F407669

General Info

Members Datasets Scaffolds Average Seq Length
325 163 650 277

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100009577|Ga0068869_1000095774
Length 304
Sequence MQTGKMAGDLRHLSGQRKVKHSFILKLPGMANFNLTSQQVSDYNSDGYIIIRNFLQKEEVDKLYHIAIEDDTMQKHSFDLNDQTGKKTKLALWYTPGNDAYGLLTKSRRMIDAVDKLMEGDSAVCHFHSKLMQKEPKVGGAWEWHQDYGYWYKNEFLLPNQMMSVMIAITAANKQNGCLQVIKGTHKMGRIEHGFAGEQVGASQHYVDLALKTMELVYVELMPGDALFFHSNLLHRSAANLSDNSRWSLISCYNRSANIPYNEPSASSTIPLEAVPDEALLQWETKGLGDSANFLEKEKDEALK

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
134 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
152 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
163 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.77
Nodule 0
Rhizoplane 0
Rhizosphere 94.15
Stem 0
Stem Tuber 0
Unclassified 6.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100009577 3300005334 Bacteria 6291
2 JGI24740J21852_10002630 3300001979 Bacteria 8086
3 JGI24739J22299_10010586 3300001989 Bacteria 3422
4 JGI25154J39366_1000007 3300002738 Bacteria 335932
5 JGI25153J46596_10000504 3300003215 Bacteria 24851
6 rootH2_10000086 3300003320 Bacteria 48758
7 rootH2_10011701 3300003320 Bacteria 9654
8 rootH2_10012061 3300003320 Bacteria 49051
9 rootH2_10130711 3300003320 Bacteria 4291
10 rootL2_10058418 3300003322 Bacteria 21138
11 JGI25160J50197_1005566 3300003354 Bacteria 5225
12 Ga0065712_10068858 3300005290 Bacteria 8735
13 Ga0065712_10140653 3300005290 Bacteria 1453
14 Ga0070658_10038567 3300005327 Bacteria 3852
15 Ga0070658_10130421 3300005327 Bacteria 2095
16 Ga0070676_10091106 3300005328 Bacteria 1868
17 Ga0070683_100023035 3300005329 Bacteria 5569
18 Ga0068869_100423281 3300005334 Unclassified 1099
19 Ga0070666_10000156 3300005335 Bacteria 47136
20 Ga0070680_100002502 3300005336 Bacteria 13614
21 Ga0068868_100130119 3300005338 Bacteria 2059
22 Ga0070660_100002765 3300005339 Bacteria 12054
23 Ga0070660_100063058 3300005339 Bacteria 2880
24 Ga0070660_100165811 3300005339 Bacteria 1782
25 Ga0070660_100257896 3300005339 Unclassified 1423
26 Ga0070689_100074210 3300005340 Bacteria 2661
27 Ga0070689_100160676 3300005340 Bacteria 1816
28 Ga0070691_10026315 3300005341 Bacteria 2711
29 Ga0070691_10032087 3300005341 Unclassified 2466
30 Ga0070668_100132745 3300005347 Bacteria 2000
31 Ga0070668_100525832 3300005347 Bacteria 1027
32 Ga0070669_100114341 3300005353 Unclassified 2052
33 Ga0070675_100450576 3300005354 Bacteria 1154
34 Ga0070671_100039395 3300005355 Bacteria 3922
35 Ga0070659_100008306 3300005366 Bacteria 7580
36 Ga0070659_100024655 3300005366 Unclassified 4613
37 Ga0070659_100480482 3300005366 Bacteria 1057
38 Ga0070667_100103146 3300005367 Bacteria 2465
39 Ga0070667_100138852 3300005367 Bacteria 2126
40 Ga0070663_100005240 3300005455 Bacteria 7682
41 Ga0070663_100007631 3300005455 Bacteria 6599
42 Ga0070663_100122385 3300005455 Bacteria 1967
43 Ga0070681_10005612 3300005458 Bacteria 12126
44 Ga0070681_10043871 3300005458 Unclassified 4476
45 Ga0068867_100062659 3300005459 Bacteria 2763
46 Ga0070685_10006615 3300005466 Bacteria 5913
47 Ga0070679_100076781 3300005530 Bacteria 3329
48 Ga0070679_100081152 3300005530 Bacteria 3232
49 Ga0070679_100325299 3300005530 Bacteria 1486
