673_100106443
363 Ga0070667_100029333
364 Ga0070667_100146902
365 Ga0070714_100000395
366 Ga0070714_100021904
367 Ga0070713_100337133
368 Ga0070701_10054844
369 Ga0070711_100098734
370 Ga0070705_100060546
371 Ga0070694_100409684
372 Ga0070678_100087911
373 Ga0070678_100467941
374 Ga0070662_100016467
375 Ga0070662_100096680
376 Ga0070681_10427034
377 Ga0068867_100070402
378 Ga0070685_10158780
379 Ga0070679_100596594
380 Ga0070684_100016956
381 Ga0068853_100079908
382 Ga0070672_100172746
383 Ga0070686_100027234
384 Ga0070664_100002473
385 Ga0068857_100512738
386 Ga0068854_100189152
387 Ga0068856_100096589
388 Ga0070702_100003638
389 Ga0068852_100515317
390 Ga0068859_100014440
391 Ga0068859_100069245
392 Ga0068864_100004083
393 Ga0068864_100175036
394 Ga0068866_10336312
395 Ga0068861_100001281
396 Ga0068861_100045077
397 Ga0068870_10067969
398 Ga0068863_100001465
399 Ga0068863_100013531
400 Ga0068858_100019915
401 Ga0068858_100202038
402 Ga0068860_100014496
403 Ga0068860_100018622
404 Ga0068862_100000444
405 Ga0068862_100006783
406 Ga0068862_100059066
407 Ga0068862_101012267
408 Ga0097621_100226265
409 Ga0097621_100231224
410 Ga0068871_100066717
411 Ga0068871_100306052
412 Ga0075428_100000877
413 Ga0075428_100448016
414 Ga0075430_100051178
415 Ga0075430_100097943
416 Ga0075431_100000544
417 Ga0075431_100094131
418 Ga0075431_100132305
419 Ga0075429_100020585
420 Ga0068865_100067756
421 Ga0097620_100014443
422 Ga0097620_100069245
423 Ga0111539_10007604
424 Ga0111539_10020533
425 Ga0111539_10025852
426 Ga0111539_10099765
427 Ga0105247_10150919
428 Ga0114129_10174006
429 Ga0114129_11464936
430 Ga0105243_10020398
431 Ga0105248_10004291
432 Ga0105238_10532374
433 Ga0105249_10001844
434 Ga0105249_10009136
435 Ga0105239_10265502
436 Ga0105239_10315210
437 Ga0157316_1015265
438 Ga0157374_10054875
439 Ga0163162_10058715
440 Ga0163162_10108093
441 Ga0163163_10002210
442 Ga0163163_10499037
443 Ga0163163_10952501
444 Ga0157380_11111480
445 Ga0157377_10004781
446 Ga0157377_10627412
447 Ga0157379_10121093
448 Ga0157376_10097948
449 Ga0209675_1008212
450 Ga0209675_1033019
451 Ga0209676_1000853
452 Ga0209676_1001638
453 Ga0209676_1002245
454 Ga0209676_1005352
455 Ga0209676_1017075
456 Ga0209676_1029451
457 Ga0209025_1006156
458 Ga0209025_1022651
459 Ga0209025_1055602
460 Ga0209564_1014357
461 Ga0209758_1018388
462 Ga0209050_1000652
463 Ga0209050_1015492
464 Ga0209256_1004152
465 Ga0209256_1005109
466 Ga0209256_1011411
467 Ga0209051_1009836
468 Ga0209257_1000378
469 Ga0209257_1002057
470 Ga0209257_1005547
471 Ga0209257_1008474
472 Ga0207642_10146054
473 Ga0207642_10216534
474 Ga0207710_10094984
475 Ga0207688_10072305
476 Ga0207680_10074782
477 Ga0207680_10076497
478 Ga0207645_10076703
479 Ga0207643_10033475
480 Ga0207654_10448286
481 Ga0207654_10511994
482 Ga0207671_10006504
483 Ga0207663_10075147
484 Ga0207662_10003875
485 Ga0207649_10020395
486 Ga0207652_10503072
487 Ga0207681_10020707
488 Ga0207694_10328648
489 Ga0207650_10008769
490 Ga0207650_10113649
491 Ga0207659_10038569
492 Ga0207664_10005638
493 Ga0207644_10036242
494 Ga0207706_10007163
495 Ga0207706_10125423
496 Ga0207670_10032220
497 Ga0207669_10009668
498 Ga0207669_10490161
499 Ga0207704_10032306
500 Ga0207711_10007133
501 Ga0207689_10004165
502 Ga0207679_10022794
503 Ga0207667_10224913
504 Ga0207651_10005488
505 Ga0207712_10010651
506 Ga0207712_10413777
507 Ga0207712_10786435
508 Ga0207668_10094337
509 Ga0207640_10584906
510 Ga0207658_10162345
511 Ga0207658_10195892
512 Ga0207703_10000802
513 Ga0207703_10949566
514 Ga0207639_10087521
515 Ga0207678_10207179
516 Ga0207708_10005652
517 Ga0207702_10033079
518 Ga0207641_10001349
519 Ga0207641_10006148
520 Ga0207641_10720217
521 Ga0207648_10053692
522 Ga0207676_10004261
523 Ga0207676_10056008
524 Ga0207674_10023976
525 Ga0207674_10067681
526 Ga0207675_100006523
527 Ga0207675_100019811
528 Ga0207683_10054487
529 Ga0207683_10401306
530 Ga0207698_10695402
531 Ga0207428_10001433
532 Ga0207428_10080117
533 Ga0207428_10267061
534 Ga0268266_10061492
535 Ga0268265_10001375
536 Ga0268265_10080520
537 Ga0268265_10214351
538 Ga0268264_10000293
539 Ga0268264_10046118
540 Ga0265334_10000009
541 Ga0265334_10028966
542 Ga0265338_10058804
543 Ga0316182_1287656
544 Ga0307408_100033286
545 Ga0307408_100035659
546 Ga0307408_100057493
547 Ga0307408_100096448
548 Ga0265313_10000764
549 Ga0265313_10091646
550 Ga0316576_10177414
551 Ga0307405_10226450
552 Ga0307405_10345401
553 Ga0307406_10133809
554 Ga0307406_10365953
555 Ga0307412_10109501
556 Ga0307412_10123716
557 Ga0307409_100683247
558 Ga0307416_100465322
559 Ga0307414_10124782
560 Ga0307414_10166975
561 Ga0307414_10213784
562 Ga0307411_10034399
563 Ga0307411_10059894
564 Ga0307415_100738819
565 Ga0373958_0012852
566 Ga0316574_0039268
567 Ga0316574_0058675
568 Ga0316574_0145935
569 Ga0373927_0000003
570 Ga0395899_0225912
571 Ga0395900_0110441
572 Ga0395898_0111340
573 Ga0439436_0016819
574 Ga0439436_0025197
575 Ga0439436_0037472
576 Ga0439465_0000775
577 Ga0439465_0001959
578 Ga0439465_0026696
579 Ga0451787_162886
580 Ga0451789_0831714
581 Ga0451791_0059521
582 Ga0451795_0506400
583 Ga0451802_1944768
584 Ga0451833_0081663
585 Ga0451837_1530162
586 Ga0439433_0025579
587 Ga0439448_0055773
588 Ga0439432_006881
589 Ga0439432_023316
590 Ga0439449_0001471
591 Ga0439449_0002945
592 Ga0439449_0005956
593 Ga0439449_0006265
594 Ga0439449_0006813
595 Ga0439454_042818
596 Ga0439462_0011271
597 Ga0451577_0027725
598 Ga0466963_0087294
599 Ga0451576_0010878
600 Ga0495582_0303902
601 Ga0495632_0012104
602 Ga0495656_0002875
603 Ga0495670_0173739
604 Ga0495636_0000118
605 Ga0495636_0020261
606 Ga0495636_0020456
607 Ga0495687_097723
608 Ga0496102_0003801
609 Ga0496103_0043747
610 Ga0496104_0055561
611 Ga0496106_0014465
612 Ga0496108_0586775
613 Ga0496111_0054771
614 Ga0496118_0031529
615 Ga0496125_0000813
616 Ga0496126_0098327
617 Ga0501290_001700
618 Ga0501299_005296
619 Ga0501300_000697
620 Ga0501303_016604
621 Ga0501043_0063870
622 Ga0501068_0141116
623 Ga0501202_052408
624 Ga0501249_011580
625 Ga0501265_000684
626 Ga0501266_002893
627 Ga0501275_000043
628 nmdc:mga05p37_148607_c1
629 nmdc:mga09592_3846_c1
630 nmdc:mga0qj67_48925_c1
631 nmdc:mga0qj67_79920_c1
632 nmdc:mga06r32_236551_c1
633 nmdc:mga06r32_391754_c1
634 nmdc:mga06r32_8_c1
635 nmdc:mga08y16_10318_c1
636 nmdc:mga08y16_1386_c1
637 nmdc:mga08y16_61850_c1
638 nmdc:mga08y16_99779_c1
639 nmdc:mga0n895_685581_c1
640 Ga0500597_139169
641 2572254675
642 2643816644
643 2643880991
644 2643938676
645 2644077580
646 2644530399
647 2644661560
648 2644694105
649 2644699641
650 8003016809

