F407667

General Info

Members Datasets Scaffolds Average Seq Length
325 207 651 305

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100005503|Ga0070670_1000055033
Length 340
Sequence MTVPRDPASRSVSDAVSGRRVPEAHPTGPVDPADFNRAFAIGIVLNLLFVAVEAFYGWKVDSLALLADAGHNLSDVAGLAVAWGGALAAGMRPDARYTYGRKRASILAAFANAVLLLVAMGSLAWEALGRLRVPQPPADGVTLMVVAGIGIVVNLGTALLFLRGRHGDLNVRGAFLHMAGDALVSAGVVVTGALALRFGWPWLDPAVSLVIALVIVLGTWSLFRQSLHLLFDGVPEGIDLHAVRRELEALPGVDRVHDLHVWATGTTETALTAHLVMPDVRADDHFLEDATRRLQARFRIGHVTLQVVREPFMALCADAVPPSSSPGLANESNRTGSIPS

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
192 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
195 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
196 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
205 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
206 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
207 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.92
Nodule 0
Rhizoplane 2.77
Rhizosphere 73.54
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100005503 3300005331 Bacteria 10686
2 rootH1_10016395 3300003316 Bacteria 5664
3 rootH1_10016395 3300003323 Bacteria 39282
4 Ga0070658_10336012 3300005327 Bacteria 1291
5 Ga0070676_10002874 3300005328 Bacteria 8894
6 Ga0070676_10011223 3300005328 Bacteria 4872
7 Ga0070683_100040677 3300005329 Bacteria 4274
8 Ga0070683_100181681 3300005329 Bacteria 1997
9 Ga0070670_100155998 3300005331 Bacteria 1977
10 Ga0070677_10001348 3300005333 Bacteria 7834
11 Ga0070677_10016579 3300005333 Bacteria 2626
12 Ga0070677_10093314 3300005333 Bacteria 1313
13 Ga0068869_100007456 3300005334 Bacteria 6995
14 Ga0068869_100197662 3300005334 Bacteria 1584
15 Ga0070680_100011528 3300005336 Bacteria 6840
16 Ga0068868_100100358 3300005338 Bacteria 2342
17 Ga0070660_100202683 3300005339 Bacteria 1609
18 Ga0070661_100148927 3300005344 Bacteria 1768
19 Ga0070668_100000387 3300005347 Bacteria 29141
20 Ga0070669_100013992 3300005353 Bacteria 5706
21 Ga0070675_100000811 3300005354 Bacteria 22016
22 Ga0070675_100002494 3300005354 Bacteria 13776
23 Ga0070675_100032057 3300005354 Bacteria 4250
24 Ga0070675_100053151 3300005354 Bacteria 3331
25 Ga0070675_100132339 3300005354 Bacteria 2126
26 Ga0070675_100201446 3300005354 Bacteria 1728
27 Ga0070671_100029734 3300005355 Bacteria 4506
28 Ga0070671_100043264 3300005355 Bacteria 3743
29 Ga0070671_100133172 3300005355 Bacteria 2094
30 Ga0070671_100158526 3300005355 Bacteria 1913
31 Ga0070674_100032959 3300005356 Bacteria 3444
32 Ga0070673_100009675 3300005364 Bacteria 6483
33 Ga0070673_100027447 3300005364 Bacteria 4221
34 Ga0070673_100180736 3300005364 Bacteria 1806
35 Ga0070667_100002072 3300005367 Bacteria 17742
36 Ga0070667_100024146 3300005367 Bacteria 5049
37 Ga0070663_100024312 3300005455 Bacteria 4075
38 Ga0070663_100185237 3300005455 Bacteria 1617
39 Ga0070678_100108731 3300005456 Bacteria 2165
40 Ga0070678_100278572 3300005456 Bacteria 1413
41 Ga0070662_100011370 3300005457 Bacteria 5875
42 Ga0070662_100064139 3300005457 Bacteria 2689
43 Ga0068867_100003441 3300005459 Bacteria 11133
44 Ga0068867_100017549 3300005459 Bacteria 5082
45 Ga0068867_100022167 3300005459 Bacteria 4538
46 Ga0070706_100003212 3300005467 Bacteria 16141
