F407653
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 190 | 325 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300005290|Ga0065712_10092038|Ga0065712_100920383 |
| Length | 111 |
| Sequence | MGKTSDQLQGTLELLVLRTLASAGEQLHGFGIAERIKQVSAEALRVEEGSLYPALHRMNEEGWVLSEWGTSDNNRRARFYKITTKGRRRLTQLERDWARHVAAVKRVIRHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 143 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 146 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 147 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 148 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 149 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 150 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 151 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 152 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 153 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 154 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 155 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 156 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 172 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 174 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 175 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 176 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 177 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 178 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 179 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 180 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 189 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.38 |
| Nodule | 0 |
| Rhizoplane | 1.54 |
| Rhizosphere | 91.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10490451 | 3300005289 | Unclassified | 675 |
| 2 | Ga0065712_10092038 | 3300005290 | Unclassified | 2347 |
| 3 | Ga0065715_10090207 | 3300005293 | Bacteria | 7448 |
| 4 | Ga0065707_10168805 | 3300005295 | Bacteria | 1500 |
| 5 | Ga0065707_10357715 | 3300005295 | Unclassified | 909 |
| 6 | Ga0070683_100575554 | 3300005329 | Bacteria | 1077 |
| 7 | Ga0070690_100079140 | 3300005330 | Bacteria | 2149 |
| 8 | Ga0070670_101768700 | 3300005331 | Unclassified | 569 |
| 9 | Ga0068869_101294548 | 3300005334 | Unclassified | 643 |
| 10 | Ga0070666_11337578 | 3300005335 | Unclassified | 535 |
| 11 | Ga0070680_100069562 | 3300005336 | Bacteria | 2891 |
| 12 | Ga0070680_100286607 | 3300005336 | Bacteria | 1396 |
| 13 | Ga0070680_101630859 | 3300005336 | Unclassified | 559 |
| 14 | Ga0070682_100457410 | 3300005337 | Unclassified | 979 |
| 15 | Ga0068868_100005475 | 3300005338 | Bacteria | 8929 |
| 16 | Ga0070660_100933474 | 3300005339 | Unclassified | 732 |
| 17 | Ga0070689_100007239 | 3300005340 | Bacteria | 7737 |
| 18 | Ga0070689_100748695 | 3300005340 | Unclassified | 856 |
| 19 | Ga0070689_101226546 | 3300005340 | Bacteria | 674 |
| 20 | Ga0070691_10078565 | 3300005341 | Bacteria | 1612 |
| 21 | Ga0070691_10181347 | 3300005341 | Unclassified | 1096 |
| 22 | Ga0070687_100023195 | 3300005343 | Bacteria | 2946 |
| 23 | Ga0070661_101011063 | 3300005344 | Unclassified | 690 |
| 24 | Ga0070692_10117361 | 3300005345 | Unclassified | 1479 |
| 25 | Ga0070692_10442706 | 3300005345 | Unclassified | 830 |
| 26 | Ga0070668_100224546 | 3300005347 | Unclassified | 1550 |
| 27 | Ga0070668_100306304 | 3300005347 | Bacteria | 1334 |
| 28 | Ga0070669_100074777 | 3300005353 | Unclassified | 2511 |
| 29 | Ga0070669_100515138 | 3300005353 | Bacteria | 994 |
| 30 | Ga0070675_100214582 | 3300005354 | Bacteria | 1674 |
| 31 | Ga0070671_100363473 | 3300005355 | Bacteria | 1236 |
| 32 | Ga0070674_101124326 | 3300005356 | Bacteria | 695 |
| 33 | Ga0070673_100256637 | 3300005364 | Bacteria | 1526 |
| 34 | Ga0070667_100123647 | 3300005367 | Bacteria | 2253 |
| 35 | Ga0070703_10236175 | 3300005406 | Bacteria | 735 |
| 36 | Ga0070714_100153550 | 3300005435 | Bacteria | 2077 |
| 37 | Ga0070713_100005821 | 3300005436 | Bacteria | 8475 |
| 38 | Ga0070701_10003976 | 3300005438 | Bacteria | 5916 |
| 39 | Ga0070701_10019457 | 3300005438 | Bacteria | 3207 |
| 40 | Ga0070701_10350485 | 3300005438 | Bacteria | 922 |
| 41 | Ga0070711_100035506 | 3300005439 | Bacteria | 3334 |
| 42 | Ga0070705_100457155 | 3300005440 | Bacteria | 959 |
| 43 | Ga0070705_100537113 | 3300005440 | Bacteria | 894 |
| 44 | Ga0070705_101454668 | 3300005440 | Unclassified | 573 |
| 45 | Ga0070700_100039258 | 3300005441 | Bacteria | 2891 |
| 46 | Ga0070700_101233839 | 3300005441 | Bacteria | 626 |
| 47 | Ga0070694_100031952 | 3300005444 | Bacteria | 3454 |
| 48 | Ga0070694_100290869 | 3300005444 | Bacteria | 1249 |
| 49 | Ga0070694_100516028 | 3300005444 | Unclassified | 953 |
| 50 | Ga0070663_100023020 | 3300005455 | Bacteria | 4171 |
| 51 | Ga0070678_100256044 | 3300005456 | Bacteria | 1470 |
| 52 | Ga0070678_101351446 | 3300005456 | Unclassified | 664 |
| 53 | Ga0070662_100377207 | 3300005457 | Unclassified | 1167 |
| 54 | Ga0070662_100652695 | 3300005457 | Bacteria | 888 |
| 55 | Ga0070662_100663708 | 3300005457 | Bacteria | 880 |
| 56 | Ga0070685_10147936 | 3300005466 | Unclassified | 1486 |
| 57 | Ga0070695_100109638 | 3300005545 | Bacteria | 1871 |
| 58 | Ga0070695_100180347 | 3300005545 | Bacteria | 1496 |
| 59 | Ga0070695_100390265 | 3300005545 | Bacteria | 1053 |
| 60 | Ga0070665_100521516 | 3300005548 | Bacteria | 1200 |
| 61 | Ga0070704_100043391 | 3300005549 | Unclassified | 3117 |
| 62 | Ga0070704_100065952 | 3300005549 | Bacteria | 2608 |
| 63 | Ga0070704_102226609 | 3300005549 | Bacteria | 510 |
| 64 | Ga0070664_100188316 | 3300005564 | Bacteria | 1838 |
| 65 | Ga0068854_100129228 | 3300005578 | Bacteria | 1927 |
| 66 | Ga0068854_100599021 | 3300005578 | Bacteria | 941 |
| 67 | Ga0070702_100040356 | 3300005615 | Bacteria | 2611 |
| 68 | Ga0068852_101456109 | 3300005616 | Bacteria | 707 |