50 Ga0070684_100083955 3300005535 Bacteria 2823
51 Ga0070684_100396569 3300005535 Bacteria 1272
52 Ga0068853_100008359 3300005539 Bacteria 8310
53 Ga0068853_100108434 3300005539 Bacteria 2463
54 Ga0068855_100011365 3300005563 Bacteria 10748
55 Ga0068855_100045137 3300005563 Bacteria 5212
56 Ga0068855_100059205 3300005563 Bacteria 4482
57 Ga0068855_100114823 3300005563 Bacteria 3087
58 Ga0068855_100370342 3300005563 Bacteria 1575
59 Ga0068855_100390567 3300005563 Bacteria 1526
60 Ga0068855_100731917 3300005563 Bacteria 1056
61 Ga0068857_100194065 3300005577 Bacteria 1850
62 Ga0068857_100480919 3300005577 Bacteria 1164
63 Ga0068854_100103631 3300005578 Unclassified 2136
64 Ga0068856_100011272 3300005614 Bacteria 8676
65 Ga0068856_100046985 3300005614 Bacteria 4252
66 Ga0068852_100006114 3300005616 Bacteria 8681
67 Ga0068852_100135577 3300005616 Bacteria 2272
68 Ga0068852_100213697 3300005616 Bacteria 1831
69 Ga0068852_100350768 3300005616 Bacteria 1441
70 Ga0068852_100816483 3300005616 Bacteria 947
71 Ga0068852_100865497 3300005616 Bacteria 920
72 Ga0068859_100000024 3300005617 Bacteria 217931
73 Ga0068859_100009051 3300005617 Bacteria 10060
74 Ga0068859_100813144 3300005617 Bacteria 1022
75 Ga0068864_100112016 3300005618 Bacteria 2432
76 Ga0068864_100207604 3300005618 Bacteria 1802
77 Ga0068851_10014050 3300005834 Bacteria 3796
78 Ga0068863_100005289 3300005841 Bacteria 12745
79 Ga0068863_100013768 3300005841 Bacteria 7795
80 Ga0068863_100021533 3300005841 Bacteria 6152
81 Ga0068863_100027954 3300005841 Bacteria 5383
82 Ga0068858_100001337 3300005842 Bacteria 25427
83 Ga0068858_100024689 3300005842 Bacteria 5598
84 Ga0068860_100063456 3300005843 Bacteria 3509
85 Ga0081540_1002517 3300005983 Bacteria 14879
86 Ga0070715_10101088 3300006163 Bacteria 1345
87 Ga0075366_10259975 3300006195 Bacteria 1059
88 Ga0097621_100011501 3300006237 Bacteria 6520
89 Ga0097621_100012295 3300006237 Bacteria 6335
90 Ga0097621_100070799 3300006237 Bacteria 2880
91 Ga0097621_100320578 3300006237 Bacteria 1373
92 Ga0097621_100463759 3300006237 Bacteria 1143
93 Ga0068871_100008693 3300006358 Bacteria 7306
94 Ga0068871_100162650 3300006358 Bacteria 1910
95 Ga0075428_100282979 3300006844 Unclassified 1784
96 Ga0075431_100070989 3300006847 Unclassified 3592
97 Ga0075429_100005482 3300006880 Bacteria 10930
98 Ga0068865_100337333 3300006881 Bacteria 1217
99 Ga0068865_100646166 3300006881 Bacteria 899
100 Ga0097620_100000024 3300006931 Bacteria 217931
101 Ga0097620_100009051 3300006931 Bacteria 10060
102 Ga0097620_100813248 3300006931 Bacteria 1022
103 Ga0105240_10001825 3300009093 Bacteria 35720
104 Ga0105240_10003650 3300009093 Bacteria 23830
105 Ga0105240_10049758 3300009093 Bacteria 5287
106 Ga0105240_10061512 3300009093 Bacteria 4679
107 Ga0111539_10030420 3300009094 Bacteria 6562
108 Ga0111539_10112304 3300009094 Bacteria 3197
109 Ga0105245_10297901 3300009098 Bacteria 1581
110 Ga0105247_10010217 3300009101 Bacteria 5681
111 Ga0114129_10036265 3300009147 Bacteria 6964
112 Ga0105241_10007297 3300009174 Bacteria 8133
113 Ga0105241_10013321 3300009174 Bacteria 6027
114 Ga0105241_10084575 3300009174 Bacteria 2491
115 Ga0105242_10002120 3300009176 Bacteria 15650
