F407653

General Info

Members Datasets Scaffolds Average Seq Length
325 190 325 114

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10092038|Ga0065712_100920383
Length 111
Sequence MGKTSDQLQGTLELLVLRTLASAGEQLHGFGIAERIKQVSAEALRVEEGSLYPALHRMNEEGWVLSEWGTSDNNRRARFYKITTKGRRRLTQLERDWARHVAAVKRVIRHA

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
151 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
152 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.38
Nodule 0
Rhizoplane 1.54
Rhizosphere 91.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10490451 3300005289 Unclassified 675
2 Ga0065712_10092038 3300005290 Unclassified 2347
3 Ga0065715_10090207 3300005293 Bacteria 7448
4 Ga0065707_10168805 3300005295 Bacteria 1500
5 Ga0065707_10357715 3300005295 Unclassified 909
6 Ga0070683_100575554 3300005329 Bacteria 1077
7 Ga0070690_100079140 3300005330 Bacteria 2149
8 Ga0070670_101768700 3300005331 Unclassified 569
9 Ga0068869_101294548 3300005334 Unclassified 643
10 Ga0070666_11337578 3300005335 Unclassified 535
11 Ga0070680_100069562 3300005336 Bacteria 2891
12 Ga0070680_100286607 3300005336 Bacteria 1396
13 Ga0070680_101630859 3300005336 Unclassified 559
14 Ga0070682_100457410 3300005337 Unclassified 979
15 Ga0068868_100005475 3300005338 Bacteria 8929
16 Ga0070660_100933474 3300005339 Unclassified 732
17 Ga0070689_100007239 3300005340 Bacteria 7737
18 Ga0070689_100748695 3300005340 Unclassified 856
19 Ga0070689_101226546 3300005340 Bacteria 674
20 Ga0070691_10078565 3300005341 Bacteria 1612
21 Ga0070691_10181347 3300005341 Unclassified 1096
22 Ga0070687_100023195 3300005343 Bacteria 2946
23 Ga0070661_101011063 3300005344 Unclassified 690
24 Ga0070692_10117361 3300005345 Unclassified 1479
25 Ga0070692_10442706 3300005345 Unclassified 830
26 Ga0070668_100224546 3300005347 Unclassified 1550
27 Ga0070668_100306304 3300005347 Bacteria 1334
28 Ga0070669_100074777 3300005353 Unclassified 2511
29 Ga0070669_100515138 3300005353 Bacteria 994
30 Ga0070675_100214582 3300005354 Bacteria 1674
31 Ga0070671_100363473 3300005355 Bacteria 1236
32 Ga0070674_101124326 3300005356 Bacteria 695
33 Ga0070673_100256637 3300005364 Bacteria 1526
34 Ga0070667_100123647 3300005367 Bacteria 2253
35 Ga0070703_10236175 3300005406 Bacteria 735
36 Ga0070714_100153550 3300005435 Bacteria 2077
37 Ga0070713_100005821 3300005436 Bacteria 8475
38 Ga0070701_10003976 3300005438 Bacteria 5916
39 Ga0070701_10019457 3300005438 Bacteria 3207
40 Ga0070701_10350485 3300005438 Bacteria 922
41 Ga0070711_100035506 3300005439 Bacteria 3334
42 Ga0070705_100457155 3300005440 Bacteria 959
43 Ga0070705_100537113 3300005440 Bacteria 894
44 Ga0070705_101454668 3300005440 Unclassified 573
45 Ga0070700_100039258 3300005441 Bacteria 2891
46 Ga0070700_101233839 3300005441 Bacteria 626
47 Ga0070694_100031952 3300005444 Bacteria 3454
48 Ga0070694_100290869 3300005444 Bacteria 1249
49 Ga0070694_100516028 3300005444 Unclassified 953
50 Ga0070663_100023020 3300005455 Bacteria 4171
51 Ga0070678_100256044 3300005456 Bacteria 1470
52 Ga0070678_101351446 3300005456 Unclassified 664
53 Ga0070662_100377207 3300005457 Unclassified 1167
54 Ga0070662_100652695 3300005457 Bacteria 888
55 Ga0070662_100663708 3300005457 Bacteria 880
56 Ga0070685_10147936 3300005466 Unclassified 1486
57 Ga0070695_100109638 3300005545 Bacteria 1871
58 Ga0070695_100180347 3300005545 Bacteria 1496
59 Ga0070695_100390265 3300005545 Bacteria 1053
60 Ga0070665_100521516 3300005548 Bacteria 1200
61 Ga0070704_100043391 3300005549 Unclassified 3117
62 Ga0070704_100065952 3300005549 Bacteria 2608
63 Ga0070704_102226609 3300005549 Bacteria 510
64 Ga0070664_100188316 3300005564 Bacteria 1838
65 Ga0068854_100129228 3300005578 Bacteria 1927
66 Ga0068854_100599021 3300005578 Bacteria 941
67 Ga0070702_100040356 3300005615 Bacteria 2611
68 Ga0068852_101456109 3300005616 Bacteria 707
69 Ga0068859_100093046 3300005617 Bacteria 3066
70 Ga0068859_100164185 3300005617 Bacteria 2300
71 Ga0068859_100333654 3300005617 Unclassified 1611
72 Ga0068859_100788886 3300005617 Bacteria 1038
73 Ga0068864_100099465 3300005618 Unclassified 2576
74 Ga0068866_10101681 3300005718 Unclassified 1587
75 Ga0068861_100033475 3300005719 Bacteria 3791
76 Ga0068861_100133501 3300005719 Bacteria 2018
77 Ga0068861_100362115 3300005719 Unclassified 1276
78 Ga0068861_100463844 3300005719 Bacteria 1138
79 Ga0068870_10960968 3300005840 Unclassified 607
80 Ga0068863_100013847 3300005841 Bacteria 7773
81 Ga0068863_100345519 3300005841 Bacteria 1448
82 Ga0068858_100003464 3300005842 Bacteria 15641
83 Ga0068860_100005271 3300005843 Bacteria 13123
84 Ga0068862_100037276 3300005844 Bacteria 4121
85 Ga0068862_100099448 3300005844 Bacteria 2542