| 69 | Ga0068859_100093046 | 3300005617 | Bacteria | 3066 |
| 70 | Ga0068859_100164185 | 3300005617 | Bacteria | 2300 |
| 71 | Ga0068859_100333654 | 3300005617 | Unclassified | 1611 |
| 72 | Ga0068859_100788886 | 3300005617 | Bacteria | 1038 |
| 73 | Ga0068864_100099465 | 3300005618 | Unclassified | 2576 |
| 74 | Ga0068866_10101681 | 3300005718 | Unclassified | 1587 |
| 75 | Ga0068861_100033475 | 3300005719 | Bacteria | 3791 |
| 76 | Ga0068861_100133501 | 3300005719 | Bacteria | 2018 |
| 77 | Ga0068861_100362115 | 3300005719 | Unclassified | 1276 |
| 78 | Ga0068861_100463844 | 3300005719 | Bacteria | 1138 |
| 79 | Ga0068870_10960968 | 3300005840 | Unclassified | 607 |
| 80 | Ga0068863_100013847 | 3300005841 | Bacteria | 7773 |
| 81 | Ga0068863_100345519 | 3300005841 | Bacteria | 1448 |
| 82 | Ga0068858_100003464 | 3300005842 | Bacteria | 15641 |
| 83 | Ga0068860_100005271 | 3300005843 | Bacteria | 13123 |
| 84 | Ga0068862_100037276 | 3300005844 | Bacteria | 4121 |
| 85 | Ga0068862_100099448 | 3300005844 | Bacteria | 2542 |
| 86 | Ga0068862_100143238 | 3300005844 | Bacteria | 2122 |
| 87 | Ga0068862_100411710 | 3300005844 | Bacteria | 1267 |
| 88 | Ga0081540_1125321 | 3300005983 | Bacteria | 1058 |
| 89 | Ga0070717_10046244 | 3300006028 | Bacteria | 3561 |
| 90 | Ga0075368_10014521 | 3300006042 | Bacteria | 2910 |
| 91 | Ga0075368_10132716 | 3300006042 | Bacteria | 1035 |
| 92 | Ga0075363_100392447 | 3300006048 | Unclassified | 815 |
| 93 | Ga0075364_10032384 | 3300006051 | Bacteria | 3360 |
| 94 | Ga0075364_10065079 | 3300006051 | Bacteria | 2393 |
| 95 | Ga0075367_10001342 | 3300006178 | Bacteria | 10450 |
| 96 | Ga0075367_10038767 | 3300006178 | Bacteria | 2775 |
| 97 | Ga0075367_10113834 | 3300006178 | Bacteria | 1663 |
| 98 | Ga0075366_10002873 | 3300006195 | Bacteria | 8930 |
| 99 | Ga0075366_10047631 | 3300006195 | Bacteria | 2541 |
| 100 | Ga0075366_10275724 | 3300006195 | Bacteria | 1027 |
| 101 | Ga0075370_10039615 | 3300006353 | Bacteria | 2656 |
| 102 | Ga0075370_10210625 | 3300006353 | Unclassified | 1147 |
| 103 | Ga0068871_100030055 | 3300006358 | Bacteria | 4274 |
| 104 | Ga0075428_100020131 | 3300006844 | Bacteria | 7389 |
| 105 | Ga0075428_100052572 | 3300006844 | Bacteria | 4464 |
| 106 | Ga0075430_100029418 | 3300006846 | Bacteria | 4662 |
| 107 | Ga0075430_100153833 | 3300006846 | Bacteria | 1915 |
| 108 | Ga0075430_100520032 | 3300006846 | Bacteria | 982 |
| 109 | Ga0075430_101004870 | 3300006846 | Unclassified | 687 |
| 110 | Ga0075431_100166518 | 3300006847 | Bacteria | 2266 |
| 111 | Ga0075431_100254020 | 3300006847 | Bacteria | 1785 |
| 112 | Ga0075433_10406339 | 3300006852 | Bacteria | 1201 |
| 113 | Ga0075434_100069124 | 3300006871 | Bacteria | 3520 |
| 114 | Ga0075434_100847940 | 3300006871 | Bacteria | 929 |
| 115 | Ga0075434_101168159 | 3300006871 | Bacteria | 782 |
| 116 | Ga0075429_100020517 | 3300006880 | Bacteria | 5734 |
| 117 | Ga0068865_100070503 | 3300006881 | Bacteria | 2476 |
| 118 | Ga0097620_100093050 | 3300006931 | Bacteria | 3066 |
| 119 | Ga0097620_100164183 | 3300006931 | Bacteria | 2300 |
| 120 | Ga0097620_100333667 | 3300006931 | Unclassified | 1611 |
| 121 | Ga0097620_100788680 | 3300006931 | Bacteria | 1038 |
| 122 | Ga0075435_100001769 | 3300007076 | Bacteria | 14065 |
| 123 | Ga0075435_101019258 | 3300007076 | Bacteria | 723 |
| 124 | Ga0105240_10210021 | 3300009093 | Bacteria | 2275 |
| 125 | Ga0111539_10000854 | 3300009094 | Bacteria | 39754 |
| 126 | Ga0111539_10137585 | 3300009094 | Bacteria | 2860 |
| 127 | Ga0111539_10167829 | 3300009094 | Bacteria | 2565 |
| 128 | Ga0105245_10252040 | 3300009098 | Bacteria | 1715 |
| 129 | Ga0105247_11216362 | 3300009101 | Bacteria | 601 |
| 130 | Ga0105247_11444875 | 3300009101 | Unclassified | 558 |
| 131 | Ga0114129_10077910 | 3300009147 | Bacteria | 4610 |
| 132 | Ga0114129_10172409 | 3300009147 | Bacteria | 2948 |
| 133 | Ga0114129_10179508 | 3300009147 | Unclassified | 2882 |
| 134 | Ga0105243_10063658 | 3300009148 | Bacteria | 2956 |
| 135 | Ga0105243_10404495 | 3300009148 | Bacteria | 1269 |
| 136 | Ga0105243_10757970 | 3300009148 | Bacteria | 952 |
| 137 | Ga0105248_10097791 | 3300009177 | Bacteria | 3307 |
| 138 | Ga0105248_10100982 | 3300009177 | Unclassified | 3251 |
| 139 | Ga0105248_10644802 | 3300009177 | Unclassified | 1195 |
| 140 | Ga0105237_10385517 | 3300009545 | Bacteria | 1406 |
| 141 | Ga0105238_12162732 | 3300009551 | Unclassified | 591 |
| 142 | Ga0105249_10027848 | 3300009553 | Bacteria | 5100 |
| 143 | Ga0105249_10368975 | 3300009553 | Bacteria | 1458 |
| 144 | Ga0105249_10845080 | 3300009553 | Bacteria | 981 |
| 145 | Ga0105249_10909362 | 3300009553 | Bacteria | 947 |
| 146 | Ga0105239_10104901 | 3300010375 | Bacteria | 3130 |
| 147 | Ga0105239_10344434 | 3300010375 | Bacteria | 1682 |
| 148 | Ga0105246_11090170 | 3300011119 | Bacteria | 728 |
| 149 | Ga0157343_1038894 | 3300012488 | Unclassified | 510 |
| 150 | Ga0157370_10035515 | 3300013104 | Bacteria | 4843 |
| 151 | Ga0157370_11189515 | 3300013104 | Bacteria | 688 |
| 152 | Ga0163162_11947155 | 3300013306 | Unclassified | 673 |
| 153 | Ga0157375_10133285 | 3300013308 | Bacteria | 2606 |
| 154 | Ga0163163_10291047 | 3300014325 | Bacteria | 1685 |
| 155 | Ga0157380_10435444 | 3300014326 | Bacteria | 1255 |
| 156 | Ga0157380_11819157 | 3300014326 | Bacteria | 668 |
| 157 | Ga0157380_12134866 | 3300014326 | Bacteria | 623 |
| 158 | Ga0157377_10009090 | 3300014745 | Bacteria | 4868 |
| 159 | Ga0157377_10780369 | 3300014745 | Unclassified | 702 |
| 160 | Ga0163161_10329049 | 3300017792 | Unclassified | 1210 |
| 161 | Ga0163161_11939003 | 3300017792 | Bacteria | 524 |
| 162 | Ga0207642_10036863 | 3300025899 | Bacteria | 2102 |
| 163 | Ga0207645_10102971 | 3300025907 | Bacteria | 1843 |
| 164 | Ga0207671_10542889 | 3300025914 | Bacteria | 927 |