116 Ga0105242_10038926 3300009176 Bacteria 3827
117 Ga0105237_10000125 3300009545 Bacteria 107351
118 Ga0105237_10012826 3300009545 Bacteria 8813
119 Ga0105237_10069910 3300009545 Bacteria 3506
120 Ga0105237_10091138 3300009545 Bacteria 3038
121 Ga0105249_10016397 3300009553 Bacteria 6573
122 Ga0105249_10040087 3300009553 Bacteria 4253
123 Ga0105239_10000129 3300010375 Bacteria 106549
124 Ga0105239_10001203 3300010375 Bacteria 35394
125 Ga0105239_10040062 3300010375 Bacteria 5132
126 Ga0105239_10160582 3300010375 Bacteria 2510
127 Ga0105246_10070677 3300011119 Bacteria 2455
128 Ga0105246_10280364 3300011119 Bacteria 1337
129 Ga0157373_10000156 3300013100 Bacteria 55108
130 Ga0157373_10014809 3300013100 Bacteria 5714
131 Ga0157373_10016368 3300013100 Bacteria 5411
132 Ga0157373_10025671 3300013100 Bacteria 4260
133 Ga0157373_10093757 3300013100 Bacteria 2114
134 Ga0157371_10003016 3300013102 Bacteria 15632
135 Ga0157371_10003214 3300013102 Bacteria 15001
136 Ga0157371_10011577 3300013102 Bacteria 6782
137 Ga0157371_10017182 3300013102 Bacteria 5379
138 Ga0157371_10026941 3300013102 Bacteria 4173
139 Ga0157371_10032075 3300013102 Bacteria 3781
140 Ga0157371_10064314 3300013102 Bacteria 2599
141 Ga0157371_10119583 3300013102 Bacteria 1873
142 Ga0157370_10005048 3300013104 Bacteria 14906
143 Ga0157370_10054419 3300013104 Bacteria 3814
144 Ga0157370_10070378 3300013104 Bacteria 3302
145 Ga0157370_10097135 3300013104 Bacteria 2763
146 Ga0157370_10207226 3300013104 Bacteria 1818
147 Ga0157370_10341306 3300013104 Bacteria 1381
148 Ga0157370_10475597 3300013104 Bacteria 1148
149 Ga0157369_10000039 3300013105 Bacteria 188947
150 Ga0157369_10031302 3300013105 Bacteria 5859
151 Ga0157369_10039431 3300013105 Bacteria 5162
152 Ga0157369_10239864 3300013105 Bacteria 1894
153 Ga0157369_10297476 3300013105 Bacteria 1679
154 Ga0157369_10309744 3300013105 Bacteria 1642
155 Ga0157369_10570242 3300013105 Bacteria 1169
156 Ga0157369_10777611 3300013105 Bacteria 984
157 Ga0157374_10000013 3300013296 Bacteria 461240
158 Ga0157374_10320132 3300013296 Bacteria 1537
159 Ga0157378_10005987 3300013297 Bacteria 10661
160 Ga0157378_10020798 3300013297 Bacteria 5770
161 Ga0157378_10139349 3300013297 Bacteria 2251
162 Ga0163162_10000153 3300013306 Bacteria 63805
163 Ga0163162_10060112 3300013306 Bacteria 3834
164 Ga0163162_10986333 3300013306 Bacteria 952
165 Ga0157372_10000001 3300013307 Bacteria 791349
166 Ga0157372_10000965 3300013307 Bacteria 31343
167 Ga0157372_10017690 3300013307 Bacteria 7651
168 Ga0157372_10046379 3300013307 Bacteria 4824
169 Ga0157372_10062076 3300013307 Bacteria 4185
170 Ga0157372_10082444 3300013307 Bacteria 3641
171 Ga0157372_10145062 3300013307 Bacteria 2737
172 Ga0157372_10395632 3300013307 Bacteria 1610
173 Ga0157375_10058343 3300013308 Bacteria 3818
174 Ga0157375_10071152 3300013308 Bacteria 3490
175 Ga0157375_10245304 3300013308 Bacteria 1951
176 Ga0157380_10014743 3300014326 Bacteria 5723
177 Ga0157380_10329202 3300014326 Bacteria 1420
178 Ga0157379_10154700 3300014968 Bacteria 2068
179 Ga0157376_10001450 3300014969 Bacteria 15619
180 Ga0157376_10005592 3300014969 Bacteria 8795
181 Ga0157376_10028632 3300014969 Bacteria 4430
182 Ga0163161_10033483 3300017792 Bacteria 3672