86 Ga0068862_100143238 3300005844 Bacteria 2122
87 Ga0068862_100411710 3300005844 Bacteria 1267
88 Ga0081540_1125321 3300005983 Bacteria 1058
89 Ga0070717_10046244 3300006028 Bacteria 3561
90 Ga0075368_10014521 3300006042 Bacteria 2910
91 Ga0075368_10132716 3300006042 Bacteria 1035
92 Ga0075363_100392447 3300006048 Unclassified 815
93 Ga0075364_10032384 3300006051 Bacteria 3360
94 Ga0075364_10065079 3300006051 Bacteria 2393
95 Ga0075367_10001342 3300006178 Bacteria 10450
96 Ga0075367_10038767 3300006178 Bacteria 2775
97 Ga0075367_10113834 3300006178 Bacteria 1663
98 Ga0075366_10002873 3300006195 Bacteria 8930
99 Ga0075366_10047631 3300006195 Bacteria 2541
100 Ga0075366_10275724 3300006195 Bacteria 1027
101 Ga0075370_10039615 3300006353 Bacteria 2656
102 Ga0075370_10210625 3300006353 Unclassified 1147
103 Ga0068871_100030055 3300006358 Bacteria 4274
104 Ga0075428_100020131 3300006844 Bacteria 7389
105 Ga0075428_100052572 3300006844 Bacteria 4464
106 Ga0075430_100029418 3300006846 Bacteria 4662
107 Ga0075430_100153833 3300006846 Bacteria 1915
108 Ga0075430_100520032 3300006846 Bacteria 982
109 Ga0075430_101004870 3300006846 Unclassified 687
110 Ga0075431_100166518 3300006847 Bacteria 2266
111 Ga0075431_100254020 3300006847 Bacteria 1785
112 Ga0075433_10406339 3300006852 Bacteria 1201
113 Ga0075434_100069124 3300006871 Bacteria 3520
114 Ga0075434_100847940 3300006871 Bacteria 929
115 Ga0075434_101168159 3300006871 Bacteria 782
116 Ga0075429_100020517 3300006880 Bacteria 5734
117 Ga0068865_100070503 3300006881 Bacteria 2476
118 Ga0097620_100093050 3300006931 Bacteria 3066
119 Ga0097620_100164183 3300006931 Bacteria 2300
120 Ga0097620_100333667 3300006931 Unclassified 1611
121 Ga0097620_100788680 3300006931 Bacteria 1038
122 Ga0075435_100001769 3300007076 Bacteria 14065
123 Ga0075435_101019258 3300007076 Bacteria 723
124 Ga0105240_10210021 3300009093 Bacteria 2275
125 Ga0111539_10000854 3300009094 Bacteria 39754
126 Ga0111539_10137585 3300009094 Bacteria 2860
127 Ga0111539_10167829 3300009094 Bacteria 2565
128 Ga0105245_10252040 3300009098 Bacteria 1715
129 Ga0105247_11216362 3300009101 Bacteria 601
130 Ga0105247_11444875 3300009101 Unclassified 558
131 Ga0114129_10077910 3300009147 Bacteria 4610
132 Ga0114129_10172409 3300009147 Bacteria 2948
133 Ga0114129_10179508 3300009147 Unclassified 2882
134 Ga0105243_10063658 3300009148 Bacteria 2956
135 Ga0105243_10404495 3300009148 Bacteria 1269
136 Ga0105243_10757970 3300009148 Bacteria 952
137 Ga0105248_10097791 3300009177 Bacteria 3307
138 Ga0105248_10100982 3300009177 Unclassified 3251
139 Ga0105248_10644802 3300009177 Unclassified 1195
140 Ga0105237_10385517 3300009545 Bacteria 1406
141 Ga0105238_12162732 3300009551 Unclassified 591
142 Ga0105249_10027848 3300009553 Bacteria 5100
143 Ga0105249_10368975 3300009553 Bacteria 1458
144 Ga0105249_10845080 3300009553 Bacteria 981
145 Ga0105249_10909362 3300009553 Bacteria 947
146 Ga0105239_10104901 3300010375 Bacteria 3130
147 Ga0105239_10344434 3300010375 Bacteria 1682
148 Ga0105246_11090170 3300011119 Bacteria 728
149 Ga0157343_1038894 3300012488 Unclassified 510
150 Ga0157370_10035515 3300013104 Bacteria 4843
151 Ga0157370_11189515 3300013104 Bacteria 688
152 Ga0163162_11947155 3300013306 Unclassified 673
153 Ga0157375_10133285 3300013308 Bacteria 2606
154 Ga0163163_10291047 3300014325 Bacteria 1685
155 Ga0157380_10435444 3300014326 Bacteria 1255
156 Ga0157380_11819157 3300014326 Bacteria 668
157 Ga0157380_12134866 3300014326 Bacteria 623
158 Ga0157377_10009090 3300014745 Bacteria 4868
159 Ga0157377_10780369 3300014745 Unclassified 702
160 Ga0163161_10329049 3300017792 Unclassified 1210
161 Ga0163161_11939003 3300017792 Bacteria 524
162 Ga0207642_10036863 3300025899 Bacteria 2102
163 Ga0207645_10102971 3300025907 Bacteria 1843
164 Ga0207671_10542889 3300025914 Bacteria 927
165 Ga0207671_10631290 3300025914 Unclassified 853
166 Ga0207693_10114627 3300025915 Bacteria 2115
167 Ga0207663_10009612 3300025916 Bacteria 5118
168 Ga0207660_10076770 3300025917 Unclassified 2443
169 Ga0207660_10644480 3300025917 Unclassified 864
170 Ga0207660_11284184 3300025917 Unclassified 595
171 Ga0207657_10479862 3300025919 Unclassified 975
172 Ga0207649_10754381 3300025920 Unclassified 757
173 Ga0207681_10018009 3300025923 Bacteria 4444
174 Ga0207681_10610852 3300025923 Bacteria 902
175 Ga0207694_11042546 3300025924 Unclassified 692
176 Ga0207650_11312157 3300025925 Unclassified 616
177 Ga0207687_10185384 3300025927 Bacteria 1615
178 Ga0207700_10179390 3300025928 Bacteria 1772
179 Ga0207664_10069421 3300025929 Bacteria 2833
180 Ga0207644_10090311 3300025931 Bacteria 2282
181 Ga0207644_10124031 3300025931 Unclassified 1970
182 Ga0207706_10493243 3300025933 Bacteria 1058