47 Ga0070707_100091325 3300005468 Bacteria 2948
48 Ga0070679_100013748 3300005530 Bacteria 7754
49 Ga0068853_100230003 3300005539 Bacteria 1696
50 Ga0070672_100005290 3300005543 Bacteria 8541
51 Ga0070665_100003128 3300005548 Bacteria 17825
52 Ga0070665_100012781 3300005548 Bacteria 8458
53 Ga0070664_100201548 3300005564 Bacteria 1776
54 Ga0068857_100061892 3300005577 Bacteria 3326
55 Ga0068857_100201061 3300005577 Bacteria 1816
56 Ga0068854_100002276 3300005578 Bacteria 11815
57 Ga0068854_100055466 3300005578 Bacteria 2853
58 Ga0068854_100105943 3300005578 Bacteria 2114
59 Ga0068852_100008274 3300005616 Bacteria 7654
60 Ga0068852_100155488 3300005616 Bacteria 2130
61 Ga0068859_100091336 3300005617 Bacteria 3095
62 Ga0068864_100006860 3300005618 Bacteria 9330
63 Ga0068864_100020590 3300005618 Bacteria 5518
64 Ga0068861_100007201 3300005719 Bacteria 7622
65 Ga0068851_10075809 3300005834 Bacteria 1748
66 Ga0068870_10010036 3300005840 Bacteria 4332
67 Ga0068863_100011702 3300005841 Bacteria 8485
68 Ga0068863_100230451 3300005841 Bacteria 1786
69 Ga0068858_100123069 3300005842 Bacteria 2427
70 Ga0068858_100306479 3300005842 Bacteria 1516
71 Ga0068858_100349778 3300005842 Bacteria 1416
72 Ga0068860_100309884 3300005843 Bacteria 1548
73 Ga0068862_100097846 3300005844 Bacteria 2562
74 Ga0075368_10002119 3300006042 Bacteria 6405
75 Ga0075368_10031925 3300006042 Bacteria 2044
76 Ga0075362_10004079 3300006177 Bacteria 5206
77 Ga0075362_10048350 3300006177 Bacteria 1898
78 Ga0075367_10004037 3300006178 Bacteria 7100
79 Ga0075366_10001252 3300006195 Bacteria 12602
80 Ga0075366_10024936 3300006195 Bacteria 3489
81 Ga0075366_10073292 3300006195 Bacteria 2041
82 Ga0097621_100011993 3300006237 Bacteria 6413
83 Ga0097621_100175287 3300006237 Bacteria 1850
84 Ga0075370_10000505 3300006353 Bacteria 14819
85 Ga0075370_10000533 3300006353 Bacteria 14584
86 Ga0075370_10000983 3300006353 Bacteria 11796
87 Ga0075370_10026902 3300006353 Bacteria 3189
88 Ga0075370_10058015 3300006353 Bacteria 2201
89 Ga0068871_100016332 3300006358 Bacteria 5588
90 Ga0068871_100016640 3300006358 Bacteria 5547
91 Ga0075434_100213250 3300006871 Bacteria 1951
92 Ga0097620_100091332 3300006931 Bacteria 3095
93 Ga0105240_10302027 3300009093 Bacteria 1831
94 Ga0105245_10019544 3300009098 Bacteria 5934
95 Ga0105245_10057984 3300009098 Bacteria 3485
96 Ga0105243_10045598 3300009148 Bacteria 3445
97 Ga0105241_10022727 3300009174 Bacteria 4647
98 Ga0105237_10045653 3300009545 Bacteria 4408
99 Ga0105238_10099811 3300009551 Bacteria 2886
100 Ga0105249_10100333 3300009553 Bacteria 2722
101 Ga0105239_10045083 3300010375 Bacteria 4833
102 Ga0105239_10070831 3300010375 Bacteria 3830
103 Ga0157371_10029521 3300013102 Bacteria 3963
104 Ga0157369_10695324 3300013105 Bacteria 1047
105 Ga0157374_10011182 3300013296 Bacteria 7758
106 Ga0163162_10082804 3300013306 Bacteria 3281
107 Ga0157372_10031358 3300013307 Bacteria 5821
108 Ga0157375_10037585 3300013308 Bacteria 4640
109 Ga0157375_10060676 3300013308 Bacteria 3752
110 Ga0157377_10006411 3300014745 Bacteria 5611
111 Ga0157376_10005452 3300014969 Bacteria 8893
112 Ga0163161_10268134 3300017792 Bacteria 1335
113 Ga0209026_1001241 3300025250 Bacteria 11674
114 Ga0207697_10017407 3300025315 Bacteria 2954