183 Ga0209646_1000002 3300025246 Bacteria 1425781
184 Ga0209026_1000086 3300025250 Bacteria 185551
185 Ga0209758_1001590 3300025297 Bacteria 25985
186 Ga0207426_1000419 3300025302 Bacteria 69963
187 Ga0207656_10022735 3300025321 Bacteria 2519
188 Ga0207710_10023473 3300025900 Bacteria 2650
189 Ga0207680_10000523 3300025903 Bacteria 18355
190 Ga0207647_10001709 3300025904 Bacteria 16864
191 Ga0207685_10149596 3300025905 Unclassified 1055
192 Ga0207705_10010201 3300025909 Bacteria 6834
193 Ga0207705_10108956 3300025909 Bacteria 2044
194 Ga0207705_10125994 3300025909 Bacteria 1904
195 Ga0207705_10187841 3300025909 Bacteria 1561
196 Ga0207654_10000412 3300025911 Bacteria 24701
197 Ga0207654_10010522 3300025911 Bacteria 4711
198 Ga0207707_10285613 3300025912 Unclassified 1428
199 Ga0207695_10000209 3300025913 Bacteria 157802
200 Ga0207695_10000300 3300025913 Bacteria 122104
201 Ga0207695_10000483 3300025913 Bacteria 85395
202 Ga0207695_10034657 3300025913 Bacteria 5486
203 Ga0207695_10261022 3300025913 Bacteria 1630
204 Ga0207671_10000112 3300025914 Bacteria 125310
205 Ga0207671_10002294 3300025914 Bacteria 20672
206 Ga0207671_10056692 3300025914 Bacteria 2903
207 Ga0207660_10021915 3300025917 Bacteria 4301
208 Ga0207657_10006445 3300025919 Bacteria 12161
209 Ga0207657_10073115 3300025919 Bacteria 2899
210 Ga0207657_10154695 3300025919 Unclassified 1866
211 Ga0207652_10001292 3300025921 Bacteria 22268
212 Ga0207652_10012635 3300025921 Bacteria 6826
213 Ga0207652_10312998 3300025921 Bacteria 1417
214 Ga0207694_10173308 3300025924 Bacteria 1747
215 Ga0207659_10092342 3300025926 Bacteria 2263
216 Ga0207659_10105747 3300025926 Bacteria 2130
217 Ga0207690_10138822 3300025932 Bacteria 1788
218 Ga0207686_10001888 3300025934 Bacteria 11604
219 Ga0207686_10261744 3300025934 Bacteria 1268
220 Ga0207670_10168815 3300025936 Bacteria 1639
221 Ga0207670_10231190 3300025936 Bacteria 1420
222 Ga0207704_10251775 3300025938 Bacteria 1326
223 Ga0207704_10378215 3300025938 Bacteria 1111
224 Ga0207689_10003921 3300025942 Bacteria 13543
225 Ga0207661_10005362 3300025944 Bacteria 9034
226 Ga0207667_10000323 3300025949 Bacteria 66327
227 Ga0207667_10010902 3300025949 Bacteria 10596
228 Ga0207667_10099521 3300025949 Bacteria 3000
229 Ga0207667_10185382 3300025949 Bacteria 2136
230 Ga0207667_10367008 3300025949 Bacteria 1468
231 Ga0207667_10670765 3300025949 Bacteria 1041
232 Ga0207651_10200506 3300025960 Bacteria 1599
233 Ga0207712_10005522 3300025961 Bacteria 7976
234 Ga0207712_10106214 3300025961 Bacteria 2097
235 Ga0207668_10236442 3300025972 Bacteria 1476
236 Ga0207668_10257639 3300025972 Bacteria 1420
237 Ga0207640_10039554 3300025981 Bacteria 2985
238 Ga0207640_10429811 3300025981 Unclassified 1083
239 Ga0207658_10014562 3300025986 Bacteria 5385
240 Ga0207658_10054609 3300025986 Bacteria 2956
241 Ga0207677_10603507 3300026023 Bacteria 963
242 Ga0207703_10000764 3300026035 Bacteria 31691
243 Ga0207703_10024583 3300026035 Bacteria 4738
244 Ga0207639_10028574 3300026041 Bacteria 4073
245 Ga0207639_10038870 3300026041 Bacteria 3542
246 Ga0207678_10006605 3300026067 Bacteria 10283
247 Ga0207678_10085694 3300026067 Bacteria 2693
248 Ga0207708_10182631 3300026075 Bacteria 1666