183 Ga0207706_10582658 3300025933 Bacteria 962
184 Ga0207706_10601673 3300025933 Bacteria 944
185 Ga0207709_10257806 3300025935 Bacteria 1277
186 Ga0207709_11141821 3300025935 Bacteria 641
187 Ga0207670_10017734 3300025936 Bacteria 4309
188 Ga0207670_10250046 3300025936 Bacteria 1370
189 Ga0207669_11139627 3300025937 Bacteria 659
190 Ga0207704_10147351 3300025938 Bacteria 1656
191 Ga0207704_10153516 3300025938 Unclassified 1628
192 Ga0207704_10434510 3300025938 Unclassified 1044
193 Ga0207691_10005638 3300025940 Bacteria 12104
194 Ga0207711_10075502 3300025941 Unclassified 2933
195 Ga0207711_10682171 3300025941 Bacteria 958
196 Ga0207689_10070338 3300025942 Bacteria 2875
197 Ga0207689_10431546 3300025942 Unclassified 1100
198 Ga0207689_10943898 3300025942 Bacteria 728
199 Ga0207661_10515130 3300025944 Bacteria 1094
200 Ga0207651_10439912 3300025960 Bacteria 1117
201 Ga0207651_11763352 3300025960 Unclassified 557
202 Ga0207712_10729806 3300025961 Bacteria 866
203 Ga0207668_10030717 3300025972 Bacteria 3533
204 Ga0207668_10096314 3300025972 Bacteria 2187
205 Ga0207668_10789714 3300025972 Bacteria 840
206 Ga0207640_10327192 3300025981 Bacteria 1222
207 Ga0207658_10827593 3300025986 Bacteria 841
208 Ga0207677_10202694 3300026023 Unclassified 1578
209 Ga0207703_10117761 3300026035 Bacteria 2276
210 Ga0207639_12106678 3300026041 Bacteria 525
211 Ga0207678_10128477 3300026067 Unclassified 2161
212 Ga0207708_10015003 3300026075 Bacteria 5807
213 Ga0207708_11170943 3300026075 Bacteria 672
214 Ga0207641_10071937 3300026088 Bacteria 2977
215 Ga0207641_10298560 3300026088 Bacteria 1521
216 Ga0207648_10006472 3300026089 Bacteria 11633
217 Ga0207648_11332141 3300026089 Unclassified 675
218 Ga0207676_10470821 3300026095 Bacteria 1188
219 Ga0207676_11086849 3300026095 Bacteria 790
220 Ga0207676_11096656 3300026095 Unclassified 787
221 Ga0207674_11842928 3300026116 Bacteria 572
222 Ga0207675_100010699 3300026118 Bacteria 8592
223 Ga0207675_100036266 3300026118 Bacteria 4600
224 Ga0207675_100063645 3300026118 Bacteria 3446
225 Ga0207675_100122169 3300026118 Unclassified 2465
226 Ga0207675_100151033 3300026118 Bacteria 2211
227 Ga0207675_100228535 3300026118 Bacteria 1794
228 Ga0207698_10091274 3300026142 Bacteria 2493
229 Ga0209813_10062357 3300027866 Bacteria 1193
230 Ga0209813_10072320 3300027866 Unclassified 1124
231 Ga0209974_10191499 3300027876 Unclassified 752
232 Ga0207428_10001768 3300027907 Bacteria 22154
233 Ga0268266_11297208 3300028379 Unclassified 703
234 Ga0268265_10098311 3300028380 Unclassified 2357
235 Ga0268265_10120402 3300028380 Unclassified 2161
236 Ga0268265_10508216 3300028380 Bacteria 1137
237 Ga0268264_10140743 3300028381 Bacteria 2151
238 Ga0268264_10300697 3300028381 Bacteria 1510
239 Ga0265316_10883454 3300031344 Bacteria 625
240 Ga0265314_10009776 3300031711 Bacteria 8058
241 Ga0307412_10976825 3300031911 Bacteria 747
242 Ga0307416_101682910 3300032002 Bacteria 739
243 Ga0307411_10270586 3300032005 Bacteria 1347
244 Ga0307411_10459942 3300032005 Bacteria 1067
245 Ga0373940_0031472 3300035088 Unclassified 1417
246 Ga0373941_0177313 3300035115 Bacteria 798
247 Ga0373927_0004292 3300035695 Bacteria 10006
248 Ga0373927_0494295 3300035695 Bacteria 808
249 Ga0373947_0217917 3300035725 Bacteria 1254
250 Ga0373947_0365027 3300035725 Unclassified 970
251 Ga0395900_0291323 3300037418 Unclassified 1621
252 Ga0395900_0349719 3300037418 Unclassified 1452
253 Ga0395900_0500370 3300037418 Bacteria 1166
254 Ga0395900_1833182 3300037418 Unclassified 517
255 Ga0395901_1000830 3300038443 Unclassified 812
256 Ga0436361_1105276 3300039447 Bacteria 3284
257 Ga0439453_0071760 3300041408 Bacteria 734
258 Ga0439452_110930 3300042010 Bacteria 586
259 Ga0450908_002047 3300042184 Bacteria 3938
260 Ga0439434_0270915 3300042435 Bacteria 583
261 Ga0439435_0037481 3300042436 Unclassified 1343
262 Ga0439460_0054364 3300042461 Bacteria 1208
263 Ga0439440_0204360 3300042993 Bacteria 587
264 Ga0451576_0269218 3300045051 Unclassified 1781
265 Ga0451576_0508143 3300045051 Bacteria 1266
266 Ga0466967_1623312 3300045976 Unclassified 644
267 Ga0495580_0055119 3300046472 Bacteria 2802
268 Ga0495580_0353082 3300046472 Unclassified 996
269 Ga0495656_0227514 3300046615 Bacteria 935
270 Ga0496106_0975077 3300048909 Unclassified 667
271 Ga0496106_1017692 3300048909 Unclassified 651
272 Ga0496108_0282156 3300048911 Bacteria 1446
273 Ga0496110_0431436 3300048913 Unclassified 1201
274 Ga0496113_0551030 3300048916 Bacteria 925
275 Ga0501036_0786693 3300049572 Unclassified 784
276 Ga0501042_0518901 3300049578 Bacteria 865
277 Ga0501042_1193940 3300049578 Unclassified 555
278 Ga0501071_0188955 3300049587 Bacteria 1544