115 Ga0207682_10000902 3300025893 Bacteria 13752
116 Ga0207682_10079594 3300025893 Bacteria 1402
117 Ga0207688_10082591 3300025901 Bacteria 1836
118 Ga0207645_10002682 3300025907 Bacteria 13864
119 Ga0207645_10007284 3300025907 Bacteria 7824
120 Ga0207645_10033862 3300025907 Bacteria 3283
121 Ga0207643_10081971 3300025908 Bacteria 1870
122 Ga0207684_10001976 3300025910 Bacteria 21165
123 Ga0207671_10045353 3300025914 Bacteria 3251
124 Ga0207671_10083430 3300025914 Bacteria 2399
125 Ga0207660_10023759 3300025917 Bacteria 4142
126 Ga0207657_10139335 3300025919 Bacteria 1983
127 Ga0207652_10016775 3300025921 Bacteria 5984
128 Ga0207646_10040066 3300025922 Bacteria 4214
129 Ga0207650_10000580 3300025925 Bacteria 29427
130 Ga0207650_10019257 3300025925 Bacteria 4793
131 Ga0207650_10043291 3300025925 Bacteria 3304
132 Ga0207659_10002887 3300025926 Bacteria 10226
133 Ga0207659_10004403 3300025926 Bacteria 8512
134 Ga0207659_10013599 3300025926 Bacteria 5219
135 Ga0207659_10187568 3300025926 Bacteria 1643
136 Ga0207659_10297936 3300025926 Bacteria 1323
137 Ga0207687_10009282 3300025927 Bacteria 6434
138 Ga0207644_10003339 3300025931 Bacteria 10351
139 Ga0207644_10015161 3300025931 Bacteria 5171
140 Ga0207644_10020707 3300025931 Bacteria 4475
141 Ga0207644_10101367 3300025931 Bacteria 2163
142 Ga0207706_10004799 3300025933 Bacteria 12661
143 Ga0207709_10035286 3300025935 Bacteria 2956
144 Ga0207669_10009375 3300025937 Bacteria 4658
145 Ga0207669_10028042 3300025937 Bacteria 3092
146 Ga0207691_10026833 3300025940 Bacteria 5404
147 Ga0207689_10001372 3300025942 Bacteria 23344
148 Ga0207689_10030787 3300025942 Bacteria 4471
149 Ga0207689_10120524 3300025942 Bacteria 2158
150 Ga0207661_10102204 3300025944 Bacteria 2409
151 Ga0207679_10166911 3300025945 Bacteria 1808
152 Ga0207679_10229017 3300025945 Bacteria 1568
153 Ga0207651_10013527 3300025960 Bacteria 4673
154 Ga0207651_10014111 3300025960 Bacteria 4601
155 Ga0207712_10108196 3300025961 Bacteria 2080
156 Ga0207668_10000019 3300025972 Bacteria 152108
157 Ga0207640_10008779 3300025981 Bacteria 5627
158 Ga0207640_10046154 3300025981 Bacteria 2801
159 Ga0207658_10008774 3300025986 Bacteria 6864
160 Ga0207658_10087666 3300025986 Bacteria 2404
161 Ga0207677_10001471 3300026023 Bacteria 12473
162 Ga0207677_10023806 3300026023 Bacteria 3790
163 Ga0207677_10024773 3300026023 Bacteria 3733
164 Ga0207703_10053286 3300026035 Bacteria 3288
165 Ga0207703_10277524 3300026035 Bacteria 1521
166 Ga0207703_10303542 3300026035 Bacteria 1457
167 Ga0207639_10044585 3300026041 Bacteria 3336
168 Ga0207678_10007734 3300026067 Bacteria 9495
169 Ga0207702_10056465 3300026078 Bacteria 3334
170 Ga0207702_10464933 3300026078 Bacteria 1229
171 Ga0207641_10048710 3300026088 Bacteria 3578
172 Ga0207648_10003099 3300026089 Bacteria 17554
173 Ga0207648_10003741 3300026089 Bacteria 15906
174 Ga0207676_10013888 3300026095 Bacteria 5782
175 Ga0207676_10020756 3300026095 Bacteria 4810
176 Ga0207676_10027635 3300026095 Bacteria 4228
177 Ga0207674_10028708 3300026116 Bacteria 5868
178 Ga0207675_100005156 3300026118 Bacteria 12584
179 Ga0207683_10004944 3300026121 Bacteria 11467
180 Ga0207698_10171997 3300026142 Bacteria 1909
181 Ga0207698_10252525 3300026142 Bacteria 1615