249 Ga0207702_10057884 3300026078 Bacteria 3296
250 Ga0207702_10472655 3300026078 Unclassified 1219
251 Ga0207641_10000087 3300026088 Bacteria 132202
252 Ga0207641_10000850 3300026088 Bacteria 32370
253 Ga0207641_10012023 3300026088 Bacteria 7101
254 Ga0207641_10050774 3300026088 Bacteria 3510
255 Ga0207648_10005920 3300026089 Bacteria 12235
256 Ga0207676_10104379 3300026095 Bacteria 2357
257 Ga0207676_10817496 3300026095 Bacteria 910
258 Ga0207674_10129058 3300026116 Bacteria 2492
259 Ga0207674_10207843 3300026116 Bacteria 1907
260 Ga0207698_10187805 3300026142 Bacteria 1837
261 Ga0207428_10150681 3300027907 Bacteria 1770
262 Ga0268264_10048188 3300028381 Bacteria 3544
263 Ga0307515_10000059 3300028794 Bacteria 257520
264 Ga0316181_1176071 3300030744 Bacteria 2668
265 Ga0307408_100002709 3300031548 Bacteria 12292
266 Ga0307408_100011289 3300031548 Bacteria 5901
267 Ga0307408_100011639 3300031548 Bacteria 5816
268 Ga0307412_10008671 3300031911 Bacteria 5813
269 Ga0307416_100469213 3300032002 Bacteria 1316
270 Ga0373925_0235819 3300037068 Bacteria 1464
271 Ga0395899_0000342 3300037312 Bacteria 57838
272 Ga0395899_0020659 3300037312 Bacteria 4992
273 Ga0395899_0043493 3300037312 Bacteria 3350
274 Ga0395899_0103888 3300037312 Bacteria 2048
275 Ga0395900_0032765 3300037418 Bacteria 5344
276 Ga0395900_0049936 3300037418 Bacteria 4310
277 Ga0395900_0157095 3300037418 Unclassified 2322
278 Ga0395900_0206825 3300037418 Bacteria 1983
279 Ga0395900_0234988 3300037418 Bacteria 1841
280 Ga0395900_0320418 3300037418 Bacteria 1531
281 Ga0395898_0055068 3300037466 Bacteria 3879
282 Ga0395898_0713511 3300037466 Bacteria 944
283 Ga0395905_0004874 3300037471 Bacteria 13829
284 Ga0395905_0625541 3300037471 Bacteria 978
285 Ga0395901_0296705 3300038443 Unclassified 1676
286 Ga0395901_0299486 3300038443 Bacteria 1667
287 Ga0395901_0469585 3300038443 Bacteria 1284
288 Ga0395901_0770592 3300038443 Bacteria 953
289 Ga0439449_0022930 3300042007 Bacteria 2336
290 Ga0450898_005089 3300042134 Unclassified 1970
291 Ga0450918_036033 3300042531 Bacteria 881
292 Ga0466969_0086013 3300044656 Bacteria 1494
293 Ga0466966_0012472 3300044684 Bacteria 5630
294 Ga0466961_0018534 3300044693 Bacteria 4479
295 Ga0466961_0057520 3300044693 Bacteria 2475
296 Ga0453684_0254600 3300044712 Bacteria 2014
297 Ga0466971_0041572 3300044719 Bacteria 2065
298 Ga0466970_0039776 3300044765 Bacteria 2496
299 Ga0466957_0079479 3300044842 Bacteria 2041
300 Ga0466959_0008177 3300045049 Bacteria 7383
301 Ga0466958_0077770 3300045836 Bacteria 2038
302 Ga0466958_0080477 3300045836 Bacteria 2004
303 Ga0495611_0000244 3300046648 Bacteria 37825
304 Ga0495649_0044918 3300046694 Bacteria 2411
305 Ga0495672_0076089 3300047320 Bacteria 1886
306 Ga0501033_0204280 3300049570 Bacteria 1410
307 Ga0501034_0058568 3300049571 Bacteria 3871
308 Ga0501034_0360199 3300049571 Unclassified 1382
309 Ga0501043_0026995 3300049579 Bacteria 4506
310 Ga0501070_0048805 3300049586 Unclassified 3516
311 Ga0501223_000634 3300049663 Bacteria 8431
312 Ga0501259_003308 3300049688 Bacteria 2574
313 Ga0501044_0077668 3300049823 Bacteria 3367
314 Ga0501044_0161003 3300049823 Bacteria 2221
315 nmdc:mga0k408_286197_c1 3300050493 Bacteria 984