279 Ga0501071_0691906 3300049587 Bacteria 785
280 Ga0501071_1040064 3300049587 Unclassified 633
281 Ga0501072_0024885 3300049588 Bacteria 4661
282 Ga0501075_0052679 3300049591 Bacteria 3060
283 Ga0501076_0614654 3300049592 Bacteria 897
284 Ga0501251_084514 3300049681 Unclassified 561
285 Ga0501079_0877802 3300049741 Bacteria 706
286 Ga0501283_000914 3300049779 Bacteria 3918
287 nmdc:mga03n38_396589_c1 3300050490 Unclassified 759
288 nmdc:mga00v17_411344_c1 3300050491 Bacteria 879
289 nmdc:mga0k408_172428_c1 3300050493 Bacteria 1290
290 nmdc:mga0k408_1878_c1 3300050493 Bacteria 11264
291 nmdc:mga06z11_46000_c1 3300050494 Bacteria 2209
292 nmdc:mga04h51_30050_c1 3300050495 Unclassified 1707
293 nmdc:mga07m45_10097_c1 3300050496 Bacteria 4919
294 nmdc:mga07m45_167504_c1 3300050496 Bacteria 1276
295 nmdc:mga05p37_116359_c1 3300050507 Unclassified 3285
296 nmdc:mga05p37_148962_c1 3300050507 Bacteria 2864
297 nmdc:mga05p37_1596409_c1 3300050507 Bacteria 643
298 nmdc:mga09592_116310_c1 3300050508 Bacteria 2295
299 nmdc:mga09592_1377215_c1 3300050508 Archaea 577
300 nmdc:mga09592_168279_c1 3300050508 Bacteria 1895
301 nmdc:mga0qj67_1119539_c1 3300050509 Bacteria 614
302 nmdc:mga0qj67_126717_c1 3300050509 Bacteria 2066
303 nmdc:mga0qj67_14590_c1 3300050509 Bacteria 5940
304 nmdc:mga0qj67_580315_c1 3300050509 Bacteria 898
305 nmdc:mga0qj67_782925_c1 3300050509 Unclassified 756
306 nmdc:mga06r32_12967_c1 3300050510 Bacteria 4328
307 nmdc:mga06r32_142495_c1 3300050510 Bacteria 2374
308 nmdc:mga06r32_226784_c1 3300050510 Bacteria 1856
309 nmdc:mga06r32_421598_c1 3300050510 Unclassified 1316
310 nmdc:mga06r32_623912_c1 3300050510 Bacteria 1048
311 nmdc:mga08y16_21812_c1 3300050511 Bacteria 6758
312 nmdc:mga08y16_5690_c1 3300050511 Bacteria 13060
313 nmdc:mga0n895_1003448_c1 3300050512 Bacteria 816
314 nmdc:mga0n895_933570_c1 3300050512 Bacteria 852
315 nmdc:mga0rr50_1380_c1 3300050513 Bacteria 13302
316 nmdc:mga0rr50_1434612_c1 3300050513 Bacteria 584
317 nmdc:mga0rr50_28501_c1 3300050513 Bacteria 3926
318 nmdc:mga0a205_183833_c1 3300050515 Unclassified 1984
319 nmdc:mga0a205_19417_c1 3300050515 Bacteria 6406
320 nmdc:mga0sz30_563233_c1 3300050516 Unclassified 514
321 Ga0501084_0369591 3300054114 Bacteria 1212
322 Ga0501084_0829890 3300054114 Bacteria 778
323 Ga0501084_0886058 3300054114 Bacteria 751
324 Ga0501084_1766063 3300054114 Unclassified 517
325 Ga0590071_069016 3300059421 Bacteria 870

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300012488 Ga0157343_1038894 Ga0157343_10388942 102
2 3300037418 Ga0395900_0500370 Ga0395900_0500370_721_1038 105
3 3300038443 Ga0395901_1000830 Ga0395901_1000830_183_500 105
4 3300005290 Ga0065712_10092038 Ga0065712_100920383 108
5 3300005293 Ga0065715_10090207 Ga0065715_100902079 108
6 3300005295 Ga0065707_10168805 Ga0065707_101688052 108
7 3300005334 Ga0068869_101294548 Ga0068869_1012945481 108
8 3300005340 Ga0070689_100748695 Ga0070689_1007486952 108
9 3300005354 Ga0070675_100214582 Ga0070675_1002145822 108
10 3300005440 Ga0070705_100457155 Ga0070705_1004571552 108
11 3300005441 Ga0070700_101233839 Ga0070700_1012338392 108
12 3300005444 Ga0070694_100031952 Ga0070694_1000319524 108
13 3300005457 Ga0070662_100663708 Ga0070662_1006637081 108
14 3300005545 Ga0070695_100390265 Ga0070695_1003902653 108
15 3300005549 Ga0070704_100065952 Ga0070704_1000659523 108
16 3300005578 Ga0068854_100129228 Ga0068854_1001292283 108
17 3300005617 Ga0068859_100333654 Ga0068859_1003336543 108
18 3300006931 Ga0097620_100333667 Ga0097620_1003336671 108
19 3300009553 Ga0105249_10909362 Ga0105249_109093622 108
20 3300025960 Ga0207651_10439912 Ga0207651_104399122 108
21 3300025961 Ga0207712_10729806 Ga0207712_107298062 108
22 3300025981 Ga0207640_10327192 Ga0207640_103271922 108
23 3300026075 Ga0207708_11170943 Ga0207708_111709431 108
24 3300026118 Ga0207675_100122169 Ga0207675_1001221693 108
25 3300037418 Ga0395900_1833182 Ga0395900_1833182_34_369 108
26 3300005335 Ga0070666_11337578 Ga0070666_113375781 109
27 3300005336 Ga0070680_100286607 Ga0070680_1002866072 109
28 3300005339 Ga0070660_100933474 Ga0070660_1009334741 109
29 3300005341 Ga0070691_10181347 Ga0070691_101813471 109
30 3300005356 Ga0070674_101124326 Ga0070674_1011243261 109
31 3300005406 Ga0070703_10236175 Ga0070703_102361751 109
32 3300005440 Ga0070705_101454668 Ga0070705_1014546681 109
33 3300005444 Ga0070694_100516028 Ga0070694_1005160282 109
34 3300005457 Ga0070662_100652695 Ga0070662_1006526952 109
35 3300005564 Ga0070664_100188316 Ga0070664_1001883162 109
36 3300005617 Ga0068859_100093046 Ga0068859_1000930462 109
37 3300005718 Ga0068866_10101681 Ga0068866_101016812 109
38 3300005719 Ga0068861_100033475 Ga0068861_1000334752 109
39 3300005719 Ga0068861_100463844 Ga0068861_1004638442 109