182 Ga0268266_10002885 3300028379 Bacteria 17854
183 Ga0268266_10035150 3300028379 Bacteria 4262
184 Ga0268264_10224964 3300028381 Bacteria 1729
185 Ga0307517_10000394 3300028786 Bacteria 74695
186 Ga0307517_10002371 3300028786 Bacteria 30326
187 Ga0307517_10068490 3300028786 Bacteria 3232
188 Ga0307517_10097433 3300028786 Bacteria 2348
189 Ga0307515_10034576 3300028794 Bacteria 8264
190 Ga0307515_10048040 3300028794 Bacteria 6464
191 Ga0265324_10000205 3300029957 Bacteria 45035
192 Ga0307512_10018166 3300030522 Bacteria 6430
193 Ga0307512_10108949 3300030522 Bacteria 1835
194 Ga0265332_10000037 3300031238 Bacteria 134250
195 Ga0265328_10006004 3300031239 Bacteria 5172
196 Ga0265320_10037383 3300031240 Bacteria 2445
197 Ga0265325_10012582 3300031241 Bacteria 4834
198 Ga0265331_10001917 3300031250 Bacteria 14580
199 Ga0265327_10016337 3300031251 Bacteria 4718
200 Ga0265327_10023943 3300031251 Unclassified 3599
201 Ga0265316_10016992 3300031344 Bacteria 6300
202 Ga0265316_10270778 3300031344 Bacteria 1243
203 Ga0307513_10032604 3300031456 Bacteria 5871
204 Ga0307513_10091581 3300031456 Bacteria 3098
205 Ga0307513_10097702 3300031456 Bacteria 2971
206 Ga0307513_10182027 3300031456 Bacteria 1963
207 Ga0307509_10001869 3300031507 Bacteria 34796
208 Ga0307509_10014864 3300031507 Bacteria 9124
209 Ga0307509_10052233 3300031507 Bacteria 4364
210 Ga0307509_10147664 3300031507 Bacteria 2273
211 Ga0307508_10000150 3300031616 Bacteria 83110
212 Ga0307508_10003594 3300031616 Bacteria 15591
213 Ga0307508_10076742 3300031616 Bacteria 2919
214 Ga0307514_10008353 3300031649 Bacteria 8836
215 Ga0265314_10000740 3300031711 Bacteria 39277
216 Ga0265314_10008059 3300031711 Bacteria 9068
217 Ga0307516_10001680 3300031730 Bacteria 30456
218 Ga0307516_10041912 3300031730 Bacteria 4545
219 Ga0307516_10045381 3300031730 Bacteria 4341
220 Ga0307405_10015836 3300031731 Bacteria 4094
221 Ga0307413_10127203 3300031824 Bacteria 1737
222 Ga0307406_10006930 3300031901 Bacteria 6276
223 Ga0307412_10002558 3300031911 Bacteria 10107
224 Ga0307409_100001798 3300031995 Bacteria 10845
225 Ga0307409_100168538 3300031995 Bacteria 1925
226 Ga0307416_100130733 3300032002 Bacteria 2259
227 Ga0307416_100151368 3300032002 Bacteria 2128
228 Ga0307411_10355871 3300032005 Bacteria 1195
229 Ga0307415_100034430 3300032126 Bacteria 3298
230 Ga0307415_100089606 3300032126 Bacteria 2222
231 Ga0307507_10042869 3300033179 Bacteria 4499
232 Ga0307510_10000360 3300033180 Bacteria 42908
233 Ga0373960_0021481 3300035121 Bacteria 1717
234 Ga0373946_0096354 3300035171 Bacteria 1319
235 Ga0373931_0005739 3300035691 Bacteria 5767
236 Ga0373933_0120202 3300035724 Bacteria 1645
237 Ga0395899_0010271 3300037312 Bacteria 7176
238 Ga0395900_0030783 3300037418 Bacteria 5511
239 Ga0395898_0037189 3300037466 Bacteria 4830
240 Ga0436364_1102035 3300037853 Bacteria 2407
241 Ga0395901_0040356 3300038443 Bacteria 4833
242 Ga0436365_1045043 3300039437 Bacteria 3188
243 Ga0451577_0010403 3300042876 Bacteria 8898
244 Ga0451577_0043679 3300042876 Bacteria 4014
245 Ga0453683_0003052 3300044673 Bacteria 12538
246 Ga0453684_0013764 3300044712 Bacteria 13080
247 Ga0453684_0027491 3300044712 Bacteria 8155
248 Ga0453684_0177518 3300044712 Bacteria 2503