316 nmdc:mga05p37_47394_c1 3300050507 Bacteria 5285
317 nmdc:mga09592_23381_c1 3300050508 Bacteria 5105
318 nmdc:mga06r32_38123_c1 3300050510 Unclassified 4551
319 nmdc:mga08y16_862729_c1 3300050511 Bacteria 894
320 Ga0500583_0000073 3300053092 Bacteria 60111
321 Ga0500583_0105255 3300053092 Bacteria 1385
322 Ga0500568_0001011 3300053139 Bacteria 19249
323 Ga0466962_0069268 3300061719 Bacteria 1685
324 2522551359 2522125168 Bacteria 7376607
325 8003154361 8003151029 Bacteria 8187759
326 Ga0068869_100009577
327 JGI24740J21852_10002630
328 JGI24739J22299_10010586
329 JGI25154J39366_1000007
330 JGI25153J46596_10000504
331 rootH2_10000086
332 rootH2_10011701
333 rootH2_10012061
334 rootH2_10130711
335 rootL2_10058418
336 JGI25160J50197_1005566
337 Ga0065712_10068858
338 Ga0065712_10140653
339 Ga0070658_10038567
340 Ga0070658_10130421
341 Ga0070676_10091106
342 Ga0070683_100023035
343 Ga0068869_100423281
344 Ga0070666_10000156
345 Ga0070680_100002502
346 Ga0068868_100130119
347 Ga0070660_100002765
348 Ga0070660_100063058
349 Ga0070660_100165811
350 Ga0070660_100257896
351 Ga0070689_100074210
352 Ga0070689_100160676
353 Ga0070691_10026315
354 Ga0070691_10032087
355 Ga0070668_100132745
356 Ga0070668_100525832
357 Ga0070669_100114341
358 Ga0070675_100450576
359 Ga0070671_100039395
360 Ga0070659_100008306
361 Ga0070659_100024655
362 Ga0070659_100480482
363 Ga0070667_100103146
364 Ga0070667_100138852
365 Ga0070663_100005240
366 Ga0070663_100007631
367 Ga0070663_100122385
368 Ga0070681_10005612
369 Ga0070681_10043871
370 Ga0068867_100062659
371 Ga0070685_10006615
372 Ga0070679_100076781
373 Ga0070679_100081152
374 Ga0070679_100325299
375 Ga0070684_100083955
376 Ga0070684_100396569
377 Ga0068853_100008359
378 Ga0068853_100108434
379 Ga0068855_100011365
380 Ga0068855_100045137
381 Ga0068855_100059205
382 Ga0068855_100114823
383 Ga0068855_100370342
384 Ga0068855_100390567
385 Ga0068855_100731917
386 Ga0068857_100194065
387 Ga0068857_100480919
388 Ga0068854_100103631
389 Ga0068856_100011272
390 Ga0068856_100046985
391 Ga0068852_100006114
392 Ga0068852_100135577
393 Ga0068852_100213697
394 Ga0068852_100350768
395 Ga0068852_100816483
396 Ga0068852_100865497
397 Ga0068859_100000024
398 Ga0068859_100009051
399 Ga0068859_100813144
400 Ga0068864_100112016
401 Ga0068864_100207604
402 Ga0068851_10014050
403 Ga0068863_100005289
404 Ga0068863_100013768
405 Ga0068863_100021533
406 Ga0068863_100027954
407 Ga0068858_100001337
408 Ga0068858_100024689
409 Ga0068860_100063456
410 Ga0081540_1002517
411 Ga0070715_10101088
412 Ga0075366_10259975
413 Ga0097621_100011501
414 Ga0097621_100012295
415 Ga0097621_100070799
416 Ga0097621_100320578
417 Ga0097621_100463759
418 Ga0068871_100008693
419 Ga0068871_100162650
420 Ga0075428_100282979
421 Ga0075431_100070989
422 Ga0075429_100005482
423 Ga0068865_100337333
424 Ga0068865_100646166
425 Ga0097620_100000024
426 Ga0097620_100009051
427 Ga0097620_100813248
428 Ga0105240_10001825
429 Ga0105240_10003650
430 Ga0105240_10049758
431 Ga0105240_10061512
432 Ga0111539_10030420
433 Ga0111539_10112304
434 Ga0105245_10297901
435 Ga0105247_10010217
436 Ga0114129_10036265
437 Ga0105241_10007297
438 Ga0105241_10013321
439 Ga0105241_10084575