40 3300005840 Ga0068870_10960968 Ga0068870_109609682 109
41 3300005841 Ga0068863_100013847 Ga0068863_1000138473 109
42 3300005842 Ga0068858_100003464 Ga0068858_1000034642 109
43 3300005843 Ga0068860_100005271 Ga0068860_1000052718 109
44 3300005844 Ga0068862_100099448 Ga0068862_1000994482 109
45 3300005844 Ga0068862_100143238 Ga0068862_1001432382 109
46 3300006048 Ga0075363_100392447 Ga0075363_1003924472 109
47 3300006051 Ga0075364_10065079 Ga0075364_100650792 109
48 3300006178 Ga0075367_10001342 Ga0075367_100013427 109
49 3300006195 Ga0075366_10002873 Ga0075366_100028736 109
50 3300006353 Ga0075370_10210625 Ga0075370_102106252 109
51 3300006358 Ga0068871_100030055 Ga0068871_1000300552 109
52 3300006844 Ga0075428_100052572 Ga0075428_1000525723 109
53 3300006846 Ga0075430_100153833 Ga0075430_1001538332 109
54 3300006847 Ga0075431_100166518 Ga0075431_1001665182 109
55 3300006871 Ga0075434_100069124 Ga0075434_1000691243 109
56 3300006880 Ga0075429_100020517 Ga0075429_1000205172 109
57 3300006881 Ga0068865_100070503 Ga0068865_1000705032 109
58 3300006931 Ga0097620_100093050 Ga0097620_1000930502 109
59 3300007076 Ga0075435_100001769 Ga0075435_10000176911 109
60 3300009101 Ga0105247_11444875 Ga0105247_114448751 109
61 3300017792 Ga0163161_10329049 Ga0163161_103290492 109
62 3300025899 Ga0207642_10036863 Ga0207642_100368632 109
63 3300025907 Ga0207645_10102971 Ga0207645_101029712 109
64 3300025917 Ga0207660_10644480 Ga0207660_106444802 109
65 3300025923 Ga0207681_10018009 Ga0207681_100180092 109
66 3300025924 Ga0207694_11042546 Ga0207694_110425462 109
67 3300025927 Ga0207687_10185384 Ga0207687_101853841 109
68 3300025931 Ga0207644_10124031 Ga0207644_101240312 109
69 3300025933 Ga0207706_10493243 Ga0207706_104932432 109
70 3300025936 Ga0207670_10017734 Ga0207670_100177343 109
71 3300025938 Ga0207704_10153516 Ga0207704_101535162 109
72 3300025938 Ga0207704_10434510 Ga0207704_104345102 109
73 3300025941 Ga0207711_10682171 Ga0207711_106821712 109
74 3300025942 Ga0207689_10431546 Ga0207689_104315462 109
75 3300025942 Ga0207689_10943898 Ga0207689_109438982 109
76 3300025960 Ga0207651_11763352 Ga0207651_117633522 109
77 3300025972 Ga0207668_10030717 Ga0207668_100307172 109
78 3300025986 Ga0207658_10827593 Ga0207658_108275932 109
79 3300026023 Ga0207677_10202694 Ga0207677_102026941 109
80 3300026035 Ga0207703_10117761 Ga0207703_101177611 109
81 3300026067 Ga0207678_10128477 Ga0207678_101284772 109
82 3300026075 Ga0207708_10015003 Ga0207708_100150034 109
83 3300026088 Ga0207641_10071937 Ga0207641_100719372 109
84 3300026089 Ga0207648_10006472 Ga0207648_100064722 109
85 3300026095 Ga0207676_11086849 Ga0207676_110868492 109
86 3300026116 Ga0207674_11842928 Ga0207674_118429282 109
87 3300026118 Ga0207675_100010699 Ga0207675_1000106992 109
88 3300026118 Ga0207675_100228535 Ga0207675_1002285352 109
89 3300027907 Ga0207428_10001768 Ga0207428_100017689 109
90 3300028380 Ga0268265_10120402 Ga0268265_101204022 109
91 3300028381 Ga0268264_10140743 Ga0268264_101407432 109
92 3300035695 Ga0373927_0494295 Ga0373927_0494295_155_484 109
93 3300035725 Ga0373947_0365027 Ga0373947_0365027_56_400 109
94 3300005289 Ga0065704_10490451 Ga0065704_104904511 110
95 3300005295 Ga0065707_10357715 Ga0065707_103577151 110
96 3300005329 Ga0070683_100575554 Ga0070683_1005755542 110
97 3300005330 Ga0070690_100079140 Ga0070690_1000791402 110
98 3300005331 Ga0070670_101768700 Ga0070670_1017687002 110
99 3300005336 Ga0070680_100069562 Ga0070680_1000695622 110
100 3300005336 Ga0070680_101630859 Ga0070680_1016308591 110
101 3300005337 Ga0070682_100457410 Ga0070682_1004574102 110
102 3300005338 Ga0068868_100005475 Ga0068868_1000054756 110
103 3300005340 Ga0070689_100007239 Ga0070689_1000072396 110
104 3300005340 Ga0070689_101226546 Ga0070689_1012265461 110
105 3300005341 Ga0070691_10078565 Ga0070691_100785653 110
106 3300005343 Ga0070687_100023195 Ga0070687_1000231952 110
107 3300005344 Ga0070661_101011063 Ga0070661_1010110631 110
108 3300005345 Ga0070692_10117361 Ga0070692_101173612 110
109 3300005345 Ga0070692_10442706 Ga0070692_104427062 110
110 3300005347 Ga0070668_100224546 Ga0070668_1002245462 110
111 3300005347 Ga0070668_100306304 Ga0070668_1003063042 110
112 3300005353 Ga0070669_100074777 Ga0070669_1000747772 110
113 3300005353 Ga0070669_100515138 Ga0070669_1005151381 110
114 3300005355 Ga0070671_100363473 Ga0070671_1003634732 110
115 3300005364 Ga0070673_100256637 Ga0070673_1002566372 110
116 3300005367 Ga0070667_100123647 Ga0070667_1001236472 110
117 3300005435 Ga0070714_100153550 Ga0070714_1001535502 110
118 3300005436 Ga0070713_100005821 Ga0070713_1000058213 110
119 3300005438 Ga0070701_10003976 Ga0070701_100039762 110