249 Ga0466957_0136699 3300044842 Bacteria 1576
250 Ga0451576_0004366 3300045051 Bacteria 18441
251 Ga0451576_0017689 3300045051 Bacteria 7835
252 Ga0451576_0075815 3300045051 Bacteria 3500
253 Ga0451576_0119061 3300045051 Bacteria 2749
254 Ga0495592_0000145 3300046454 Bacteria 62850
255 Ga0495643_0138148 3300046522 Bacteria 1218
256 Ga0495598_0064335 3300046537 Bacteria 1139
257 Ga0495597_0023805 3300046542 Bacteria 2831
258 Ga0495645_0017626 3300046543 Bacteria 5117
259 Ga0495668_0037292 3300046616 Bacteria 2720
260 Ga0495625_0012800 3300046660 Bacteria 6782
261 Ga0495625_0086942 3300046660 Bacteria 2168
262 Ga0495647_0045227 3300046681 Bacteria 1691
263 Ga0495658_0207895 3300046683 Bacteria 1222
264 Ga0495669_0076481 3300046684 Bacteria 1532
265 Ga0495613_0000559 3300046689 Bacteria 30599
266 Ga0495649_0022635 3300046694 Bacteria 3516
267 Ga0495660_0009993 3300046810 Bacteria 5521
268 Ga0495687_002674 3300047443 Bacteria 13880
269 Ga0495687_012461 3300047443 Bacteria 4494
270 Ga0495593_0125960 3300047673 Bacteria 1302
271 Ga0496101_0056855 3300048904 Bacteria 2828
272 Ga0496102_0030746 3300048905 Bacteria 4808
273 Ga0496106_0027054 3300048909 Bacteria 4270
274 Ga0496107_0039938 3300048910 Bacteria 3367
275 Ga0496110_0011602 3300048913 Bacteria 7223
276 Ga0496110_0032095 3300048913 Bacteria 4533
277 Ga0496114_0022175 3300048917 Bacteria 5173
278 Ga0496114_0029409 3300048917 Bacteria 4516
279 Ga0496115_0030737 3300048918 Bacteria 4227
280 Ga0496118_0028623 3300048921 Bacteria 4688
281 Ga0496121_0000078 3300048924 Bacteria 233455
282 Ga0496126_0013746 3300048929 Bacteria 8210
283 Ga0496126_0057963 3300048929 Bacteria 3493
284 Ga0501033_0119673 3300049570 Bacteria 1912
285 Ga0501034_0048718 3300049571 Bacteria 4276
286 Ga0501034_0092626 3300049571 Bacteria 3019
287 Ga0501036_0230399 3300049572 Bacteria 1555
288 Ga0501038_0098720 3300049574 Bacteria 2435
289 Ga0501047_0099411 3300049581 Bacteria 2788
290 Ga0501047_0173493 3300049581 Bacteria 2025
291 Ga0501070_0159062 3300049586 Bacteria 1863
292 Ga0501044_0070986 3300049823 Bacteria 3542
293 nmdc:mga03683_3203_c1 3300050489 Bacteria 5232
294 nmdc:mga03683_32980_c1 3300050489 Bacteria 2086
295 nmdc:mga0yw44_200578_c1 3300050492 Bacteria 1317
296 nmdc:mga0k408_12958_c1 3300050493 Bacteria 4565
297 nmdc:mga0k408_1837_c1 3300050493 Bacteria 11392
298 nmdc:mga0k408_27059_c1 3300050493 Bacteria 3255
299 nmdc:mga0k408_46296_c1 3300050493 Bacteria 2512
300 nmdc:mga0k408_57903_c1 3300050493 Bacteria 2250
301 nmdc:mga0k408_8189_c1 3300050493 Bacteria 5603
302 nmdc:mga06z11_214390_c1 3300050494 Bacteria 1123
303 nmdc:mga07m45_118740_c1 3300050496 Bacteria 1527
304 nmdc:mga07m45_2072_c1 3300050496 Bacteria 9311
305 nmdc:mga07m45_50459_c1 3300050496 Bacteria 2345
306 nmdc:mga0n895_175112_c1 3300050512 Bacteria 2176
307 Ga0495619_0171843 3300053085 Bacteria 1499
308 Ga0500578_0099134 3300053086 Bacteria 1845
309 Ga0500555_011888 3300053103 Bacteria 2503
310 Ga0500556_0003618 3300053104 Bacteria 4501
311 Ga0500593_107204 3300053117 Bacteria 1155
312 Ga0500595_016826 3300053119 Bacteria 2716
313 Ga0500652_125628 3300053131 Bacteria 1071
314 Ga0500658_0018775 3300053134 Bacteria 2597
315 Ga0500559_0000107 3300053136 Bacteria 65560
316 Ga0500568_0049958 3300053139 Bacteria 1649