| 165 | Ga0207671_10631290 | 3300025914 | Unclassified | 853 |
| 166 | Ga0207693_10114627 | 3300025915 | Bacteria | 2115 |
| 167 | Ga0207663_10009612 | 3300025916 | Bacteria | 5118 |
| 168 | Ga0207660_10076770 | 3300025917 | Unclassified | 2443 |
| 169 | Ga0207660_10644480 | 3300025917 | Unclassified | 864 |
| 170 | Ga0207660_11284184 | 3300025917 | Unclassified | 595 |
| 171 | Ga0207657_10479862 | 3300025919 | Unclassified | 975 |
| 172 | Ga0207649_10754381 | 3300025920 | Unclassified | 757 |
| 173 | Ga0207681_10018009 | 3300025923 | Bacteria | 4444 |
| 174 | Ga0207681_10610852 | 3300025923 | Bacteria | 902 |
| 175 | Ga0207694_11042546 | 3300025924 | Unclassified | 692 |
| 176 | Ga0207650_11312157 | 3300025925 | Unclassified | 616 |
| 177 | Ga0207687_10185384 | 3300025927 | Bacteria | 1615 |
| 178 | Ga0207700_10179390 | 3300025928 | Bacteria | 1772 |
| 179 | Ga0207664_10069421 | 3300025929 | Bacteria | 2833 |
| 180 | Ga0207644_10090311 | 3300025931 | Bacteria | 2282 |
| 181 | Ga0207644_10124031 | 3300025931 | Unclassified | 1970 |
| 182 | Ga0207706_10493243 | 3300025933 | Bacteria | 1058 |
| 183 | Ga0207706_10582658 | 3300025933 | Bacteria | 962 |
| 184 | Ga0207706_10601673 | 3300025933 | Bacteria | 944 |
| 185 | Ga0207709_10257806 | 3300025935 | Bacteria | 1277 |
| 186 | Ga0207709_11141821 | 3300025935 | Bacteria | 641 |
| 187 | Ga0207670_10017734 | 3300025936 | Bacteria | 4309 |
| 188 | Ga0207670_10250046 | 3300025936 | Bacteria | 1370 |
| 189 | Ga0207669_11139627 | 3300025937 | Bacteria | 659 |
| 190 | Ga0207704_10147351 | 3300025938 | Bacteria | 1656 |
| 191 | Ga0207704_10153516 | 3300025938 | Unclassified | 1628 |
| 192 | Ga0207704_10434510 | 3300025938 | Unclassified | 1044 |
| 193 | Ga0207691_10005638 | 3300025940 | Bacteria | 12104 |
| 194 | Ga0207711_10075502 | 3300025941 | Unclassified | 2933 |
| 195 | Ga0207711_10682171 | 3300025941 | Bacteria | 958 |
| 196 | Ga0207689_10070338 | 3300025942 | Bacteria | 2875 |
| 197 | Ga0207689_10431546 | 3300025942 | Unclassified | 1100 |
| 198 | Ga0207689_10943898 | 3300025942 | Bacteria | 728 |
| 199 | Ga0207661_10515130 | 3300025944 | Bacteria | 1094 |
| 200 | Ga0207651_10439912 | 3300025960 | Bacteria | 1117 |
| 201 | Ga0207651_11763352 | 3300025960 | Unclassified | 557 |
| 202 | Ga0207712_10729806 | 3300025961 | Bacteria | 866 |
| 203 | Ga0207668_10030717 | 3300025972 | Bacteria | 3533 |
| 204 | Ga0207668_10096314 | 3300025972 | Bacteria | 2187 |
| 205 | Ga0207668_10789714 | 3300025972 | Bacteria | 840 |
| 206 | Ga0207640_10327192 | 3300025981 | Bacteria | 1222 |
| 207 | Ga0207658_10827593 | 3300025986 | Bacteria | 841 |
| 208 | Ga0207677_10202694 | 3300026023 | Unclassified | 1578 |
| 209 | Ga0207703_10117761 | 3300026035 | Bacteria | 2276 |
| 210 | Ga0207639_12106678 | 3300026041 | Bacteria | 525 |
| 211 | Ga0207678_10128477 | 3300026067 | Unclassified | 2161 |
| 212 | Ga0207708_10015003 | 3300026075 | Bacteria | 5807 |
| 213 | Ga0207708_11170943 | 3300026075 | Bacteria | 672 |
| 214 | Ga0207641_10071937 | 3300026088 | Bacteria | 2977 |
| 215 | Ga0207641_10298560 | 3300026088 | Bacteria | 1521 |
| 216 | Ga0207648_10006472 | 3300026089 | Bacteria | 11633 |
| 217 | Ga0207648_11332141 | 3300026089 | Unclassified | 675 |
| 218 | Ga0207676_10470821 | 3300026095 | Bacteria | 1188 |
| 219 | Ga0207676_11086849 | 3300026095 | Bacteria | 790 |
| 220 | Ga0207676_11096656 | 3300026095 | Unclassified | 787 |
| 221 | Ga0207674_11842928 | 3300026116 | Bacteria | 572 |
| 222 | Ga0207675_100010699 | 3300026118 | Bacteria | 8592 |
| 223 | Ga0207675_100036266 | 3300026118 | Bacteria | 4600 |
| 224 | Ga0207675_100063645 | 3300026118 | Bacteria | 3446 |
| 225 | Ga0207675_100122169 | 3300026118 | Unclassified | 2465 |
| 226 | Ga0207675_100151033 | 3300026118 | Bacteria | 2211 |
| 227 | Ga0207675_100228535 | 3300026118 | Bacteria | 1794 |
| 228 | Ga0207698_10091274 | 3300026142 | Bacteria | 2493 |
| 229 | Ga0209813_10062357 | 3300027866 | Bacteria | 1193 |
| 230 | Ga0209813_10072320 | 3300027866 | Unclassified | 1124 |
| 231 | Ga0209974_10191499 | 3300027876 | Unclassified | 752 |
| 232 | Ga0207428_10001768 | 3300027907 | Bacteria | 22154 |
| 233 | Ga0268266_11297208 | 3300028379 | Unclassified | 703 |
| 234 | Ga0268265_10098311 | 3300028380 | Unclassified | 2357 |
| 235 | Ga0268265_10120402 | 3300028380 | Unclassified | 2161 |
| 236 | Ga0268265_10508216 | 3300028380 | Bacteria | 1137 |
| 237 | Ga0268264_10140743 | 3300028381 | Bacteria | 2151 |
| 238 | Ga0268264_10300697 | 3300028381 | Bacteria | 1510 |
| 239 | Ga0265316_10883454 | 3300031344 | Bacteria | 625 |
| 240 | Ga0265314_10009776 | 3300031711 | Bacteria | 8058 |
| 241 | Ga0307412_10976825 | 3300031911 | Bacteria | 747 |
| 242 | Ga0307416_101682910 | 3300032002 | Bacteria | 739 |
| 243 | Ga0307411_10270586 | 3300032005 | Bacteria | 1347 |
| 244 | Ga0307411_10459942 | 3300032005 | Bacteria | 1067 |
| 245 | Ga0373940_0031472 | 3300035088 | Unclassified | 1417 |
| 246 | Ga0373941_0177313 | 3300035115 | Bacteria | 798 |
| 247 | Ga0373927_0004292 | 3300035695 | Bacteria | 10006 |
| 248 | Ga0373927_0494295 | 3300035695 | Bacteria | 808 |
| 249 | Ga0373947_0217917 | 3300035725 | Bacteria | 1254 |
| 250 | Ga0373947_0365027 | 3300035725 | Unclassified | 970 |
| 251 | Ga0395900_0291323 | 3300037418 | Unclassified | 1621 |
| 252 | Ga0395900_0349719 | 3300037418 | Unclassified | 1452 |
| 253 | Ga0395900_0500370 | 3300037418 | Bacteria | 1166 |
| 254 | Ga0395900_1833182 | 3300037418 | Unclassified | 517 |
| 255 | Ga0395901_1000830 | 3300038443 | Unclassified | 812 |
| 256 | Ga0436361_1105276 | 3300039447 | Bacteria | 3284 |
| 257 | Ga0439453_0071760 | 3300041408 | Bacteria | 734 |
| 258 | Ga0439452_110930 | 3300042010 | Bacteria | 586 |
| 259 | Ga0450908_002047 | 3300042184 | Bacteria | 3938 |
| 260 | Ga0439434_0270915 | 3300042435 | Bacteria | 583 |