120 3300005438 Ga0070701_10019457 Ga0070701_100194572 110
121 3300005438 Ga0070701_10350485 Ga0070701_103504851 110
122 3300005439 Ga0070711_100035506 Ga0070711_1000355062 110
123 3300005440 Ga0070705_100537113 Ga0070705_1005371132 110
124 3300005441 Ga0070700_100039258 Ga0070700_1000392582 110
125 3300005444 Ga0070694_100290869 Ga0070694_1002908692 110
126 3300005455 Ga0070663_100023020 Ga0070663_1000230202 110
127 3300005456 Ga0070678_100256044 Ga0070678_1002560442 110
128 3300005456 Ga0070678_101351446 Ga0070678_1013514462 110
129 3300005457 Ga0070662_100377207 Ga0070662_1003772072 110
130 3300005466 Ga0070685_10147936 Ga0070685_101479362 110
131 3300005545 Ga0070695_100109638 Ga0070695_1001096382 110
132 3300005545 Ga0070695_100180347 Ga0070695_1001803472 110
133 3300005548 Ga0070665_100521516 Ga0070665_1005215162 110
134 3300005549 Ga0070704_100043391 Ga0070704_1000433912 110
135 3300005549 Ga0070704_102226609 Ga0070704_1022266091 110
136 3300005578 Ga0068854_100599021 Ga0068854_1005990212 110
137 3300005615 Ga0070702_100040356 Ga0070702_1000403562 110
138 3300005616 Ga0068852_101456109 Ga0068852_1014561091 110
139 3300005617 Ga0068859_100164185 Ga0068859_1001641852 110
140 3300005617 Ga0068859_100788886 Ga0068859_1007888862 110
141 3300005618 Ga0068864_100099465 Ga0068864_1000994651 110
142 3300005719 Ga0068861_100133501 Ga0068861_1001335012 110
143 3300005719 Ga0068861_100362115 Ga0068861_1003621152 110
144 3300005841 Ga0068863_100345519 Ga0068863_1003455191 110
145 3300005844 Ga0068862_100037276 Ga0068862_1000372763 110
146 3300005844 Ga0068862_100411710 Ga0068862_1004117102 110
147 3300005983 Ga0081540_1125321 Ga0081540_11253212 110
148 3300006028 Ga0070717_10046244 Ga0070717_100462442 110
149 3300006042 Ga0075368_10014521 Ga0075368_100145212 110
150 3300006042 Ga0075368_10132716 Ga0075368_101327162 110
151 3300006051 Ga0075364_10032384 Ga0075364_100323843 110
152 3300006178 Ga0075367_10038767 Ga0075367_100387672 110
153 3300006178 Ga0075367_10113834 Ga0075367_101138342 110
154 3300006195 Ga0075366_10047631 Ga0075366_100476312 110
155 3300006195 Ga0075366_10275724 Ga0075366_102757241 110
156 3300006353 Ga0075370_10039615 Ga0075370_100396152 110
157 3300006844 Ga0075428_100020131 Ga0075428_1000201312 110
158 3300006846 Ga0075430_100029418 Ga0075430_1000294182 110
159 3300006846 Ga0075430_100520032 Ga0075430_1005200322 110
160 3300006846 Ga0075430_101004870 Ga0075430_1010048701 110
161 3300006847 Ga0075431_100254020 Ga0075431_1002540202 110
162 3300006852 Ga0075433_10406339 Ga0075433_104063392 110
163 3300006871 Ga0075434_100847940 Ga0075434_1008479402 110
164 3300006871 Ga0075434_101168159 Ga0075434_1011681592 110
165 3300006931 Ga0097620_100164183 Ga0097620_1001641832 110
166 3300006931 Ga0097620_100788680 Ga0097620_1007886802 110
167 3300007076 Ga0075435_101019258 Ga0075435_1010192581 110
168 3300009093 Ga0105240_10210021 Ga0105240_102100212 110
169 3300009094 Ga0111539_10000854 Ga0111539_1000085424 110
170 3300009094 Ga0111539_10137585 Ga0111539_101375855 110
171 3300009094 Ga0111539_10167829 Ga0111539_101678293 110
172 3300009098 Ga0105245_10252040 Ga0105245_102520402 110
173 3300009101 Ga0105247_11216362 Ga0105247_112163621 110
174 3300009147 Ga0114129_10077910 Ga0114129_100779103 110
175 3300009147 Ga0114129_10172409 Ga0114129_101724093 110
176 3300009147 Ga0114129_10179508 Ga0114129_101795083 110
177 3300009148 Ga0105243_10063658 Ga0105243_100636582 110
178 3300009148 Ga0105243_10404495 Ga0105243_104044952 110
179 3300009148 Ga0105243_10757970 Ga0105243_107579702 110
180 3300009177 Ga0105248_10097791 Ga0105248_100977912 110
181 3300009177 Ga0105248_10100982 Ga0105248_101009823 110
182 3300009177 Ga0105248_10644802 Ga0105248_106448022 110
183 3300009545 Ga0105237_10385517 Ga0105237_103855172 110
184 3300009551 Ga0105238_12162732 Ga0105238_121627322 110
185 3300009553 Ga0105249_10027848 Ga0105249_100278482 110
186 3300009553 Ga0105249_10368975 Ga0105249_103689752 110
187 3300009553 Ga0105249_10845080 Ga0105249_108450802 110
188 3300010375 Ga0105239_10104901 Ga0105239_101049012 110
189 3300010375 Ga0105239_10344434 Ga0105239_103444342 110
190 3300011119 Ga0105246_11090170 Ga0105246_110901701 110
191 3300013104 Ga0157370_10035515 Ga0157370_100355152 110
192 3300013104 Ga0157370_11189515 Ga0157370_111895152 110
193 3300013306 Ga0163162_11947155 Ga0163162_119471552 110
194 3300013308 Ga0157375_10133285 Ga0157375_101332852 110
195 3300014325 Ga0163163_10291047 Ga0163163_102910472 110
196 3300014326 Ga0157380_10435444 Ga0157380_104354442 110
197 3300014326 Ga0157380_11819157 Ga0157380_118191571 110
198 3300014326 Ga0157380_12134866 Ga0157380_121348661 110
199 3300014745 Ga0157377_10009090 Ga0157377_100090902 110