317 Ga0500619_034772 3300053154 Bacteria 1559
318 Ga0500622_0004859 3300053156 Bacteria 8234
319 Ga0500636_0037579 3300053177 Bacteria 2865
320 Ga0500636_0062503 3300053177 Bacteria 2171
321 Ga0500645_001321 3300053730 Bacteria 12861
322 Ga0500587_002450 3300053739 Bacteria 2638
323 Ga0500587_004859 3300053739 Bacteria 1833
324 2644305573 2643221654 Bacteria 5273570
325 2919708909 2919704043 Bacteria 5560311
326 8055226676 8055225921 Bacteria 3341787
327 Ga0070670_100005503
328 rootH1_10016395
329 Ga0070658_10336012
330 Ga0070676_10002874
331 Ga0070676_10011223
332 Ga0070683_100040677
333 Ga0070683_100181681
334 Ga0070670_100155998
335 Ga0070677_10001348
336 Ga0070677_10016579
337 Ga0070677_10093314
338 Ga0068869_100007456
339 Ga0068869_100197662
340 Ga0070680_100011528
341 Ga0068868_100100358
342 Ga0070660_100202683
343 Ga0070661_100148927
344 Ga0070668_100000387
345 Ga0070669_100013992
346 Ga0070675_100000811
347 Ga0070675_100002494
348 Ga0070675_100032057
349 Ga0070675_100053151
350 Ga0070675_100132339
351 Ga0070675_100201446
352 Ga0070671_100029734
353 Ga0070671_100043264
354 Ga0070671_100133172
355 Ga0070671_100158526
356 Ga0070674_100032959
357 Ga0070673_100009675
358 Ga0070673_100027447
359 Ga0070673_100180736
360 Ga0070667_100002072
361 Ga0070667_100024146
362 Ga0070663_100024312
363 Ga0070663_100185237
364 Ga0070678_100108731
365 Ga0070678_100278572
366 Ga0070662_100011370
367 Ga0070662_100064139
368 Ga0068867_100003441
369 Ga0068867_100017549
370 Ga0068867_100022167
371 Ga0070706_100003212
372 Ga0070707_100091325
373 Ga0070679_100013748
374 Ga0068853_100230003
375 Ga0070672_100005290
376 Ga0070665_100003128
377 Ga0070665_100012781
378 Ga0070664_100201548
379 Ga0068857_100061892
380 Ga0068857_100201061
381 Ga0068854_100002276
382 Ga0068854_100055466
383 Ga0068854_100105943
384 Ga0068852_100008274
385 Ga0068852_100155488
386 Ga0068859_100091336
387 Ga0068864_100006860
388 Ga0068864_100020590
389 Ga0068861_100007201
390 Ga0068851_10075809
391 Ga0068870_10010036
392 Ga0068863_100011702
393 Ga0068863_100230451
394 Ga0068858_100123069
395 Ga0068858_100306479
396 Ga0068858_100349778
397 Ga0068860_100309884
398 Ga0068862_100097846
399 Ga0075368_10002119
400 Ga0075368_10031925
401 Ga0075362_10004079
402 Ga0075362_10048350
403 Ga0075367_10004037
404 Ga0075366_10001252
405 Ga0075366_10024936
406 Ga0075366_10073292
407 Ga0097621_100011993
408 Ga0097621_100175287
409 Ga0075370_10000505
410 Ga0075370_10000533
411 Ga0075370_10000983
412 Ga0075370_10026902
413 Ga0075370_10058015
414 Ga0068871_100016332
415 Ga0068871_100016640
416 Ga0075434_100213250
417 Ga0097620_100091332
418 Ga0105240_10302027
419 Ga0105245_10019544
420 Ga0105245_10057984
421 Ga0105243_10045598
422 Ga0105241_10022727
423 Ga0105237_10045653
424 Ga0105238_10099811
425 Ga0105249_10100333
426 Ga0105239_10045083
427 Ga0105239_10070831
428 Ga0157371_10029521
429 Ga0157369_10695324
430 Ga0157374_10011182
431 Ga0163162_10082804
432 Ga0157372_10031358
433 Ga0157375_10037585
434 Ga0157375_10060676
435 Ga0157377_10006411
436 Ga0157376_10005452
437 Ga0163161_10268134
438 Ga0209026_1001241
439 Ga0207697_10017407
440 Ga0207682_10000902
441 Ga0207682_10079594
442 Ga0207688_10082591
443 Ga0207645_10002682