| 261 | Ga0439435_0037481 | 3300042436 | Unclassified | 1343 |
| 262 | Ga0439460_0054364 | 3300042461 | Bacteria | 1208 |
| 263 | Ga0439440_0204360 | 3300042993 | Bacteria | 587 |
| 264 | Ga0451576_0269218 | 3300045051 | Unclassified | 1781 |
| 265 | Ga0451576_0508143 | 3300045051 | Bacteria | 1266 |
| 266 | Ga0466967_1623312 | 3300045976 | Unclassified | 644 |
| 267 | Ga0495580_0055119 | 3300046472 | Bacteria | 2802 |
| 268 | Ga0495580_0353082 | 3300046472 | Unclassified | 996 |
| 269 | Ga0495656_0227514 | 3300046615 | Bacteria | 935 |
| 270 | Ga0496106_0975077 | 3300048909 | Unclassified | 667 |
| 271 | Ga0496106_1017692 | 3300048909 | Unclassified | 651 |
| 272 | Ga0496108_0282156 | 3300048911 | Bacteria | 1446 |
| 273 | Ga0496110_0431436 | 3300048913 | Unclassified | 1201 |
| 274 | Ga0496113_0551030 | 3300048916 | Bacteria | 925 |
| 275 | Ga0501036_0786693 | 3300049572 | Unclassified | 784 |
| 276 | Ga0501042_0518901 | 3300049578 | Bacteria | 865 |
| 277 | Ga0501042_1193940 | 3300049578 | Unclassified | 555 |
| 278 | Ga0501071_0188955 | 3300049587 | Bacteria | 1544 |
| 279 | Ga0501071_0691906 | 3300049587 | Bacteria | 785 |
| 280 | Ga0501071_1040064 | 3300049587 | Unclassified | 633 |
| 281 | Ga0501072_0024885 | 3300049588 | Bacteria | 4661 |
| 282 | Ga0501075_0052679 | 3300049591 | Bacteria | 3060 |
| 283 | Ga0501076_0614654 | 3300049592 | Bacteria | 897 |
| 284 | Ga0501251_084514 | 3300049681 | Unclassified | 561 |
| 285 | Ga0501079_0877802 | 3300049741 | Bacteria | 706 |
| 286 | Ga0501283_000914 | 3300049779 | Bacteria | 3918 |
| 287 | nmdc:mga03n38_396589_c1 | 3300050490 | Unclassified | 759 |
| 288 | nmdc:mga00v17_411344_c1 | 3300050491 | Bacteria | 879 |
| 289 | nmdc:mga0k408_172428_c1 | 3300050493 | Bacteria | 1290 |
| 290 | nmdc:mga0k408_1878_c1 | 3300050493 | Bacteria | 11264 |
| 291 | nmdc:mga06z11_46000_c1 | 3300050494 | Bacteria | 2209 |
| 292 | nmdc:mga04h51_30050_c1 | 3300050495 | Unclassified | 1707 |
| 293 | nmdc:mga07m45_10097_c1 | 3300050496 | Bacteria | 4919 |
| 294 | nmdc:mga07m45_167504_c1 | 3300050496 | Bacteria | 1276 |
| 295 | nmdc:mga05p37_116359_c1 | 3300050507 | Unclassified | 3285 |
| 296 | nmdc:mga05p37_148962_c1 | 3300050507 | Bacteria | 2864 |
| 297 | nmdc:mga05p37_1596409_c1 | 3300050507 | Bacteria | 643 |
| 298 | nmdc:mga09592_116310_c1 | 3300050508 | Bacteria | 2295 |
| 299 | nmdc:mga09592_1377215_c1 | 3300050508 | Archaea | 577 |
| 300 | nmdc:mga09592_168279_c1 | 3300050508 | Bacteria | 1895 |
| 301 | nmdc:mga0qj67_1119539_c1 | 3300050509 | Bacteria | 614 |
| 302 | nmdc:mga0qj67_126717_c1 | 3300050509 | Bacteria | 2066 |
| 303 | nmdc:mga0qj67_14590_c1 | 3300050509 | Bacteria | 5940 |
| 304 | nmdc:mga0qj67_580315_c1 | 3300050509 | Bacteria | 898 |
| 305 | nmdc:mga0qj67_782925_c1 | 3300050509 | Unclassified | 756 |
| 306 | nmdc:mga06r32_12967_c1 | 3300050510 | Bacteria | 4328 |
| 307 | nmdc:mga06r32_142495_c1 | 3300050510 | Bacteria | 2374 |
| 308 | nmdc:mga06r32_226784_c1 | 3300050510 | Bacteria | 1856 |
| 309 | nmdc:mga06r32_421598_c1 | 3300050510 | Unclassified | 1316 |
| 310 | nmdc:mga06r32_623912_c1 | 3300050510 | Bacteria | 1048 |
| 311 | nmdc:mga08y16_21812_c1 | 3300050511 | Bacteria | 6758 |
| 312 | nmdc:mga08y16_5690_c1 | 3300050511 | Bacteria | 13060 |
| 313 | nmdc:mga0n895_1003448_c1 | 3300050512 | Bacteria | 816 |
| 314 | nmdc:mga0n895_933570_c1 | 3300050512 | Bacteria | 852 |
| 315 | nmdc:mga0rr50_1380_c1 | 3300050513 | Bacteria | 13302 |
| 316 | nmdc:mga0rr50_1434612_c1 | 3300050513 | Bacteria | 584 |
| 317 | nmdc:mga0rr50_28501_c1 | 3300050513 | Bacteria | 3926 |
| 318 | nmdc:mga0a205_183833_c1 | 3300050515 | Unclassified | 1984 |
| 319 | nmdc:mga0a205_19417_c1 | 3300050515 | Bacteria | 6406 |
| 320 | nmdc:mga0sz30_563233_c1 | 3300050516 | Unclassified | 514 |
| 321 | Ga0501084_0369591 | 3300054114 | Bacteria | 1212 |
| 322 | Ga0501084_0829890 | 3300054114 | Bacteria | 778 |
| 323 | Ga0501084_0886058 | 3300054114 | Bacteria | 751 |
| 324 | Ga0501084_1766063 | 3300054114 | Unclassified | 517 |
| 325 | Ga0590071_069016 | 3300059421 | Bacteria | 870 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300012488 | Ga0157343_1038894 | Ga0157343_10388942 | 102 |
| 2 | 3300037418 | Ga0395900_0500370 | Ga0395900_0500370_721_1038 | 105 |
| 3 | 3300038443 | Ga0395901_1000830 | Ga0395901_1000830_183_500 | 105 |
| 4 | 3300005290 | Ga0065712_10092038 | Ga0065712_100920383 | 108 |
| 5 | 3300005293 | Ga0065715_10090207 | Ga0065715_100902079 | 108 |
| 6 | 3300005295 | Ga0065707_10168805 | Ga0065707_101688052 | 108 |
| 7 | 3300005334 | Ga0068869_101294548 | Ga0068869_1012945481 | 108 |
| 8 | 3300005340 | Ga0070689_100748695 | Ga0070689_1007486952 | 108 |
| 9 | 3300005354 | Ga0070675_100214582 | Ga0070675_1002145822 | 108 |
| 10 | 3300005440 | Ga0070705_100457155 | Ga0070705_1004571552 | 108 |
| 11 | 3300005441 | Ga0070700_101233839 | Ga0070700_1012338392 | 108 |
| 12 | 3300005444 | Ga0070694_100031952 | Ga0070694_1000319524 | 108 |
| 13 | 3300005457 | Ga0070662_100663708 | Ga0070662_1006637081 | 108 |
| 14 | 3300005545 | Ga0070695_100390265 | Ga0070695_1003902653 | 108 |
| 15 | 3300005549 | Ga0070704_100065952 | Ga0070704_1000659523 | 108 |
| 16 | 3300005578 | Ga0068854_100129228 | Ga0068854_1001292283 | 108 |
| 17 | 3300005617 | Ga0068859_100333654 | Ga0068859_1003336543 | 108 |
| 18 | 3300006931 | Ga0097620_100333667 | Ga0097620_1003336671 | 108 |
| 19 | 3300009553 | Ga0105249_10909362 | Ga0105249_109093622 | 108 |
| 20 | 3300025960 | Ga0207651_10439912 | Ga0207651_104399122 | 108 |
| 21 | 3300025961 | Ga0207712_10729806 | Ga0207712_107298062 | 108 |
| 22 | 3300025981 | Ga0207640_10327192 | Ga0207640_103271922 | 108 |
| 23 | 3300026075 | Ga0207708_11170943 | Ga0207708_111709431 | 108 |
| 24 | 3300026118 | Ga0207675_100122169 | Ga0207675_1001221693 | 108 |
| 25 | 3300037418 | Ga0395900_1833182 | Ga0395900_1833182_34_369 | 108 |