200 3300014745 Ga0157377_10780369 Ga0157377_107803691 110
201 3300017792 Ga0163161_11939003 Ga0163161_119390031 110
202 3300025914 Ga0207671_10542889 Ga0207671_105428892 110
203 3300025914 Ga0207671_10631290 Ga0207671_106312901 110
204 3300025915 Ga0207693_10114627 Ga0207693_101146272 110
205 3300025916 Ga0207663_10009612 Ga0207663_100096122 110
206 3300025917 Ga0207660_10076770 Ga0207660_100767701 110
207 3300025917 Ga0207660_11284184 Ga0207660_112841841 110
208 3300025919 Ga0207657_10479862 Ga0207657_104798622 110
209 3300025920 Ga0207649_10754381 Ga0207649_107543811 110
210 3300025923 Ga0207681_10610852 Ga0207681_106108522 110
211 3300025925 Ga0207650_11312157 Ga0207650_113121572 110
212 3300025928 Ga0207700_10179390 Ga0207700_101793902 110
213 3300025929 Ga0207664_10069421 Ga0207664_100694213 110
214 3300025931 Ga0207644_10090311 Ga0207644_100903114 110
215 3300025933 Ga0207706_10582658 Ga0207706_105826582 110
216 3300025933 Ga0207706_10601673 Ga0207706_106016731 110
217 3300025935 Ga0207709_10257806 Ga0207709_102578062 110
218 3300025935 Ga0207709_11141821 Ga0207709_111418211 110
219 3300025936 Ga0207670_10250046 Ga0207670_102500462 110
220 3300025937 Ga0207669_11139627 Ga0207669_111396272 110
221 3300025938 Ga0207704_10147351 Ga0207704_101473512 110
222 3300025940 Ga0207691_10005638 Ga0207691_100056381 110
223 3300025941 Ga0207711_10075502 Ga0207711_100755022 110
224 3300025942 Ga0207689_10070338 Ga0207689_100703382 110
225 3300025944 Ga0207661_10515130 Ga0207661_105151302 110
226 3300025972 Ga0207668_10096314 Ga0207668_100963143 110
227 3300025972 Ga0207668_10789714 Ga0207668_107897142 110
228 3300026041 Ga0207639_12106678 Ga0207639_121066782 110
229 3300026088 Ga0207641_10298560 Ga0207641_102985601 110
230 3300026089 Ga0207648_11332141 Ga0207648_113321411 110
231 3300026095 Ga0207676_10470821 Ga0207676_104708212 110
232 3300026095 Ga0207676_11096656 Ga0207676_110966561 110
233 3300026118 Ga0207675_100036266 Ga0207675_1000362662 110
234 3300026118 Ga0207675_100063645 Ga0207675_1000636453 110
235 3300026118 Ga0207675_100151033 Ga0207675_1001510332 110
236 3300026142 Ga0207698_10091274 Ga0207698_100912742 110
237 3300027866 Ga0209813_10062357 Ga0209813_100623572 110
238 3300027866 Ga0209813_10072320 Ga0209813_100723202 110
239 3300027876 Ga0209974_10191499 Ga0209974_101914993 110
240 3300028379 Ga0268266_11297208 Ga0268266_112972082 110
241 3300028380 Ga0268265_10098311 Ga0268265_100983112 110
242 3300028380 Ga0268265_10508216 Ga0268265_105082162 110
243 3300028381 Ga0268264_10300697 Ga0268264_103006972 110
244 3300031344 Ga0265316_10883454 Ga0265316_108834542 110
245 3300031711 Ga0265314_10009776 Ga0265314_100097763 110
246 3300031911 Ga0307412_10976825 Ga0307412_109768251 110
247 3300032002 Ga0307416_101682910 Ga0307416_1016829102 110
248 3300032005 Ga0307411_10270586 Ga0307411_102705862 110
249 3300032005 Ga0307411_10459942 Ga0307411_104599422 110
250 3300035088 Ga0373940_0031472 Ga0373940_0031472_803_1147 110
251 3300035115 Ga0373941_0177313 Ga0373941_0177313_46_390 110
252 3300035695 Ga0373927_0004292 Ga0373927_0004292_3258_3614 110
253 3300035725 Ga0373947_0217917 Ga0373947_0217917_592_948 110
254 3300037418 Ga0395900_0291323 Ga0395900_0291323_79_432 110
255 3300037418 Ga0395900_0349719 Ga0395900_0349719_342_695 110
256 3300039447 Ga0436361_1105276 Ga0436361_1105276_392_736 110
257 3300041408 Ga0439453_0071760 Ga0439453_0071760_381_713 110
258 3300042010 Ga0439452_110930 Ga0439452_110930_119_472 110
259 3300042184 Ga0450908_002047 Ga0450908_002047_890_1243 110
260 3300042435 Ga0439434_0270915 Ga0439434_0270915_135_488 110
261 3300042436 Ga0439435_0037481 Ga0439435_0037481_793_1125 110
262 3300042461 Ga0439460_0054364 Ga0439460_0054364_681_1034 110
263 3300042993 Ga0439440_0204360 Ga0439440_0204360_75_428 110
264 3300045051 Ga0451576_0269218 Ga0451576_0269218_1369_1758 110
265 3300045051 Ga0451576_0508143 Ga0451576_0508143_326_670 110
266 3300045976 Ga0466967_1623312 Ga0466967_1623312_85_429 110
267 3300046472 Ga0495580_0055119 Ga0495580_0055119_111_467 110
268 3300046472 Ga0495580_0353082 Ga0495580_0353082_296_640 110
269 3300046615 Ga0495656_0227514 Ga0495656_0227514_508_852 110
270 3300048909 Ga0496106_0975077 Ga0496106_0975077_35_388 110
271 3300048909 Ga0496106_1017692 Ga0496106_1017692_277_636 110
272 3300048911 Ga0496108_0282156 Ga0496108_0282156_938_1291 110
273 3300048913 Ga0496110_0431436 Ga0496110_0431436_684_1043 110
274 3300048916 Ga0496113_0551030 Ga0496113_0551030_181_534 110
275 3300049572 Ga0501036_0786693 Ga0501036_0786693_382_735 110
276 3300049578 Ga0501042_0518901 Ga0501042_0518901_438_791 110
277 3300049578 Ga0501042_1193940 Ga0501042_1193940_107_460 110