440 Ga0105242_10002120
441 Ga0105242_10038926
442 Ga0105237_10000125
443 Ga0105237_10012826
444 Ga0105237_10069910
445 Ga0105237_10091138
446 Ga0105249_10016397
447 Ga0105249_10040087
448 Ga0105239_10000129
449 Ga0105239_10001203
450 Ga0105239_10040062
451 Ga0105239_10160582
452 Ga0105246_10070677
453 Ga0105246_10280364
454 Ga0157373_10000156
455 Ga0157373_10014809
456 Ga0157373_10016368
457 Ga0157373_10025671
458 Ga0157373_10093757
459 Ga0157371_10003016
460 Ga0157371_10003214
461 Ga0157371_10011577
462 Ga0157371_10017182
463 Ga0157371_10026941
464 Ga0157371_10032075
465 Ga0157371_10064314
466 Ga0157371_10119583
467 Ga0157370_10005048
468 Ga0157370_10054419
469 Ga0157370_10070378
470 Ga0157370_10097135
471 Ga0157370_10207226
472 Ga0157370_10341306
473 Ga0157370_10475597
474 Ga0157369_10000039
475 Ga0157369_10031302
476 Ga0157369_10039431
477 Ga0157369_10239864
478 Ga0157369_10297476
479 Ga0157369_10309744
480 Ga0157369_10570242
481 Ga0157369_10777611
482 Ga0157374_10000013
483 Ga0157374_10320132
484 Ga0157378_10005987
485 Ga0157378_10020798
486 Ga0157378_10139349
487 Ga0163162_10000153
488 Ga0163162_10060112
489 Ga0163162_10986333
490 Ga0157372_10000001
491 Ga0157372_10000965
492 Ga0157372_10017690
493 Ga0157372_10046379
494 Ga0157372_10062076
495 Ga0157372_10082444
496 Ga0157372_10145062
497 Ga0157372_10395632
498 Ga0157375_10058343
499 Ga0157375_10071152
500 Ga0157375_10245304
501 Ga0157380_10014743
502 Ga0157380_10329202
503 Ga0157379_10154700
504 Ga0157376_10001450
505 Ga0157376_10005592
506 Ga0157376_10028632
507 Ga0163161_10033483
508 Ga0209646_1000002
509 Ga0209026_1000086
510 Ga0209758_1001590
511 Ga0207426_1000419
512 Ga0207656_10022735
513 Ga0207710_10023473
514 Ga0207680_10000523
515 Ga0207647_10001709
516 Ga0207685_10149596
517 Ga0207705_10010201
518 Ga0207705_10108956
519 Ga0207705_10125994
520 Ga0207705_10187841
521 Ga0207654_10000412
522 Ga0207654_10010522
523 Ga0207707_10285613
524 Ga0207695_10000209
525 Ga0207695_10000300
526 Ga0207695_10000483
527 Ga0207695_10034657
528 Ga0207695_10261022
529 Ga0207671_10000112
530 Ga0207671_10002294
531 Ga0207671_10056692
532 Ga0207660_10021915
533 Ga0207657_10006445
534 Ga0207657_10073115
535 Ga0207657_10154695
536 Ga0207652_10001292
537 Ga0207652_10012635
538 Ga0207652_10312998
539 Ga0207694_10173308
540 Ga0207659_10092342
541 Ga0207659_10105747
542 Ga0207690_10138822
543 Ga0207686_10001888
544 Ga0207686_10261744
545 Ga0207670_10168815
546 Ga0207670_10231190
547 Ga0207704_10251775
548 Ga0207704_10378215
549 Ga0207689_10003921
550 Ga0207661_10005362
551 Ga0207667_10000323
552 Ga0207667_10010902
553 Ga0207667_10099521
554 Ga0207667_10185382
555 Ga0207667_10367008
556 Ga0207667_10670765
557 Ga0207651_10200506
558 Ga0207712_10005522
559 Ga0207712_10106214
560 Ga0207668_10236442
561 Ga0207668_10257639
562 Ga0207640_10039554
563 Ga0207640_10429811
564 Ga0207658_10014562
565 Ga0207658_10054609
566 Ga0207677_10603507
567 Ga0207703_10000764
568 Ga0207703_10024583
569 Ga0207639_10028574
570 Ga0207639_10038870
571 Ga0207678_10006605
572 Ga0207678_10085694
573 Ga0207708_10182631
574 Ga0207702_10057884
575 Ga0207702_10472655
576 Ga0207641_10000087
577 Ga0207641_10000850
578 Ga0207641_10012023
579 Ga0207641_10050774