| 26 | 3300005335 | Ga0070666_11337578 | Ga0070666_113375781 | 109 |
| 27 | 3300005336 | Ga0070680_100286607 | Ga0070680_1002866072 | 109 |
| 28 | 3300005339 | Ga0070660_100933474 | Ga0070660_1009334741 | 109 |
| 29 | 3300005341 | Ga0070691_10181347 | Ga0070691_101813471 | 109 |
| 30 | 3300005356 | Ga0070674_101124326 | Ga0070674_1011243261 | 109 |
| 31 | 3300005406 | Ga0070703_10236175 | Ga0070703_102361751 | 109 |
| 32 | 3300005440 | Ga0070705_101454668 | Ga0070705_1014546681 | 109 |
| 33 | 3300005444 | Ga0070694_100516028 | Ga0070694_1005160282 | 109 |
| 34 | 3300005457 | Ga0070662_100652695 | Ga0070662_1006526952 | 109 |
| 35 | 3300005564 | Ga0070664_100188316 | Ga0070664_1001883162 | 109 |
| 36 | 3300005617 | Ga0068859_100093046 | Ga0068859_1000930462 | 109 |
| 37 | 3300005718 | Ga0068866_10101681 | Ga0068866_101016812 | 109 |
| 38 | 3300005719 | Ga0068861_100033475 | Ga0068861_1000334752 | 109 |
| 39 | 3300005719 | Ga0068861_100463844 | Ga0068861_1004638442 | 109 |
| 40 | 3300005840 | Ga0068870_10960968 | Ga0068870_109609682 | 109 |
| 41 | 3300005841 | Ga0068863_100013847 | Ga0068863_1000138473 | 109 |
| 42 | 3300005842 | Ga0068858_100003464 | Ga0068858_1000034642 | 109 |
| 43 | 3300005843 | Ga0068860_100005271 | Ga0068860_1000052718 | 109 |
| 44 | 3300005844 | Ga0068862_100099448 | Ga0068862_1000994482 | 109 |
| 45 | 3300005844 | Ga0068862_100143238 | Ga0068862_1001432382 | 109 |
| 46 | 3300006048 | Ga0075363_100392447 | Ga0075363_1003924472 | 109 |
| 47 | 3300006051 | Ga0075364_10065079 | Ga0075364_100650792 | 109 |
| 48 | 3300006178 | Ga0075367_10001342 | Ga0075367_100013427 | 109 |
| 49 | 3300006195 | Ga0075366_10002873 | Ga0075366_100028736 | 109 |
| 50 | 3300006353 | Ga0075370_10210625 | Ga0075370_102106252 | 109 |
| 51 | 3300006358 | Ga0068871_100030055 | Ga0068871_1000300552 | 109 |
| 52 | 3300006844 | Ga0075428_100052572 | Ga0075428_1000525723 | 109 |
| 53 | 3300006846 | Ga0075430_100153833 | Ga0075430_1001538332 | 109 |
| 54 | 3300006847 | Ga0075431_100166518 | Ga0075431_1001665182 | 109 |
| 55 | 3300006871 | Ga0075434_100069124 | Ga0075434_1000691243 | 109 |
| 56 | 3300006880 | Ga0075429_100020517 | Ga0075429_1000205172 | 109 |
| 57 | 3300006881 | Ga0068865_100070503 | Ga0068865_1000705032 | 109 |
| 58 | 3300006931 | Ga0097620_100093050 | Ga0097620_1000930502 | 109 |
| 59 | 3300007076 | Ga0075435_100001769 | Ga0075435_10000176911 | 109 |
| 60 | 3300009101 | Ga0105247_11444875 | Ga0105247_114448751 | 109 |
| 61 | 3300017792 | Ga0163161_10329049 | Ga0163161_103290492 | 109 |
| 62 | 3300025899 | Ga0207642_10036863 | Ga0207642_100368632 | 109 |
| 63 | 3300025907 | Ga0207645_10102971 | Ga0207645_101029712 | 109 |
| 64 | 3300025917 | Ga0207660_10644480 | Ga0207660_106444802 | 109 |
| 65 | 3300025923 | Ga0207681_10018009 | Ga0207681_100180092 | 109 |
| 66 | 3300025924 | Ga0207694_11042546 | Ga0207694_110425462 | 109 |
| 67 | 3300025927 | Ga0207687_10185384 | Ga0207687_101853841 | 109 |
| 68 | 3300025931 | Ga0207644_10124031 | Ga0207644_101240312 | 109 |
| 69 | 3300025933 | Ga0207706_10493243 | Ga0207706_104932432 | 109 |
| 70 | 3300025936 | Ga0207670_10017734 | Ga0207670_100177343 | 109 |
| 71 | 3300025938 | Ga0207704_10153516 | Ga0207704_101535162 | 109 |
| 72 | 3300025938 | Ga0207704_10434510 | Ga0207704_104345102 | 109 |
| 73 | 3300025941 | Ga0207711_10682171 | Ga0207711_106821712 | 109 |
| 74 | 3300025942 | Ga0207689_10431546 | Ga0207689_104315462 | 109 |
| 75 | 3300025942 | Ga0207689_10943898 | Ga0207689_109438982 | 109 |
| 76 | 3300025960 | Ga0207651_11763352 | Ga0207651_117633522 | 109 |
| 77 | 3300025972 | Ga0207668_10030717 | Ga0207668_100307172 | 109 |
| 78 | 3300025986 | Ga0207658_10827593 | Ga0207658_108275932 | 109 |
| 79 | 3300026023 | Ga0207677_10202694 | Ga0207677_102026941 | 109 |
| 80 | 3300026035 | Ga0207703_10117761 | Ga0207703_101177611 | 109 |
| 81 | 3300026067 | Ga0207678_10128477 | Ga0207678_101284772 | 109 |
| 82 | 3300026075 | Ga0207708_10015003 | Ga0207708_100150034 | 109 |
| 83 | 3300026088 | Ga0207641_10071937 | Ga0207641_100719372 | 109 |
| 84 | 3300026089 | Ga0207648_10006472 | Ga0207648_100064722 | 109 |
| 85 | 3300026095 | Ga0207676_11086849 | Ga0207676_110868492 | 109 |
| 86 | 3300026116 | Ga0207674_11842928 | Ga0207674_118429282 | 109 |
| 87 | 3300026118 | Ga0207675_100010699 | Ga0207675_1000106992 | 109 |
| 88 | 3300026118 | Ga0207675_100228535 | Ga0207675_1002285352 | 109 |
| 89 | 3300027907 | Ga0207428_10001768 | Ga0207428_100017689 | 109 |
| 90 | 3300028380 | Ga0268265_10120402 | Ga0268265_101204022 | 109 |
| 91 | 3300028381 | Ga0268264_10140743 | Ga0268264_101407432 | 109 |
| 92 | 3300035695 | Ga0373927_0494295 | Ga0373927_0494295_155_484 | 109 |
| 93 | 3300035725 | Ga0373947_0365027 | Ga0373947_0365027_56_400 | 109 |
| 94 | 3300005289 | Ga0065704_10490451 | Ga0065704_104904511 | 110 |
| 95 | 3300005295 | Ga0065707_10357715 | Ga0065707_103577151 | 110 |
| 96 | 3300005329 | Ga0070683_100575554 | Ga0070683_1005755542 | 110 |
| 97 | 3300005330 | Ga0070690_100079140 | Ga0070690_1000791402 | 110 |
| 98 | 3300005331 | Ga0070670_101768700 | Ga0070670_1017687002 | 110 |
| 99 | 3300005336 | Ga0070680_100069562 | Ga0070680_1000695622 | 110 |
| 100 | 3300005336 | Ga0070680_101630859 | Ga0070680_1016308591 | 110 |
| 101 | 3300005337 | Ga0070682_100457410 | Ga0070682_1004574102 | 110 |
| 102 | 3300005338 | Ga0068868_100005475 | Ga0068868_1000054756 | 110 |
| 103 | 3300005340 | Ga0070689_100007239 | Ga0070689_1000072396 | 110 |
| 104 | 3300005340 | Ga0070689_101226546 | Ga0070689_1012265461 | 110 |
| 105 | 3300005341 | Ga0070691_10078565 | Ga0070691_100785653 | 110 |
| 106 | 3300005343 | Ga0070687_100023195 | Ga0070687_1000231952 | 110 |
| 107 | 3300005344 | Ga0070661_101011063 | Ga0070661_1010110631 | 110 |
| 108 | 3300005345 | Ga0070692_10117361 | Ga0070692_101173612 | 110 |