278 3300049587 Ga0501071_0188955 Ga0501071_0188955_1016_1369 110
279 3300049587 Ga0501071_0691906 Ga0501071_0691906_126_458 110
280 3300049587 Ga0501071_1040064 Ga0501071_1040064_30_374 110
281 3300049588 Ga0501072_0024885 Ga0501072_0024885_3776_4129 110
282 3300049591 Ga0501075_0052679 Ga0501075_0052679_1580_1933 110
283 3300049592 Ga0501076_0614654 Ga0501076_0614654_414_767 110
284 3300049681 Ga0501251_084514 Ga0501251_084514_196_549 110
285 3300049741 Ga0501079_0877802 Ga0501079_0877802_156_509 110
286 3300049779 Ga0501283_000914 Ga0501283_000914_861_1214 110
287 3300050490 nmdc:mga03n38_396589_c1 nmdc:mga03n38_396589_c1_10_354 110
288 3300050491 nmdc:mga00v17_411344_c1 nmdc:mga00v17_411344_c1_10_354 110
289 3300050493 nmdc:mga0k408_172428_c1 nmdc:mga0k408_172428_c1_150_503 110
290 3300050493 nmdc:mga0k408_1878_c1 nmdc:mga0k408_1878_c1_9859_10203 110
291 3300050494 nmdc:mga06z11_46000_c1 nmdc:mga06z11_46000_c1_800_1153 110
292 3300050495 nmdc:mga04h51_30050_c1 nmdc:mga04h51_30050_c1_307_660 110
293 3300050496 nmdc:mga07m45_10097_c1 nmdc:mga07m45_10097_c1_653_1006 110
294 3300050496 nmdc:mga07m45_167504_c1 nmdc:mga07m45_167504_c1_791_1144 110
295 3300050507 nmdc:mga05p37_116359_c1 nmdc:mga05p37_116359_c1_1710_2054 110
296 3300050507 nmdc:mga05p37_148962_c1 nmdc:mga05p37_148962_c1_44_388 110
297 3300050507 nmdc:mga05p37_1596409_c1 nmdc:mga05p37_1596409_c1_85_438 110
298 3300050508 nmdc:mga09592_116310_c1 nmdc:mga09592_116310_c1_1837_2193 110
299 3300050508 nmdc:mga09592_1377215_c1 nmdc:mga09592_1377215_c1_171_515 110
300 3300050508 nmdc:mga09592_168279_c1 nmdc:mga09592_168279_c1_1473_1817 110
301 3300050509 nmdc:mga0qj67_1119539_c1 nmdc:mga0qj67_1119539_c1_98_442 110
302 3300050509 nmdc:mga0qj67_126717_c1 nmdc:mga0qj67_126717_c1_985_1338 110
303 3300050509 nmdc:mga0qj67_14590_c1 nmdc:mga0qj67_14590_c1_4841_5197 110
304 3300050509 nmdc:mga0qj67_580315_c1 nmdc:mga0qj67_580315_c1_503_847 110
305 3300050509 nmdc:mga0qj67_782925_c1 nmdc:mga0qj67_782925_c1_346_699 110
306 3300050510 nmdc:mga06r32_12967_c1 nmdc:mga06r32_12967_c1_233_577 110
307 3300050510 nmdc:mga06r32_142495_c1 nmdc:mga06r32_142495_c1_166_510 110
308 3300050510 nmdc:mga06r32_226784_c1 nmdc:mga06r32_226784_c1_287_631 110
309 3300050510 nmdc:mga06r32_421598_c1 nmdc:mga06r32_421598_c1_285_638 110
310 3300050510 nmdc:mga06r32_623912_c1 nmdc:mga06r32_623912_c1_284_628 110
311 3300050511 nmdc:mga08y16_21812_c1 nmdc:mga08y16_21812_c1_934_1278 110
312 3300050511 nmdc:mga08y16_5690_c1 nmdc:mga08y16_5690_c1_2809_3165 110
313 3300050512 nmdc:mga0n895_1003448_c1 nmdc:mga0n895_1003448_c1_160_513 110
314 3300050512 nmdc:mga0n895_933570_c1 nmdc:mga0n895_933570_c1_93_440 110
315 3300050513 nmdc:mga0rr50_1380_c1 nmdc:mga0rr50_1380_c1_511_855 110
316 3300050513 nmdc:mga0rr50_1434612_c1 nmdc:mga0rr50_1434612_c1_98_451 110
317 3300050513 nmdc:mga0rr50_28501_c1 nmdc:mga0rr50_28501_c1_2469_2822 110
318 3300050515 nmdc:mga0a205_183833_c1 nmdc:mga0a205_183833_c1_493_837 110
319 3300050515 nmdc:mga0a205_19417_c1 nmdc:mga0a205_19417_c1_1414_1767 110
320 3300050516 nmdc:mga0sz30_563233_c1 nmdc:mga0sz30_563233_c1_64_408 110
321 3300054114 Ga0501084_0369591 Ga0501084_0369591_767_1123 110
322 3300054114 Ga0501084_0829890 Ga0501084_0829890_325_657 110
323 3300054114 Ga0501084_0886058 Ga0501084_0886058_80_433 110
324 3300054114 Ga0501084_1766063 Ga0501084_1766063_82_435 110
325 3300059421 Ga0590071_069016 Ga0590071_069016_366_719 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

16

92

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9297 5 106
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.926 5 106
3elk-assembly1.cif.gz_B crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum 0.9143 5 107
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9091 5 106
5x11-assembly3.cif.gz_D crystal structure of bacillus subtilis padr in complex with operator dna 0.9061 12 89
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.926 5 106 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9232 15 81 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9091 5 106 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9059 12 89 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8939 5 107 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V9BJQ0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.977 1 80
AF-A0A2T2XH58-F1-model_v4 PadR family transcriptional regulator 0.974 11 104
AF-A0A1Y4VAC9-F1-model_v4 PadR family transcriptional regulator 0.969 5 89
AF-X1PAV8-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9687 4 83
AF-A0A4Q0SZP5-F1-model_v4 Transcriptional regulator, PadR family 0.9641 8 107

Feature Viewer

pLDDT pTM Quality
88.72 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map