444 Ga0207645_10007284
445 Ga0207645_10033862
446 Ga0207643_10081971
447 Ga0207684_10001976
448 Ga0207671_10045353
449 Ga0207671_10083430
450 Ga0207660_10023759
451 Ga0207657_10139335
452 Ga0207652_10016775
453 Ga0207646_10040066
454 Ga0207650_10000580
455 Ga0207650_10019257
456 Ga0207650_10043291
457 Ga0207659_10002887
458 Ga0207659_10004403
459 Ga0207659_10013599
460 Ga0207659_10187568
461 Ga0207659_10297936
462 Ga0207687_10009282
463 Ga0207644_10003339
464 Ga0207644_10015161
465 Ga0207644_10020707
466 Ga0207644_10101367
467 Ga0207706_10004799
468 Ga0207709_10035286
469 Ga0207669_10009375
470 Ga0207669_10028042
471 Ga0207691_10026833
472 Ga0207689_10001372
473 Ga0207689_10030787
474 Ga0207689_10120524
475 Ga0207661_10102204
476 Ga0207679_10166911
477 Ga0207679_10229017
478 Ga0207651_10013527
479 Ga0207651_10014111
480 Ga0207712_10108196
481 Ga0207668_10000019
482 Ga0207640_10008779
483 Ga0207640_10046154
484 Ga0207658_10008774
485 Ga0207658_10087666
486 Ga0207677_10001471
487 Ga0207677_10023806
488 Ga0207677_10024773
489 Ga0207703_10053286
490 Ga0207703_10277524
491 Ga0207703_10303542
492 Ga0207639_10044585
493 Ga0207678_10007734
494 Ga0207702_10056465
495 Ga0207702_10464933
496 Ga0207641_10048710
497 Ga0207648_10003099
498 Ga0207648_10003741
499 Ga0207676_10013888
500 Ga0207676_10020756
501 Ga0207676_10027635
502 Ga0207674_10028708
503 Ga0207675_100005156
504 Ga0207683_10004944
505 Ga0207698_10171997
506 Ga0207698_10252525
507 Ga0268266_10002885
508 Ga0268266_10035150
509 Ga0268264_10224964
510 Ga0307517_10000394
511 Ga0307517_10002371
512 Ga0307517_10068490
513 Ga0307517_10097433
514 Ga0307515_10034576
515 Ga0307515_10048040
516 Ga0265324_10000205
517 Ga0307512_10018166
518 Ga0307512_10108949
519 Ga0265332_10000037
520 Ga0265328_10006004
521 Ga0265320_10037383
522 Ga0265325_10012582
523 Ga0265331_10001917
524 Ga0265327_10016337
525 Ga0265327_10023943
526 Ga0265316_10016992
527 Ga0265316_10270778
528 Ga0307513_10032604
529 Ga0307513_10091581
530 Ga0307513_10097702
531 Ga0307513_10182027
532 Ga0307509_10001869
533 Ga0307509_10014864
534 Ga0307509_10052233
535 Ga0307509_10147664
536 Ga0307508_10000150
537 Ga0307508_10003594
538 Ga0307508_10076742
539 Ga0307514_10008353
540 Ga0265314_10000740
541 Ga0265314_10008059
542 Ga0307516_10001680
543 Ga0307516_10041912
544 Ga0307516_10045381
545 Ga0307405_10015836
546 Ga0307413_10127203
547 Ga0307406_10006930
548 Ga0307412_10002558
549 Ga0307409_100001798
550 Ga0307409_100168538
551 Ga0307416_100130733
552 Ga0307416_100151368
553 Ga0307411_10355871
554 Ga0307415_100034430
555 Ga0307415_100089606
556 Ga0307507_10042869
557 Ga0307510_10000360
558 Ga0373960_0021481
559 Ga0373946_0096354
560 Ga0373931_0005739
561 Ga0373933_0120202
562 Ga0395899_0010271
563 Ga0395900_0030783
564 Ga0395898_0037189
565 Ga0436364_1102035
566 Ga0395901_0040356
567 Ga0436365_1045043
568 Ga0451577_0010403
569 Ga0451577_0043679
570 Ga0453683_0003052
571 Ga0453684_0013764
572 Ga0453684_0027491
573 Ga0453684_0177518
574 Ga0466957_0136699
575 Ga0451576_0004366
576 Ga0451576_0017689
577 Ga0451576_0075815
578 Ga0451576_0119061
579 Ga0495592_0000145
580 Ga0495643_0138148
581 Ga0495598_0064335
582 Ga0495597_0023805
583 Ga0495645_0017626
584 Ga0495668_0037292