| 109 | 3300005345 | Ga0070692_10442706 | Ga0070692_104427062 | 110 |
| 110 | 3300005347 | Ga0070668_100224546 | Ga0070668_1002245462 | 110 |
| 111 | 3300005347 | Ga0070668_100306304 | Ga0070668_1003063042 | 110 |
| 112 | 3300005353 | Ga0070669_100074777 | Ga0070669_1000747772 | 110 |
| 113 | 3300005353 | Ga0070669_100515138 | Ga0070669_1005151381 | 110 |
| 114 | 3300005355 | Ga0070671_100363473 | Ga0070671_1003634732 | 110 |
| 115 | 3300005364 | Ga0070673_100256637 | Ga0070673_1002566372 | 110 |
| 116 | 3300005367 | Ga0070667_100123647 | Ga0070667_1001236472 | 110 |
| 117 | 3300005435 | Ga0070714_100153550 | Ga0070714_1001535502 | 110 |
| 118 | 3300005436 | Ga0070713_100005821 | Ga0070713_1000058213 | 110 |
| 119 | 3300005438 | Ga0070701_10003976 | Ga0070701_100039762 | 110 |
| 120 | 3300005438 | Ga0070701_10019457 | Ga0070701_100194572 | 110 |
| 121 | 3300005438 | Ga0070701_10350485 | Ga0070701_103504851 | 110 |
| 122 | 3300005439 | Ga0070711_100035506 | Ga0070711_1000355062 | 110 |
| 123 | 3300005440 | Ga0070705_100537113 | Ga0070705_1005371132 | 110 |
| 124 | 3300005441 | Ga0070700_100039258 | Ga0070700_1000392582 | 110 |
| 125 | 3300005444 | Ga0070694_100290869 | Ga0070694_1002908692 | 110 |
| 126 | 3300005455 | Ga0070663_100023020 | Ga0070663_1000230202 | 110 |
| 127 | 3300005456 | Ga0070678_100256044 | Ga0070678_1002560442 | 110 |
| 128 | 3300005456 | Ga0070678_101351446 | Ga0070678_1013514462 | 110 |
| 129 | 3300005457 | Ga0070662_100377207 | Ga0070662_1003772072 | 110 |
| 130 | 3300005466 | Ga0070685_10147936 | Ga0070685_101479362 | 110 |
| 131 | 3300005545 | Ga0070695_100109638 | Ga0070695_1001096382 | 110 |
| 132 | 3300005545 | Ga0070695_100180347 | Ga0070695_1001803472 | 110 |
| 133 | 3300005548 | Ga0070665_100521516 | Ga0070665_1005215162 | 110 |
| 134 | 3300005549 | Ga0070704_100043391 | Ga0070704_1000433912 | 110 |
| 135 | 3300005549 | Ga0070704_102226609 | Ga0070704_1022266091 | 110 |
| 136 | 3300005578 | Ga0068854_100599021 | Ga0068854_1005990212 | 110 |
| 137 | 3300005615 | Ga0070702_100040356 | Ga0070702_1000403562 | 110 |
| 138 | 3300005616 | Ga0068852_101456109 | Ga0068852_1014561091 | 110 |
| 139 | 3300005617 | Ga0068859_100164185 | Ga0068859_1001641852 | 110 |
| 140 | 3300005617 | Ga0068859_100788886 | Ga0068859_1007888862 | 110 |
| 141 | 3300005618 | Ga0068864_100099465 | Ga0068864_1000994651 | 110 |
| 142 | 3300005719 | Ga0068861_100133501 | Ga0068861_1001335012 | 110 |
| 143 | 3300005719 | Ga0068861_100362115 | Ga0068861_1003621152 | 110 |
| 144 | 3300005841 | Ga0068863_100345519 | Ga0068863_1003455191 | 110 |
| 145 | 3300005844 | Ga0068862_100037276 | Ga0068862_1000372763 | 110 |
| 146 | 3300005844 | Ga0068862_100411710 | Ga0068862_1004117102 | 110 |
| 147 | 3300005983 | Ga0081540_1125321 | Ga0081540_11253212 | 110 |
| 148 | 3300006028 | Ga0070717_10046244 | Ga0070717_100462442 | 110 |
| 149 | 3300006042 | Ga0075368_10014521 | Ga0075368_100145212 | 110 |
| 150 | 3300006042 | Ga0075368_10132716 | Ga0075368_101327162 | 110 |
| 151 | 3300006051 | Ga0075364_10032384 | Ga0075364_100323843 | 110 |
| 152 | 3300006178 | Ga0075367_10038767 | Ga0075367_100387672 | 110 |
| 153 | 3300006178 | Ga0075367_10113834 | Ga0075367_101138342 | 110 |
| 154 | 3300006195 | Ga0075366_10047631 | Ga0075366_100476312 | 110 |
| 155 | 3300006195 | Ga0075366_10275724 | Ga0075366_102757241 | 110 |
| 156 | 3300006353 | Ga0075370_10039615 | Ga0075370_100396152 | 110 |
| 157 | 3300006844 | Ga0075428_100020131 | Ga0075428_1000201312 | 110 |
| 158 | 3300006846 | Ga0075430_100029418 | Ga0075430_1000294182 | 110 |
| 159 | 3300006846 | Ga0075430_100520032 | Ga0075430_1005200322 | 110 |
| 160 | 3300006846 | Ga0075430_101004870 | Ga0075430_1010048701 | 110 |
| 161 | 3300006847 | Ga0075431_100254020 | Ga0075431_1002540202 | 110 |
| 162 | 3300006852 | Ga0075433_10406339 | Ga0075433_104063392 | 110 |
| 163 | 3300006871 | Ga0075434_100847940 | Ga0075434_1008479402 | 110 |
| 164 | 3300006871 | Ga0075434_101168159 | Ga0075434_1011681592 | 110 |
| 165 | 3300006931 | Ga0097620_100164183 | Ga0097620_1001641832 | 110 |
| 166 | 3300006931 | Ga0097620_100788680 | Ga0097620_1007886802 | 110 |
| 167 | 3300007076 | Ga0075435_101019258 | Ga0075435_1010192581 | 110 |
| 168 | 3300009093 | Ga0105240_10210021 | Ga0105240_102100212 | 110 |
| 169 | 3300009094 | Ga0111539_10000854 | Ga0111539_1000085424 | 110 |
| 170 | 3300009094 | Ga0111539_10137585 | Ga0111539_101375855 | 110 |
| 171 | 3300009094 | Ga0111539_10167829 | Ga0111539_101678293 | 110 |
| 172 | 3300009098 | Ga0105245_10252040 | Ga0105245_102520402 | 110 |
| 173 | 3300009101 | Ga0105247_11216362 | Ga0105247_112163621 | 110 |
| 174 | 3300009147 | Ga0114129_10077910 | Ga0114129_100779103 | 110 |
| 175 | 3300009147 | Ga0114129_10172409 | Ga0114129_101724093 | 110 |
| 176 | 3300009147 | Ga0114129_10179508 | Ga0114129_101795083 | 110 |
| 177 | 3300009148 | Ga0105243_10063658 | Ga0105243_100636582 | 110 |
| 178 | 3300009148 | Ga0105243_10404495 | Ga0105243_104044952 | 110 |
| 179 | 3300009148 | Ga0105243_10757970 | Ga0105243_107579702 | 110 |
| 180 | 3300009177 | Ga0105248_10097791 | Ga0105248_100977912 | 110 |
| 181 | 3300009177 | Ga0105248_10100982 | Ga0105248_101009823 | 110 |
| 182 | 3300009177 | Ga0105248_10644802 | Ga0105248_106448022 | 110 |
| 183 | 3300009545 | Ga0105237_10385517 | Ga0105237_103855172 | 110 |
| 184 | 3300009551 | Ga0105238_12162732 | Ga0105238_121627322 | 110 |
| 185 | 3300009553 | Ga0105249_10027848 | Ga0105249_100278482 | 110 |
| 186 | 3300009553 | Ga0105249_10368975 | Ga0105249_103689752 | 110 |
| 187 | 3300009553 | Ga0105249_10845080 | Ga0105249_108450802 | 110 |
| 188 | 3300010375 | Ga0105239_10104901 | Ga0105239_101049012 | 110 |
| 189 | 3300010375 | Ga0105239_10344434 | Ga0105239_103444342 | 110 |
| 190 | 3300011119 | Ga0105246_11090170 | Ga0105246_110901701 | 110 |