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13759

2OG-FeII_Oxy_5

Putative 2OG-Fe(II) oxygenase

136

243

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zbe-assembly1.cif.gz_A crystal structure of aere from microcystis aeruginosa 0.8329 101 207
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.7748 102 205
3bvc-assembly1.cif.gz_A crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism 0.7662 4 206
6l9i-assembly1.cif.gz_A crystal structure of lactobacillus farciminis oxalate decarboxylase formate complex 0.7557 102 216
3bvc-assembly1.cif.gz_A crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism 0.7532 4 206
ID Description Score Start End Superfamily
af_A0A0R0I0F2_21_185_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8353 104 203 2.60.120.10
af_Q59013_3_123_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8199 102 207 2.60.120.10
af_A0A0R0EIG9_21_186_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7555 102 214 2.60.120.10
2vqaB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7543 102 205 2.60.120.10
4b29A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7495 102 204 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1I5AMK1-F1-model_v4 2OG-Fe(II) oxygenase superfamily protein 0.9785 1 210
AF-A0A7W3TKN5-F1-model_v4 JmjC domain-containing protein 0.9774 1 213
AF-A0A355VDF0-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.968 1 210
AF-A0A521HMS0-F1-model_v4 JmjC domain-containing protein 0.9664 1 212
AF-A0A368NI42-F1-model_v4 JmjC domain-containing protein 0.9663 2 209

Map