585 Ga0495625_0012800
586 Ga0495625_0086942
587 Ga0495647_0045227
588 Ga0495658_0207895
589 Ga0495669_0076481
590 Ga0495613_0000559
591 Ga0495649_0022635
592 Ga0495660_0009993
593 Ga0495687_002674
594 Ga0495687_012461
595 Ga0495593_0125960
596 Ga0496101_0056855
597 Ga0496102_0030746
598 Ga0496106_0027054
599 Ga0496107_0039938
600 Ga0496110_0011602
601 Ga0496110_0032095
602 Ga0496114_0022175
603 Ga0496114_0029409
604 Ga0496115_0030737
605 Ga0496118_0028623
606 Ga0496121_0000078
607 Ga0496126_0013746
608 Ga0496126_0057963
609 Ga0501033_0119673
610 Ga0501034_0048718
611 Ga0501034_0092626
612 Ga0501036_0230399
613 Ga0501038_0098720
614 Ga0501047_0099411
615 Ga0501047_0173493
616 Ga0501070_0159062
617 Ga0501044_0070986
618 nmdc:mga03683_3203_c1
619 nmdc:mga03683_32980_c1
620 nmdc:mga0yw44_200578_c1
621 nmdc:mga0k408_12958_c1
622 nmdc:mga0k408_1837_c1
623 nmdc:mga0k408_27059_c1
624 nmdc:mga0k408_46296_c1
625 nmdc:mga0k408_57903_c1
626 nmdc:mga0k408_8189_c1
627 nmdc:mga06z11_214390_c1
628 nmdc:mga07m45_118740_c1
629 nmdc:mga07m45_2072_c1
630 nmdc:mga07m45_50459_c1
631 nmdc:mga0n895_175112_c1
632 Ga0495619_0171843
633 Ga0500578_0099134
634 Ga0500555_011888
635 Ga0500556_0003618
636 Ga0500593_107204
637 Ga0500595_016826
638 Ga0500652_125628
639 Ga0500658_0018775
640 Ga0500559_0000107
641 Ga0500568_0049958
642 Ga0500619_034772
643 Ga0500622_0004859
644 Ga0500636_0037579
645 Ga0500636_0062503
646 Ga0500645_001321
647 Ga0500587_002450
648 Ga0500587_004859
649 2644305573
650 2919708909
651 8055226676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01545

Cation_efflux

Cation efflux family

39

231

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xpf-assembly1.cif.gz_A cryo-em structure of human znt8 wt, in the absence of zinc, determined in heterogeneous conformations- one subunit in an inward-facing and the other in an outward-facing conformation 0.8866 2 268
6vd9-assembly2.cif.gz_B metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans 0.8839 198 268
6vd8-assembly1.cif.gz_B-2 metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa 0.8597 198 271
6vd9-assembly2.cif.gz_B metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans 0.8511 198 268
6vd8-assembly1.cif.gz_A metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa 0.8288 192 271
ID Description Score Start End Superfamily
af_P75757_17_213_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9379 2 188 1.20.1510.10
af_Q2FWA9_216_326_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.9174 192 268 3.30.70.1350
af_Q9M271_29_255_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9165 2 188 1.20.1510.10
af_O35149_110_332_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9141 2 187 1.20.1510.10
af_Q6DBM8_296_375_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.9002 192 268 3.30.70.1350
ID Description Score Start End GO Terms
AF-A0A4Q2RFN1-F1-model_v4 Cation transporter 0.9663 2 270 GO:0005385
GO:0005886
AF-A0A5C6FB96-F1-model_v4 Cadmium, cobalt and zinc/H(+)-K(+) antiporter 0.9516 2 280 GO:0005385
GO:0005886
AF-A0A2T4CSY2-F1-model_v4 Cation transporter 0.9512 4 191 GO:0005385
GO:0005886
AF-A0A3M8B4U8-F1-model_v4 Cation transporter 0.9502 2 268 GO:0005385
GO:0005886
AF-A0A350SKD4-F1-model_v4 deleted 0.95 2 270

Map