| 191 | 3300013104 | Ga0157370_10035515 | Ga0157370_100355152 | 110 |
| 192 | 3300013104 | Ga0157370_11189515 | Ga0157370_111895152 | 110 |
| 193 | 3300013306 | Ga0163162_11947155 | Ga0163162_119471552 | 110 |
| 194 | 3300013308 | Ga0157375_10133285 | Ga0157375_101332852 | 110 |
| 195 | 3300014325 | Ga0163163_10291047 | Ga0163163_102910472 | 110 |
| 196 | 3300014326 | Ga0157380_10435444 | Ga0157380_104354442 | 110 |
| 197 | 3300014326 | Ga0157380_11819157 | Ga0157380_118191571 | 110 |
| 198 | 3300014326 | Ga0157380_12134866 | Ga0157380_121348661 | 110 |
| 199 | 3300014745 | Ga0157377_10009090 | Ga0157377_100090902 | 110 |
| 200 | 3300014745 | Ga0157377_10780369 | Ga0157377_107803691 | 110 |
| 201 | 3300017792 | Ga0163161_11939003 | Ga0163161_119390031 | 110 |
| 202 | 3300025914 | Ga0207671_10542889 | Ga0207671_105428892 | 110 |
| 203 | 3300025914 | Ga0207671_10631290 | Ga0207671_106312901 | 110 |
| 204 | 3300025915 | Ga0207693_10114627 | Ga0207693_101146272 | 110 |
| 205 | 3300025916 | Ga0207663_10009612 | Ga0207663_100096122 | 110 |
| 206 | 3300025917 | Ga0207660_10076770 | Ga0207660_100767701 | 110 |
| 207 | 3300025917 | Ga0207660_11284184 | Ga0207660_112841841 | 110 |
| 208 | 3300025919 | Ga0207657_10479862 | Ga0207657_104798622 | 110 |
| 209 | 3300025920 | Ga0207649_10754381 | Ga0207649_107543811 | 110 |
| 210 | 3300025923 | Ga0207681_10610852 | Ga0207681_106108522 | 110 |
| 211 | 3300025925 | Ga0207650_11312157 | Ga0207650_113121572 | 110 |
| 212 | 3300025928 | Ga0207700_10179390 | Ga0207700_101793902 | 110 |
| 213 | 3300025929 | Ga0207664_10069421 | Ga0207664_100694213 | 110 |
| 214 | 3300025931 | Ga0207644_10090311 | Ga0207644_100903114 | 110 |
| 215 | 3300025933 | Ga0207706_10582658 | Ga0207706_105826582 | 110 |
| 216 | 3300025933 | Ga0207706_10601673 | Ga0207706_106016731 | 110 |
| 217 | 3300025935 | Ga0207709_10257806 | Ga0207709_102578062 | 110 |
| 218 | 3300025935 | Ga0207709_11141821 | Ga0207709_111418211 | 110 |
| 219 | 3300025936 | Ga0207670_10250046 | Ga0207670_102500462 | 110 |
| 220 | 3300025937 | Ga0207669_11139627 | Ga0207669_111396272 | 110 |
| 221 | 3300025938 | Ga0207704_10147351 | Ga0207704_101473512 | 110 |
| 222 | 3300025940 | Ga0207691_10005638 | Ga0207691_100056381 | 110 |
| 223 | 3300025941 | Ga0207711_10075502 | Ga0207711_100755022 | 110 |
| 224 | 3300025942 | Ga0207689_10070338 | Ga0207689_100703382 | 110 |
| 225 | 3300025944 | Ga0207661_10515130 | Ga0207661_105151302 | 110 |
| 226 | 3300025972 | Ga0207668_10096314 | Ga0207668_100963143 | 110 |
| 227 | 3300025972 | Ga0207668_10789714 | Ga0207668_107897142 | 110 |
| 228 | 3300026041 | Ga0207639_12106678 | Ga0207639_121066782 | 110 |
| 229 | 3300026088 | Ga0207641_10298560 | Ga0207641_102985601 | 110 |
| 230 | 3300026089 | Ga0207648_11332141 | Ga0207648_113321411 | 110 |
| 231 | 3300026095 | Ga0207676_10470821 | Ga0207676_104708212 | 110 |
| 232 | 3300026095 | Ga0207676_11096656 | Ga0207676_110966561 | 110 |
| 233 | 3300026118 | Ga0207675_100036266 | Ga0207675_1000362662 | 110 |
| 234 | 3300026118 | Ga0207675_100063645 | Ga0207675_1000636453 | 110 |
| 235 | 3300026118 | Ga0207675_100151033 | Ga0207675_1001510332 | 110 |
| 236 | 3300026142 | Ga0207698_10091274 | Ga0207698_100912742 | 110 |
| 237 | 3300027866 | Ga0209813_10062357 | Ga0209813_100623572 | 110 |
| 238 | 3300027866 | Ga0209813_10072320 | Ga0209813_100723202 | 110 |
| 239 | 3300027876 | Ga0209974_10191499 | Ga0209974_101914993 | 110 |
| 240 | 3300028379 | Ga0268266_11297208 | Ga0268266_112972082 | 110 |
| 241 | 3300028380 | Ga0268265_10098311 | Ga0268265_100983112 | 110 |
| 242 | 3300028380 | Ga0268265_10508216 | Ga0268265_105082162 | 110 |
| 243 | 3300028381 | Ga0268264_10300697 | Ga0268264_103006972 | 110 |
| 244 | 3300031344 | Ga0265316_10883454 | Ga0265316_108834542 | 110 |
| 245 | 3300031711 | Ga0265314_10009776 | Ga0265314_100097763 | 110 |
| 246 | 3300031911 | Ga0307412_10976825 | Ga0307412_109768251 | 110 |
| 247 | 3300032002 | Ga0307416_101682910 | Ga0307416_1016829102 | 110 |
| 248 | 3300032005 | Ga0307411_10270586 | Ga0307411_102705862 | 110 |
| 249 | 3300032005 | Ga0307411_10459942 | Ga0307411_104599422 | 110 |
| 250 | 3300035088 | Ga0373940_0031472 | Ga0373940_0031472_803_1147 | 110 |
| 251 | 3300035115 | Ga0373941_0177313 | Ga0373941_0177313_46_390 | 110 |
| 252 | 3300035695 | Ga0373927_0004292 | Ga0373927_0004292_3258_3614 | 110 |
| 253 | 3300035725 | Ga0373947_0217917 | Ga0373947_0217917_592_948 | 110 |
| 254 | 3300037418 | Ga0395900_0291323 | Ga0395900_0291323_79_432 | 110 |
| 255 | 3300037418 | Ga0395900_0349719 | Ga0395900_0349719_342_695 | 110 |
| 256 | 3300039447 | Ga0436361_1105276 | Ga0436361_1105276_392_736 | 110 |
| 257 | 3300041408 | Ga0439453_0071760 | Ga0439453_0071760_381_713 | 110 |
| 258 | 3300042010 | Ga0439452_110930 | Ga0439452_110930_119_472 | 110 |
| 259 | 3300042184 | Ga0450908_002047 | Ga0450908_002047_890_1243 | 110 |
| 260 | 3300042435 | Ga0439434_0270915 | Ga0439434_0270915_135_488 | 110 |
| 261 | 3300042436 | Ga0439435_0037481 | Ga0439435_0037481_793_1125 | 110 |
| 262 | 3300042461 | Ga0439460_0054364 | Ga0439460_0054364_681_1034 | 110 |
| 263 | 3300042993 | Ga0439440_0204360 | Ga0439440_0204360_75_428 | 110 |
| 264 | 3300045051 | Ga0451576_0269218 | Ga0451576_0269218_1369_1758 | 110 |
| 265 | 3300045051 | Ga0451576_0508143 | Ga0451576_0508143_326_670 | 110 |
| 266 | 3300045976 | Ga0466967_1623312 | Ga0466967_1623312_85_429 | 110 |
| 267 | 3300046472 | Ga0495580_0055119 | Ga0495580_0055119_111_467 | 110 |
| 268 | 3300046472 | Ga0495580_0353082 | Ga0495580_0353082_296_640 | 110 |
| 269 | 3300046615 | Ga0495656_0227514 | Ga0495656_0227514_508_852 | 110 |
| 270 | 3300048909 | Ga0496106_0975077 | Ga0496106_0975077_35_388 | 110 |
| 271 | 3300048909 | Ga0496106_1017692 | Ga0496106_1017692_277_636 | 110 |