580 Ga0207648_10005920
581 Ga0207676_10104379
582 Ga0207676_10817496
583 Ga0207674_10129058
584 Ga0207674_10207843
585 Ga0207698_10187805
586 Ga0207428_10150681
587 Ga0268264_10048188
588 Ga0307515_10000059
589 Ga0316181_1176071
590 Ga0307408_100002709
591 Ga0307408_100011289
592 Ga0307408_100011639
593 Ga0307412_10008671
594 Ga0307416_100469213
595 Ga0373925_0235819
596 Ga0395899_0000342
597 Ga0395899_0020659
598 Ga0395899_0043493
599 Ga0395899_0103888
600 Ga0395900_0032765
601 Ga0395900_0049936
602 Ga0395900_0157095
603 Ga0395900_0206825
604 Ga0395900_0234988
605 Ga0395900_0320418
606 Ga0395898_0055068
607 Ga0395898_0713511
608 Ga0395905_0004874
609 Ga0395905_0625541
610 Ga0395901_0296705
611 Ga0395901_0299486
612 Ga0395901_0469585
613 Ga0395901_0770592
614 Ga0439449_0022930
615 Ga0450898_005089
616 Ga0450918_036033
617 Ga0466969_0086013
618 Ga0466966_0012472
619 Ga0466961_0018534
620 Ga0466961_0057520
621 Ga0453684_0254600
622 Ga0466971_0041572
623 Ga0466970_0039776
624 Ga0466957_0079479
625 Ga0466959_0008177
626 Ga0466958_0077770
627 Ga0466958_0080477
628 Ga0495611_0000244
629 Ga0495649_0044918
630 Ga0495672_0076089
631 Ga0501033_0204280
632 Ga0501034_0058568
633 Ga0501034_0360199
634 Ga0501043_0026995
635 Ga0501070_0048805
636 Ga0501223_000634
637 Ga0501259_003308
638 Ga0501044_0077668
639 Ga0501044_0161003
640 nmdc:mga0k408_286197_c1
641 nmdc:mga05p37_47394_c1
642 nmdc:mga09592_23381_c1
643 nmdc:mga06r32_38123_c1
644 nmdc:mga08y16_862729_c1
645 Ga0500583_0000073
646 Ga0500583_0105255
647 Ga0500568_0001011
648 Ga0466962_0069268
649 2522551359
650 8003154361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

43

248

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dt0-assembly3.cif.gz_D proline hydroxylase h11-n101i mutant 0.8612 5 246
8h7y-assembly1.cif.gz_A trans-3/4-proline-hydroxylase h11 with akg and l-proline 0.851 6 246
8h81-assembly1.cif.gz_A trans-3/4-proline-hydroxylase h11 with 4-hydroxyl-proline 0.8488 1 246
7e09-assembly1.cif.gz_A-2 trans-3/4-proline-hydroxylase h11 with 3-hydroxyl-proline 0.8488 1 246
5ep9-assembly2.cif.gz_B crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.8439 9 227
ID Description Score Start End Superfamily
af_A8E5P7_122_256_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8225 113 235 2.60.120.620
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7816 9 247 2.60.120.620
af_A4HS32_63_336_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7738 7 228 2.60.120.620
af_C7FZX0_9_206_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7716 95 226 2.60.120.620
2a1xA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7707 4 228 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A1M7NW12-F1-model_v4 Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family 0.9731 2 275 GO:0005506
GO:0016706
AF-A0A2Z4G9F2-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9689 5 275 GO:0005506
GO:0016706
AF-A0A4Q3SDZ0-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9663 1 225 GO:0005506
GO:0016706
AF-A0A2Z4G9F2-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9654 5 275 GO:0005506
GO:0016706
AF-A0A7W1W231-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9644 1 235 GO:0005506
GO:0016706

Map