| 272 | 3300048911 | Ga0496108_0282156 | Ga0496108_0282156_938_1291 | 110 |
| 273 | 3300048913 | Ga0496110_0431436 | Ga0496110_0431436_684_1043 | 110 |
| 274 | 3300048916 | Ga0496113_0551030 | Ga0496113_0551030_181_534 | 110 |
| 275 | 3300049572 | Ga0501036_0786693 | Ga0501036_0786693_382_735 | 110 |
| 276 | 3300049578 | Ga0501042_0518901 | Ga0501042_0518901_438_791 | 110 |
| 277 | 3300049578 | Ga0501042_1193940 | Ga0501042_1193940_107_460 | 110 |
| 278 | 3300049587 | Ga0501071_0188955 | Ga0501071_0188955_1016_1369 | 110 |
| 279 | 3300049587 | Ga0501071_0691906 | Ga0501071_0691906_126_458 | 110 |
| 280 | 3300049587 | Ga0501071_1040064 | Ga0501071_1040064_30_374 | 110 |
| 281 | 3300049588 | Ga0501072_0024885 | Ga0501072_0024885_3776_4129 | 110 |
| 282 | 3300049591 | Ga0501075_0052679 | Ga0501075_0052679_1580_1933 | 110 |
| 283 | 3300049592 | Ga0501076_0614654 | Ga0501076_0614654_414_767 | 110 |
| 284 | 3300049681 | Ga0501251_084514 | Ga0501251_084514_196_549 | 110 |
| 285 | 3300049741 | Ga0501079_0877802 | Ga0501079_0877802_156_509 | 110 |
| 286 | 3300049779 | Ga0501283_000914 | Ga0501283_000914_861_1214 | 110 |
| 287 | 3300050490 | nmdc:mga03n38_396589_c1 | nmdc:mga03n38_396589_c1_10_354 | 110 |
| 288 | 3300050491 | nmdc:mga00v17_411344_c1 | nmdc:mga00v17_411344_c1_10_354 | 110 |
| 289 | 3300050493 | nmdc:mga0k408_172428_c1 | nmdc:mga0k408_172428_c1_150_503 | 110 |
| 290 | 3300050493 | nmdc:mga0k408_1878_c1 | nmdc:mga0k408_1878_c1_9859_10203 | 110 |
| 291 | 3300050494 | nmdc:mga06z11_46000_c1 | nmdc:mga06z11_46000_c1_800_1153 | 110 |
| 292 | 3300050495 | nmdc:mga04h51_30050_c1 | nmdc:mga04h51_30050_c1_307_660 | 110 |
| 293 | 3300050496 | nmdc:mga07m45_10097_c1 | nmdc:mga07m45_10097_c1_653_1006 | 110 |
| 294 | 3300050496 | nmdc:mga07m45_167504_c1 | nmdc:mga07m45_167504_c1_791_1144 | 110 |
| 295 | 3300050507 | nmdc:mga05p37_116359_c1 | nmdc:mga05p37_116359_c1_1710_2054 | 110 |
| 296 | 3300050507 | nmdc:mga05p37_148962_c1 | nmdc:mga05p37_148962_c1_44_388 | 110 |
| 297 | 3300050507 | nmdc:mga05p37_1596409_c1 | nmdc:mga05p37_1596409_c1_85_438 | 110 |
| 298 | 3300050508 | nmdc:mga09592_116310_c1 | nmdc:mga09592_116310_c1_1837_2193 | 110 |
| 299 | 3300050508 | nmdc:mga09592_1377215_c1 | nmdc:mga09592_1377215_c1_171_515 | 110 |
| 300 | 3300050508 | nmdc:mga09592_168279_c1 | nmdc:mga09592_168279_c1_1473_1817 | 110 |
| 301 | 3300050509 | nmdc:mga0qj67_1119539_c1 | nmdc:mga0qj67_1119539_c1_98_442 | 110 |
| 302 | 3300050509 | nmdc:mga0qj67_126717_c1 | nmdc:mga0qj67_126717_c1_985_1338 | 110 |
| 303 | 3300050509 | nmdc:mga0qj67_14590_c1 | nmdc:mga0qj67_14590_c1_4841_5197 | 110 |
| 304 | 3300050509 | nmdc:mga0qj67_580315_c1 | nmdc:mga0qj67_580315_c1_503_847 | 110 |
| 305 | 3300050509 | nmdc:mga0qj67_782925_c1 | nmdc:mga0qj67_782925_c1_346_699 | 110 |
| 306 | 3300050510 | nmdc:mga06r32_12967_c1 | nmdc:mga06r32_12967_c1_233_577 | 110 |
| 307 | 3300050510 | nmdc:mga06r32_142495_c1 | nmdc:mga06r32_142495_c1_166_510 | 110 |
| 308 | 3300050510 | nmdc:mga06r32_226784_c1 | nmdc:mga06r32_226784_c1_287_631 | 110 |
| 309 | 3300050510 | nmdc:mga06r32_421598_c1 | nmdc:mga06r32_421598_c1_285_638 | 110 |
| 310 | 3300050510 | nmdc:mga06r32_623912_c1 | nmdc:mga06r32_623912_c1_284_628 | 110 |
| 311 | 3300050511 | nmdc:mga08y16_21812_c1 | nmdc:mga08y16_21812_c1_934_1278 | 110 |
| 312 | 3300050511 | nmdc:mga08y16_5690_c1 | nmdc:mga08y16_5690_c1_2809_3165 | 110 |
| 313 | 3300050512 | nmdc:mga0n895_1003448_c1 | nmdc:mga0n895_1003448_c1_160_513 | 110 |
| 314 | 3300050512 | nmdc:mga0n895_933570_c1 | nmdc:mga0n895_933570_c1_93_440 | 110 |
| 315 | 3300050513 | nmdc:mga0rr50_1380_c1 | nmdc:mga0rr50_1380_c1_511_855 | 110 |
| 316 | 3300050513 | nmdc:mga0rr50_1434612_c1 | nmdc:mga0rr50_1434612_c1_98_451 | 110 |
| 317 | 3300050513 | nmdc:mga0rr50_28501_c1 | nmdc:mga0rr50_28501_c1_2469_2822 | 110 |
| 318 | 3300050515 | nmdc:mga0a205_183833_c1 | nmdc:mga0a205_183833_c1_493_837 | 110 |
| 319 | 3300050515 | nmdc:mga0a205_19417_c1 | nmdc:mga0a205_19417_c1_1414_1767 | 110 |
| 320 | 3300050516 | nmdc:mga0sz30_563233_c1 | nmdc:mga0sz30_563233_c1_64_408 | 110 |
| 321 | 3300054114 | Ga0501084_0369591 | Ga0501084_0369591_767_1123 | 110 |
| 322 | 3300054114 | Ga0501084_0829890 | Ga0501084_0829890_325_657 | 110 |
| 323 | 3300054114 | Ga0501084_0886058 | Ga0501084_0886058_80_433 | 110 |
| 324 | 3300054114 | Ga0501084_1766063 | Ga0501084_1766063_82_435 | 110 |
| 325 | 3300059421 | Ga0590071_069016 | Ga0590071_069016_366_719 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9297 | 5 | 106 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.926 | 5 | 106 |
| 3elk-assembly1.cif.gz_B | crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum | 0.9143 | 5 | 107 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9091 | 5 | 106 |
| 5x11-assembly3.cif.gz_D | crystal structure of bacillus subtilis padr in complex with operator dna | 0.9061 | 12 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.926 | 5 | 106 | 1.10.10.10 |
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9232 | 15 | 81 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9091 | 5 | 106 | 1.10.10.10 |
| 5x11A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9059 | 12 | 89 | 1.10.10.10 |
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8939 | 5 | 107 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9BJQ0-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.977 | 1 | 80 |
|
| AF-A0A2T2XH58-F1-model_v4 | PadR family transcriptional regulator | 0.974 | 11 | 104 |
|
| AF-A0A1Y4VAC9-F1-model_v4 | PadR family transcriptional regulator | 0.969 | 5 | 89 |
|
| AF-X1PAV8-F1-model_v4 | Transcription regulator PadR N-terminal domain-containing protein | 0.9687 | 4 | 83 |
|
| AF-A0A4Q0SZP5-F1-model_v4 | Transcriptional regulator, PadR family | 0.9641 | 8 | 107 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar